{ "uniprot_canonical_ac": "A2RRT9-1", "uniprot_ac": "A2RRT9", "uniprot_id": "CP4V2_RAT", "mass": { "chemical_mass": 60580.0, "monoisotopic_mass": 60580.0 }, "refseq": { "ac": "NP_001129072", "name": "cytochrome P450 4V2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072" }, "gene_names": [ { "name": "Cyp4v2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2RRT9", "id": "A2RRT9" }, { "name": "Cyp4v2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072", "id": "NP_001129072" }, { "name": "Cyp4v3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072", "id": "NP_001129072" }, { "name": "Cyp4v3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RRT9", "id": "A2RRT9" } ], "protein_names": [ { "name": "Cytochrome P450 4V2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2RRT9#names_and_taxonomy", "id": "A2RRT9" }, { "name": "1.14.14.79", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RRT9#names_and_taxonomy", "id": "A2RRT9" }, { "name": "1.14.14.80", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RRT9#names_and_taxonomy", "id": "A2RRT9" }, { "name": "Docosahexaenoic acid omega-hydroxylase CYP4V2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RRT9#names_and_taxonomy", "id": "A2RRT9" }, { "name": "Long-chain fatty acid omega-monooxygenase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RRT9#names_and_taxonomy", "id": "A2RRT9" }, { "name": "cytochrome P450 4V2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072", "id": "NP_001129072" }, { "name": "cytochrome P450 4V3; cytochrome P450-like protein; docosahexaenoic acid omega-hydroxylase CYP4V2; long-chain fatty acid omega-monooxygenase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072", "id": "NP_001129072" } ], "function": [ { "annotation": "A cytochrome P450 monooxygenase involved in fatty acid metabolism in the eye. Catalyzes the omega-hydroxylation of polyunsaturated fatty acids (PUFAs) docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), and may contribute to the homeostasis of these retinal PUFAs. Omega hydroxylates saturated fatty acids such as laurate, myristate and palmitate, the catalytic efficiency decreasing in the following order: myristate > laurate > palmitate (C14>C12>C16). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9#function" } ] }, { "annotation": "Tissue kallikrein mRNA expression is increased during prenatal and early postnatal development stages in rat brain.", "evidence": [ { "database": "RefSeq", "id": "NP_001129072", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072" } ] } ], "disease": [ { "disease_id": "DOID:0050664", "recommended_name": { "id": "DOID:0050664", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050664", "name": "Bietti crystalline corneoretinal dystrophy", "description": "A retinal degeneration that is characterized by crystals in the cornea, shiny deposits on the retina and progressive atrophy of the retina, choriocapillaris and choroid, has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the CYP4V2 gene on chromosome 4q35." }, "synonyms": [ { "id": "DOID:0050664", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050664", "name": "Bietti's crystalline dystrophy", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti crystalline corneoretinal dystrophy", "description": "Bietti's crystalline dystrophy (BCD) is a rare progressive autosomal recessive tapetoretinal degeneration disease, occurring in the third decade of life, characterized by small sparkling crystalline deposits in the posterior retina and corneal limbus in addition to sclerosis of the choroidal vessels and manifesting as nightblindness, decreased vision, paracentral scotoma, and, in the end stages of the disease, legal blindness." }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti crystalline retinopathy", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti tapetoretinal Degeneration with marginal corneal dystrophy", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti crystalline dystrophy", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti's crystalline dystrophy", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "BCD", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti crystalline corneoretinal dystrophy", "description": "" }, { "id": "MONDO:0008865", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008865", "name": "Bietti crystalline corneoretinal dystrophy; BCD", "description": "" }, { "id": "MIM:210370", "resource": "MIM", "url": "https://www.omim.org/entry/210370", "name": "Bietti crystalline corneoretinal dystrophy", "description": "Bietti crystalline corneoretinal dystrophy" } ], "evidence": [ { "id": "0050664", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/gene/0050664#disease-associations" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cyp4v2", "url": "https://www.uniprot.org/uniprot/A2RRT9", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000042426", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000042426", "database": "Bgee" }, { "id": "266761", "url": "https://www.ncbi.nlm.nih.gov/gene/266761", "database": "GeneID" }, { "id": "IPR001128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001128", "database": "InterPro" }, { "id": "IPR002401", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002401", "database": "InterPro" }, { "id": "IPR017972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017972", "database": "InterPro" }, { "id": "IPR036396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036396", "database": "InterPro" }, { "id": "rno:266761", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:266761", "database": "KEGG Pathway" }, { "id": "IQPAFHK", "url": "https://omabrowser.org/oma/group/IQPAFHK/", "database": "OMA" }, { "id": "1247045at2759", "url": "http://www.orthodb.org/?query=1247045at2759", "database": "OrthoDB" }, { "id": "PF00067", "url": "http://pfam.xfam.org/family/PF00067", "database": "Pfam" }, { "id": "PR_A2RRT9", "url": "http://purl.obolibrary.org/obo/PR_PR_A2RRT9", "database": "PRO" }, { "id": "R-RNO-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211976", "database": "Reactome" }, { "id": "R-RNO-2453902", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2453902", "database": "Reactome" }, { "id": "NP_001129072", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072", "database": "RefSeq" }, { "id": "708530", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=708530", "database": "RGD" }, { "id": "38947", "url": "https://www.rhea-db.org/rhea/38947", "database": "Rhea" }, { "id": "39791", "url": "https://www.rhea-db.org/rhea/39791", "database": "Rhea" }, { "id": "40155", "url": "https://www.rhea-db.org/rhea/40155", "database": "Rhea" }, { "id": "40199", "url": "https://www.rhea-db.org/rhea/40199", "database": "Rhea" }, { "id": "40203", "url": "https://www.rhea-db.org/rhea/40203", "database": "Rhea" }, { "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9", "database": "UniProtKB" }, { "id": "A2RRT9-1", "url": "https://www.uniprot.org/uniprot/A2RRT9-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MLWLWLGLSGQKLLLWGAASAVSVAGATVLLNILQMLVSYARKWQQMRPIPSVARAYPLVGHALFMKPNNTEFFQQIIQYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDKSFMYKFLQPWLGLGLLTSTGSKWRARRKMLTPSFHFTILEDFLDVMNEQANILVNKLEKHVNQEAFNCFFPITLCALDIICETAMGKNIGAQSNGDSEYVRTVYRMSDMIYRRMKMPWFWFDLWYLMFKEGRDHKKGLKSLHTFTNNVIAERVNARKAEQDCIGAGRGPLPSKTKRKAFLDLLLSVTDEEGNKLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQRKVDKELDDVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVAGYKISKGTEAVIIPYALHRDPRYFPDPEEFQPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILACILREFWIESNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP", "length": 525, "header": "sp|A2RRT9-1|CP4V2_RAT Isoform 1 of Cytochrome P450 4V2 OS=Rattus norvegicus OX=10116 GN=Cyp4v2 PE=2 SV=1 CANONICAL=A2RRT9-1" }, "isoforms": [ { "isoform_ac": "A2RRT9-1", "url": "https://www.uniprot.org/uniprot/A2RRT9#A2RRT9-1", "sequence": { "sequence": "MLWLWLGLSGQKLLLWGAASAVSVAGATVLLNILQMLVSYARKWQQMRPIPSVARAYPLVGHALFMKPNNTEFFQQIIQYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDKSFMYKFLQPWLGLGLLTSTGSKWRARRKMLTPSFHFTILEDFLDVMNEQANILVNKLEKHVNQEAFNCFFPITLCALDIICETAMGKNIGAQSNGDSEYVRTVYRMSDMIYRRMKMPWFWFDLWYLMFKEGRDHKKGLKSLHTFTNNVIAERVNARKAEQDCIGAGRGPLPSKTKRKAFLDLLLSVTDEEGNKLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQRKVDKELDDVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVAGYKISKGTEAVIIPYALHRDPRYFPDPEEFQPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILACILREFWIESNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP", "length": 525, "header": "sp|A2RRT9-1|CP4V2_RAT Isoform 1 of Cytochrome P450 4V2 OS=Rattus norvegicus OX=10116 GN=Cyp4v2 PE=2 SV=1 CANONICAL=A2RRT9-1" }, "locus": { "chromosome": "16", "start_pos": 50135365, "end_pos": 50112044, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000019302", "url": "https://www.ensembl.org/id/ENSRNOT00000019302" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000019302", "url": "https://www.ensembl.org/id/ENSRNOP00000019302" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Expression of tissue kallikrein mRNA in developing rat brains.", "journal": "Canadian journal of physiology and pharmacology", "date": "2002", "authors": "Iwadate H, Kudo M, Kizuki K", "evidence": [ { "database": "RefSeq", "id": "NP_001129072", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129072" } ], "reference": [ { "type": "PubMed", "id": "12025956", "url": "https://www.ncbi.nlm.nih.gov/pubmed/12025956" } ] } ], "pathway": [ { "id": "rno:266761", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:266761", "resource": "KEGG Pathway" }, { "id": "R-RNO-211976", "name": "Endogenous sterols", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211976", "resource": "Reactome", "description": "Endogenous sterols" }, { "id": "R-RNO-2453902", "name": "The canonical retinoid cycle in rods (twilight vision)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2453902", "resource": "Reactome", "description": "The canonical retinoid cycle in rods (twilight vision)" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6ZWL3-1", "protein_name": "Cytochrome P450 4V2", "gene_name": "CYP4V2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER", "length": 525 }, "evidence": [ { "id": "133054", "url": "http://www.informatics.jax.org/homology/133054", "database": "MGI" }, { "id": "A2RRT9", "url": "https://omabrowser.org/oma/group/A2RRT9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9DBW0-1", "protein_name": "Cytochrome P450 4V2", "gene_name": "Cyp4v2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLWLWLGLSGQKLLLWGAASAVSLAGATILISIFPMLVSYARKWQQMRSIPSVARAYPLVGHALYMKPNNAEFFQQLIYYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDKSFLYKFLQPWLGLGLLTSTGSKWRTRRKMLTPTFHFTILENFLDVMNEQANILVNKLEKHVNQEAFNCFFYITLCALDIICETAMGKNIGAQSNNDSEYVRTVYRMSDMIYRRMKMPWLWFDLWYLVFKEGRDHKRGLKCLHTFTNNVIAERVKERKAEEDWTGAGRGPIPSKNKRKAFLDLLLSVTDEEGNRLSQEDIREEVDTFMFEGHDTTAAAINWSLYLLGTNPEVQRKVDQELDEVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVGGYKVTKGTEAIIIPYALHRDPRYFPDPEEFRPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILACILRQFWVESNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP", "length": 525 }, "evidence": [ { "id": "133054", "url": "http://www.informatics.jax.org/homology/133054", "database": "MGI" }, { "id": "A2RRT9", "url": "https://omabrowser.org/oma/group/A2RRT9/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" }, { "name": "monooxygenase activity", "id": "GO:0004497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004497", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" }, { "name": "long-chain fatty acid omega-hydroxylase activity", "id": "GO:0102033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102033", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "integral component of membrane", "id": "GO:0016021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "fatty acid omega-oxidation", "id": "GO:0010430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010430", "evidence": [ { "database": "UniProtKB", "id": "A2RRT9", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 339, "end_pos": 341, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "38947", "name": "", "equation": "dodecanoate + O2 + reduced [NADPH--hemoprotein reductase] = 12-hydroxydodecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2RRT9-1", "P08516-1", "P20816-1", "P20817-1", "P24464-1", "Q6ZWL3-1", "Q9HBI6-1", "Q02928-1", "Q91WL5-1", "A2A974-1", "Q9DBW0-1", "O88833-1" ], "evidence": [ { "id": "38947", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38947" } ] }, { "id": "39791", "name": "", "equation": "(5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-(5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2RRT9-1", "Q6ZWL3-1", "Q08477-1", "P78329-1", "Q91WL5-1", "A2A974-1", "Q9DBW0-1" ], "evidence": [ { "id": "39791", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39791" } ] }, { "id": "40155", "name": "", "equation": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2RRT9-1", "Q6ZWL3-1", "Q08477-1", "P78329-1", "Q9HBI6-1", "Q9DBW0-1" ], "evidence": [ { "id": "40155", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40155" } ] }, { "id": "40199", "name": "", "equation": "hexadecanoate + O2 + reduced [NADPH--hemoprotein reductase] = 16-hydroxyhexadecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2RRT9-1", "P08516-1", "P20816-1", "Q6ZWL3-1", "Q9HBI6-1", "Q02928-1", "Q9DBW0-1", "O88833-1" ], "evidence": [ { "id": "40199", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40199" } ] }, { "id": "40203", "name": "", "equation": "O2 + reduced [NADPH--hemoprotein reductase] + tetradecanoate = 14-hydroxytetradecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2RRT9-1", "P08516-1", "P20816-1", "P20817-1", "Q6ZWL3-1", "Q02928-1", "Q9DBW0-1", "O88833-1" ], "evidence": [ { "id": "40203", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40203" } ] }, { "id": "R-RNO-6786239", "name": "CYP4V2 omega-hydroxylates DHA to HDoHE", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-6786220" ], "output_participant_list": [ "R-ALL-6786225" ], "enzyme_list": [ "A2RRT9-1" ], "evidence": [ { "id": "R-RNO-6786239", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6786239" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-6786220", "participant_name": "DHA [endoplasmic reticulum membrane]", "crossref": [ { "id": "36005", "database": "ChEBI", "url": "" }, { "id": "36005", "database": "ChEBI", "url": "" }, { "id": "36005", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-6786225", "participant_name": "hydroxydocosahexaenoic acid [endoplasmic reticulum membrane]", "crossref": [ { "id": "72790", "database": "ChEBI", "url": "" }, { "id": "72790", "database": "ChEBI", "url": "" }, { "id": "72790", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2A974", "gene_name": "Cyp4a12b", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "A2A974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A974" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "A2A974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A974" } ] } ] }, { "uniprot_ac": "A2RRT9", "gene_name": "Cyp4v2", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "A2RRT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ] }, { "ec_number": "1.14.14.79", "activity": "Docosahexaenoate + [reduced NADPH--hemoprotein reductase] + O(2) = 22-hydroxydocosahexaenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "A2RRT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RRT9" } ] } ] }, { "uniprot_ac": "O88833", "gene_name": "Cyp4a10", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "O88833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88833" } ] } ] }, { "uniprot_ac": "P08516", "gene_name": "Cyp4a10", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P08516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08516" } ] } ] }, { "uniprot_ac": "P20816", "gene_name": "Cyp4a2", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P20816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20816" } ] } ] }, { "uniprot_ac": "P20817", "gene_name": "Cyp4a14", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P20817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20817" } ] } ] }, { "uniprot_ac": "P24464", "gene_name": "Cyp4a12", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P24464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24464" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24464" } ] } ] }, { "uniprot_ac": "P78329", "gene_name": "CYP4F2", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.78", "activity": "Phylloquinone + [reduced NADPH--hemoprotein reductase] + O(2) = omega-hydroxyphylloquinone + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.79", "activity": "Docosahexaenoate + [reduced NADPH--hemoprotein reductase] + O(2) = 22-hydroxydocosahexaenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.94", "activity": "(6Z,8E,10E,14Z)-(5S,12R)-5,12-dihydroxyicosa-6,8,10,14-tetraenoate + [reduced NADPH--hemoprotein reductase] + O(2) = (6Z,8E,10E,14Z)-(5S,12R)-5,12,20-trihydroxyicosa-6,8,10,14-tetraenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] } ] }, { "uniprot_ac": "Q02928", "gene_name": "CYP4A11", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q02928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02928" } ] }, { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q02928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02928" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q02928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02928" } ] } ] }, { "uniprot_ac": "Q08477", "gene_name": "CYP4F3", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.79", "activity": "Docosahexaenoate + [reduced NADPH--hemoprotein reductase] + O(2) = 22-hydroxydocosahexaenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.94", "activity": "(6Z,8E,10E,14Z)-(5S,12R)-5,12-dihydroxyicosa-6,8,10,14-tetraenoate + [reduced NADPH--hemoprotein reductase] + O(2) = (6Z,8E,10E,14Z)-(5S,12R)-5,12,20-trihydroxyicosa-6,8,10,14-tetraenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] } ] }, { "uniprot_ac": "Q6ZWL3", "gene_name": "CYP4V2", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q6ZWL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWL3" } ] }, { "ec_number": "1.14.14.79", "activity": "Docosahexaenoate + [reduced NADPH--hemoprotein reductase] + O(2) = 22-hydroxydocosahexaenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q6ZWL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWL3" } ] } ] }, { "uniprot_ac": "Q91WL5", "gene_name": "Cyp4a12a", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q91WL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WL5" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q91WL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WL5" } ] } ] }, { "uniprot_ac": "Q9DBW0", "gene_name": "Cyp4v2", "activity": [ { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q9DBW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBW0" } ] }, { "ec_number": "1.14.14.79", "activity": "Docosahexaenoate + [reduced NADPH--hemoprotein reductase] + O(2) = 22-hydroxydocosahexaenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q9DBW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBW0" } ] } ] }, { "uniprot_ac": "Q9HBI6", "gene_name": "CYP4F11", "activity": [ { "ec_number": "1.14.14.1", "activity": "RH + [reduced NADPH--hemoprotein reductase] + O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.80", "activity": "A long-chain fatty acid + [reduced NADPH--hemoprotein reductase] + O(2) = an omega-hydroxy-long-chain fatty acid + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.78", "activity": "Phylloquinone + [reduced NADPH--hemoprotein reductase] + O(2) = omega-hydroxyphylloquinone + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.79", "activity": "Docosahexaenoate + [reduced NADPH--hemoprotein reductase] + O(2) = 22-hydroxydocosahexaenoate + [oxidized NADPH--hemoprotein reductase] + H(2)O.", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ] }