[ { "uniprot_canonical_ac": "P68431-1", "uniprot_ac": "P68431", "uniprot_id": "H31_HUMAN", "mass": { "chemical_mass": 15404.0, "monoisotopic_mass": 15404.0 }, "refseq": { "ac": "NP_003520", "name": "histone H3.1", "summary": "Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" }, "gene_names": [ { "name": "H3C10", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C11", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C12", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C1", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C2", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C3", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C4", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C6", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C7", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3C8", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3/A", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "H3C1", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "H3FA", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" }, { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FB", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FC HIST1H3C", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FD", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FF", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FH", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FI", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FJ", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FK", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "H3FL", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3A", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" }, { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3B", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3D", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3E", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3F", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3G", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3H", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3I", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] }, { "name": "HIST1H3J", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431" } ] } ], "protein_names": [ { "name": "Histone H3.1", "type": "recommended", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "H3 histone family, member A", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "Histone H3/a", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/b", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/c", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/d", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/f", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/h", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/i", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/j", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/k", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "Histone H3/l", "type": "synonym", "evidence": [ { "id": "P68431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#names_and_taxonomy" } ] }, { "name": "histone 1, H3a", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "histone H3.1", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "histone H3/a", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "histone cluster 1 H3 family member a", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "name": "histone cluster 1, H3a", "type": "synonym", "evidence": [ { "id": "NP_003520", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431#function" } ] }, { "annotation": "Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_003520", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ] }, { "annotation": "Macrophage MCT4 inhibition activates reparative genes and protects from atherosclerosis by histone H3 lysine 18 lactylation. Erratum:[Cell Rep. 2024 Oct 22;43(10):114884. doi: 10.1016/j.celrep.2024.114884. PMID: 39392757]", "evidence": [ { "database": "RefSeq", "id": "NP_003520", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" }, { "database": "PubMed", "id": "38733581", "url": "https://glygen.org/publication/PubMed/38733581" } ] } ], "disease": [ { "disease_id": "DOID:3070", "recommended_name": { "id": "DOID:3070", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3070", "name": "high grade glioma", "description": "A cell type cancer that has_material_basis_in glial cells and is located in brain or located in spine." }, "synonyms": [ { "id": "DOID:3070", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3070", "name": "Neuroglial tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3070", "name": "glial cell tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3070", "name": "glioma, malignant", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3070", "name": "malignant Neuroglial tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3070", "name": "malignant glioma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "GLM1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma, susceptibility to, somatic", "description": "" }, { "id": "MIM:137800", "resource": "MIM", "url": "https://www.omim.org/entry/137800", "name": "Glioma 1", "description": "Glioma 1" } ], "unlinked_id_list": [ "DOID:0080879" ], "evidence": [ { "id": "3070", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3070" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "47.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "54.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "57.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "26.53", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "36.93", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "23.58", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "44.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "52.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "38.48", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "40.24", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0700275", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700275", "name": "prostate cancer, hereditary", "description": "An instance of prostate cancer that is caused by an inherited genomic modification in an individual. Familial prostate cancer (FPC) is a malignant tumor of the prostate with an early onset. FPC is either asymptomatic or causes mictionary symptoms, erectile dysfunction, bone pain, venous compression and infectious or inflammatory syndrome (for the metastatic forms). It is also characterized by familial antecedents." }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:610997", "resource": "MIM", "url": "https://www.omim.org/entry/610997", "name": "Prostate cancer, hereditary, 9", "description": "Prostate cancer, hereditary, 9" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "GC", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ], "unlinked_id_list": [ "DOID:1542" ], "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "unlinked_id_list": [ "DOID:4765" ], "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:3017", "DOID:0050938" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3973", "DOID:0080524", "DOID:0080525" ], "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3675", "DOID:4455" ], "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P68431", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P68431" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "H3C6", "url": "https://www.uniprot.org/uniprotkb/P68431", "locus": { "chromosome": "6", "start_pos": 26227473, "end_pos": 26224199, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000274750", "url": "https://www.ensembl.org/id/ENSG00000274750" } ] } } ], "crossref": [ { "id": "HGNC:4766", "url": "https://alliancegenome.org/gene/HGNC:4766", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4767", "url": "https://alliancegenome.org/gene/HGNC:4767", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4768", "url": "https://alliancegenome.org/gene/HGNC:4768", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4769", "url": "https://alliancegenome.org/gene/HGNC:4769", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4771", "url": "https://alliancegenome.org/gene/HGNC:4771", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4772", "url": "https://alliancegenome.org/gene/HGNC:4772", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4773", "url": "https://alliancegenome.org/gene/HGNC:4773", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4774", "url": "https://alliancegenome.org/gene/HGNC:4774", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4775", "url": "https://alliancegenome.org/gene/HGNC:4775", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "HGNC:4776", "url": "https://alliancegenome.org/gene/HGNC:4776", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "P68431", "url": "https://alphafold.ebi.ac.uk/entry/P68431", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSG00000197153", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197153", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "AN6379-1", "url": "https://biomarkerkb.org/biomarker/AN6379-1", "database": "BiomarkerKB", "categories": [ "Biomarkers" ] }, { "id": "AN6379-2", "url": "https://biomarkerkb.org/biomarker/AN6379-2", "database": "BiomarkerKB", "categories": [ "Biomarkers" ] }, { "id": "AN6379-3", "url": "https://biomarkerkb.org/biomarker/AN6379-3", "database": "BiomarkerKB", "categories": [ "Biomarkers" ] }, { "id": "P68431", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P68431", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd22911", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22911", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "H3C1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C10", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C10", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C11", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C11", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C12", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C12", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C2", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C3", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C4", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C6", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C6", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C7", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "H3C8", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3C8", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "8350", "url": "https://www.ncbi.nlm.nih.gov/gene/8350", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8351", "url": "https://www.ncbi.nlm.nih.gov/gene/8351", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8352", "url": "https://www.ncbi.nlm.nih.gov/gene/8352", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8353", "url": "https://www.ncbi.nlm.nih.gov/gene/8353", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8354", "url": "https://www.ncbi.nlm.nih.gov/gene/8354", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8355", "url": "https://www.ncbi.nlm.nih.gov/gene/8355", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8356", "url": "https://www.ncbi.nlm.nih.gov/gene/8356", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8357", "url": "https://www.ncbi.nlm.nih.gov/gene/8357", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8358", "url": "https://www.ncbi.nlm.nih.gov/gene/8358", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8968", "url": "https://www.ncbi.nlm.nih.gov/gene/8968", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2886", "url": "https://glyconnect.expasy.org/browser/proteins/2886", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycomics" ] }, { "id": "4766", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4766", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4767", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4767", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4768", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4768", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4769", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4769", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4771", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4771", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4772", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4772", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4773", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4773", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4774", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4774", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4775", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4775", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "4776", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:4776", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "1CS9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1CS9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1CT6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1CT6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1O9S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1O9S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1Q3L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1Q3L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2B2T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2B2T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2B2U", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2B2U&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2B2V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2B2V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2B2W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2B2W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2C1J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2C1J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2C1N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2C1N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2CO0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2CO0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2CV5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2CV5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2FSA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2FSA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KWJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KWJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KWK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KWK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2L75", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2L75&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2LBM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2LBM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2LGG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2LGG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2M0O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2M0O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2NDF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2NDF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2NDG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2NDG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OQ6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OQ6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OT7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OT7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2OX0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2OX0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RI7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RI7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RR4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RR4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2UXN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2UXN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2V85", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2V85&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2V89", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2V89&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2VNF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2VNF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2VPG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2VPG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2X0L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2X0L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3A1B", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3A1B&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AFA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AFA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AVR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AVR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AYW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AYW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3AZN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3AZN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3B95", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3B95&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3FDT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3FDT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3KMT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3KMT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3KQI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3KQI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3LQI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3LQI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3LQJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3LQJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3MP1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3MP1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3O34", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3O34&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3O35", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3O35&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3O37", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3O37&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3QJ6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3QJ6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3RIG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3RIG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3RIY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3RIY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SOU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SOU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3SOW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3SOW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3U31", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3U31&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3U3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3U3D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3U4S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3U4S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3U5N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3U5N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3U5O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3U5O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3U5P", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3U5P&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3UEE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3UEE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3UEF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3UEF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3UIG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3UIG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3UII", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3UII&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3UIK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3UIK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3V43", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3V43&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3W96", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3W96&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3W97", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3W97&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3W98", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3W98&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3W99", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3W99&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3WA9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3WA9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3WAA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3WAA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3WKJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3WKJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3X1S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3X1S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3X1T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3X1T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3X1U", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3X1U&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3X1V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3X1V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3ZG6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3ZG6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3ZVY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3ZVY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4A0J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4A0J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4A0N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4A0N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4A7J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4A7J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4BD3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4BD3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4C1Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4C1Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4F4U", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4F4U&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4F56", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4F56&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4FWF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4FWF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4HON", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4HON&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4I51", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4I51&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4L7X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4L7X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LK9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LK9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LKA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LKA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LLB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LLB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LXL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LXL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4N4H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4N4H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4QBQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4QBQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4QBR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4QBR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4QBS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4QBS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4TN7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4TN7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4U68", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4U68&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4UP0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4UP0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4UY4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4UY4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4X3K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4X3K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4Y6L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4Y6L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4YHP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4YHP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4YHZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4YHZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4YM5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4YM5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4YM6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4YM6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4Z0R", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4Z0R&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4Z2M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4Z2M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5AV5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5AV5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5AV6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5AV6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5AV8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5AV8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5AV9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5AV9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5AVB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5AVB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5AVC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5AVC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5B24", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5B24&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5B2I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5B2I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5B2J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5B2J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5B31", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5B31&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C11", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C11&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C13", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C13&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5C3I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5C3I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5CPI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5CPI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5CPJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5CPJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5CPK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5CPK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5D6Y", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5D6Y&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5DAH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5DAH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5FB0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5FB0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5FB1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5FB1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5FFV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5FFV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5GH9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5GH9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5GSE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5GSE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5GSU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5GSU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5GT0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5GT0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5GT3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5GT3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5GTC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5GTC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5H6Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5H6Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5H6R", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5H6R&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5HJB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5HJB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5HJC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5HJC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5HJD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5HJD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5HYN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5HYN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5IQL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5IQL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5J3V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5J3V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5J9S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5J9S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JHN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JHN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JIN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JIN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JIY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JIY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JJ0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JJ0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JRG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JRG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5KJH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5KJH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5KJI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5KJI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5KKL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5KKL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5LUG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5LUG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5M5G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5M5G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5MR8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5MR8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5NNC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5NNC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5NND", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5NND&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5OY3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5OY3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5SVX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5SVX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5SVY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5SVY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5SZB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5SZB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5SZC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5SZC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T0K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T0K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T0M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T0M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T1G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T1G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T1I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T1I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T8R", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T8R&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5TBN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5TBN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5TDR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5TDR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5TDW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5TDW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5U2J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5U2J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5V21", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5V21&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5V22", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5V22&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5VA6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5VA6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5VAB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5VAB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5VGE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5VGE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5VNB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5VNB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WFC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WFC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WLE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WLE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WVO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WVO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WXG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WXG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WXH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WXH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5WYI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5WYI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5X60", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5X60&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XF3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XF3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XF4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XF4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XF5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XF5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XFQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XFQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XFR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XFR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XNV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XNV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5XTZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5XTZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Y0C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Y0C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Y0D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Y0D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Y20", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Y20&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Y2F", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Y2F&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Z23", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Z23&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Z30", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Z30&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5ZBX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5ZBX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6AXJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6AXJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6AZE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6AZE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6BHD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6BHD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6BHE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6BHE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6BHG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6BHG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6BHH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6BHH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6BHI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6BHI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6D07", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6D07&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6D08", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6D08&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6E83", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6E83&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6E86", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6E86&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6F6D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6F6D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6HKT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6HKT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6HTS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6HTS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6IEU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6IEU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6IIS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6IIS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6IIT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6IIT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6IPU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6IPU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6IQ4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6IQ4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6JOU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6JOU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6JR0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6JR0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6JR1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6JR1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6JXD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6JXD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6K1I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6K1I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6K1J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6K1J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6K1K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6K1K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6KE9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6KE9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6KVD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6KVD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6L49", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6L49&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6L4A", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6L4A&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6L9H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6L9H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6L9Z", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6L9Z&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LA2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LA2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LA8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LA8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LA9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LA9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LAB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LAB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LE9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LE9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LER", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LER&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LS6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LS6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LSD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LSD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6M3V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6M3V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6M44", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6M44&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6M4D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6M4D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6M4G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6M4G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6M4H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6M4H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6MIL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6MIL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6MIM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6MIM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6MIN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6MIN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6MIO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6MIO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6MIQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6MIQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6PA1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6PA1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6PAG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6PAG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R8Y", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R8Y&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R8Z", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R8Z&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R90", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R90&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R91", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R91&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R92", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R92&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R93", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R93&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6R94", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6R94&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6T90", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6T90&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6T93", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6T93&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6UPK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6UPK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6UPL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6UPL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6USJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6USJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6V2H", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6V2H&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6V2K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6V2K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6V3N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6V3N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6V41", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6V41&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6V92", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6V92&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6VIL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6VIL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6WAV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6WAV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6WW4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6WW4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6YIF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6YIF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6YIH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6YIH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6YOV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6YOV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7BWD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7BWD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7C0M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7C0M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7CCQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7CCQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7CCR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7CCR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7CFP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7CFP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7CFQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7CFQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7COW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7COW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7D1Z", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7D1Z&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7DBP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7DBP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7E8D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7E8D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7EBK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7EBK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K5X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K5X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K5Y", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K5Y&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K60", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K60&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K61", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K61&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K63", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K63&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KLR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KLR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LBK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LBK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LBO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LBO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LBP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LBP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LBQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LBQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LYA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LYA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LYB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LYB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LYC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LYC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7MJU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7MJU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7NL0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7NL0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7SCY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7SCY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7SCZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7SCZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7TD5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7TD5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7U0G", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7U0G&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7U0I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7U0I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7U0J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7U0J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V6Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V6Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V90", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V90&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V96", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V96&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V9C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V9C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V9J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V9J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V9K", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V9K&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7V9S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7V9S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7VA4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7VA4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7VZ4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7VZ4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7W9V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7W9V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7X57", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7X57&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7X58", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7X58&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XD1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XD1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XVL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XVL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XVM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XVM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XX5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XX5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XX6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XX6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XZX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XZX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XZY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XZY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7XZZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7XZZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y00", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y00&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y5U", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y5U&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y5V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y5V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y5W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y5W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y60", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y60&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y61", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y61&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y7I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y7I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7Y8R", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7Y8R&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7YOZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7YOZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7YQK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7YQK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7ZI4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7ZI4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8DK5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8DK5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8DS8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8DS8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8EVG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8EVG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8EVH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8EVH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8EVI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8EVI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8EVJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8EVJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8GE0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8GE0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8GRM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8GRM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8GUI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8GUI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8GUJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8GUJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8GUK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8GUK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H0V", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H0V&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H0W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H0W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8H1T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8H1T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HAN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HAN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HE5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HE5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HLY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HLY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8HMX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8HMX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8I60", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8I60&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IEG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IEG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IEJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IEJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IHL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IHL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IIY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IIY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IIZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IIZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IJ0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IJ0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IQF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IQF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8IQG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8IQG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8J6S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8J6S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8J6T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8J6T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JBX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JBX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JCC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JCC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JCD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JCD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JHF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JHF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JHG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JHG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JL9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JL9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JLA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JLA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JND", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JND&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JNE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JNE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8JNF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8JNF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KCY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KCY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KD1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KD1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8KE0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8KE0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OFF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OFF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OO7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OO7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OOA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OOA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OOP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OOP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OOS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OOS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OSJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OSJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OSK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OSK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OSL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OSL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OTS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OTS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OTT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OTT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OX0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OX0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8OX1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8OX1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Q36", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Q36&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Q3E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Q3E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Q3M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Q3M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Q3X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Q3X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8QKT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8QKT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8RGM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8RGM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SMW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SMW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SMX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SMX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SMY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SMY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SMZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SMZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SN9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SN9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SNA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SNA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SPS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SPS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SPU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SPU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SWI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SWI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8SYP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8SYP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8TXV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8TXV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8TXW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8TXW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8TXX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8TXX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8U13", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8U13&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8U14", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8U14&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8UPF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8UPF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VFX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VFX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VFY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VFY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VFZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VFZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VG0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VG0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VG1", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VG1&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VG2", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VG2&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VLR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VLR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VMI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VMI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VML", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VML&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8VNV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8VNV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8W9D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8W9D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8W9E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8W9E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8W9F", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8W9F&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8WG5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8WG5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8X15", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8X15&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8X19", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8X19&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8X1C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8X1C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8XBT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8XBT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8XBU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8XBU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8XBW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8XBW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8XRJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8XRJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8XVS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8XVS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y3C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y3C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y3D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y3E", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y3E&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y3F", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y3F&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YBJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YBJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YBK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YBK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YJF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YJF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YJM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YJM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YNY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YNY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YTI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YTI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8YV8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8YV8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9ECP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9ECP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9EHI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9EHI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9FGQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9FGQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9FH9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9FH9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GCG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GCG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GE4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GE4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GE5", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GE5&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GEL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GEL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GEV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GEV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GF6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GF6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GFB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GFB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9GFM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9GFM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9IGW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9IGW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9IGX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9IGX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9J8M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9J8M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9J8N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9J8N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9J8O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9J8O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9J8W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9J8W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9JC6", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9JC6&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MLL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MLL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MLN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MLN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MLR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MLR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MLS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MLS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MMK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MMK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MMM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MMM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MMN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MMN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MMO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MMO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MMT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MMT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9Q80", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9Q80&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9Q8X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9Q8X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9Q9F", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9Q9F&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9QCR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9QCR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9QCS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9QCS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9QLM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9QLM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9QMS", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9QMS&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9R04", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9R04&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9R2M", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9R2M&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9R2P", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9R2P&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9R2Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9R2Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VEM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VEM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VEW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VEW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VG0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VG0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VG3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VG3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VGE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VGE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VGZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VGZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9VH0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9VH0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1001619", "url": "https://www.iedb.org/epitope/1001619", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1001620", "url": "https://www.iedb.org/epitope/1001620", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1021376", "url": "https://www.iedb.org/epitope/1021376", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1036870", "url": "https://www.iedb.org/epitope/1036870", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1043608", "url": "https://www.iedb.org/epitope/1043608", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1047209", "url": "https://www.iedb.org/epitope/1047209", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1125883", "url": "https://www.iedb.org/epitope/1125883", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1125884", "url": "https://www.iedb.org/epitope/1125884", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1127267", "url": "https://www.iedb.org/epitope/1127267", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1127268", "url": "https://www.iedb.org/epitope/1127268", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1130434", "url": "https://www.iedb.org/epitope/1130434", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1133155", "url": "https://www.iedb.org/epitope/1133155", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1133156", "url": "https://www.iedb.org/epitope/1133156", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1133157", "url": "https://www.iedb.org/epitope/1133157", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1133158", "url": "https://www.iedb.org/epitope/1133158", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1135481", "url": "https://www.iedb.org/epitope/1135481", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1135868", "url": "https://www.iedb.org/epitope/1135868", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1135869", "url": "https://www.iedb.org/epitope/1135869", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1137286", "url": "https://www.iedb.org/epitope/1137286", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1137404", "url": "https://www.iedb.org/epitope/1137404", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1137405", "url": "https://www.iedb.org/epitope/1137405", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1148288", "url": "https://www.iedb.org/epitope/1148288", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1148289", "url": "https://www.iedb.org/epitope/1148289", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1149710", "url": "https://www.iedb.org/epitope/1149710", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1154378", "url": "https://www.iedb.org/epitope/1154378", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1167769", "url": "https://www.iedb.org/epitope/1167769", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1167770", "url": "https://www.iedb.org/epitope/1167770", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1172842", "url": "https://www.iedb.org/epitope/1172842", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1172843", "url": "https://www.iedb.org/epitope/1172843", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1172844", "url": "https://www.iedb.org/epitope/1172844", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1172845", "url": "https://www.iedb.org/epitope/1172845", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1176984", "url": "https://www.iedb.org/epitope/1176984", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1192580", "url": "https://www.iedb.org/epitope/1192580", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1212971", "url": "https://www.iedb.org/epitope/1212971", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1257208", "url": "https://www.iedb.org/epitope/1257208", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1257209", "url": "https://www.iedb.org/epitope/1257209", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1258375", "url": "https://www.iedb.org/epitope/1258375", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1364264", "url": "https://www.iedb.org/epitope/1364264", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1385258", "url": "https://www.iedb.org/epitope/1385258", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1402716", "url": "https://www.iedb.org/epitope/1402716", "database": "IEDB", "categories": [ "Other" ] }, { "id": "143126", "url": "https://www.iedb.org/epitope/143126", "database": "IEDB", "categories": [ "Other" ] }, { "id": "162146", "url": "https://www.iedb.org/epitope/162146", "database": "IEDB", "categories": [ "Other" ] }, { "id": "162519", "url": "https://www.iedb.org/epitope/162519", "database": "IEDB", "categories": [ "Other" ] }, { "id": "213486", "url": "https://www.iedb.org/epitope/213486", "database": "IEDB", "categories": [ "Other" ] }, { "id": "213487", "url": "https://www.iedb.org/epitope/213487", "database": "IEDB", "categories": [ "Other" ] }, { "id": "219933", "url": "https://www.iedb.org/epitope/219933", "database": "IEDB", "categories": [ "Other" ] }, { "id": "221761", "url": "https://www.iedb.org/epitope/221761", "database": "IEDB", "categories": [ "Other" ] }, { "id": "223695", "url": "https://www.iedb.org/epitope/223695", "database": "IEDB", "categories": [ "Other" ] }, { "id": "223829", "url": "https://www.iedb.org/epitope/223829", "database": "IEDB", "categories": [ "Other" ] }, { "id": "224167", "url": "https://www.iedb.org/epitope/224167", "database": "IEDB", "categories": [ "Other" ] }, { "id": "236256", "url": "https://www.iedb.org/epitope/236256", "database": "IEDB", "categories": [ "Other" ] }, { "id": "236257", "url": "https://www.iedb.org/epitope/236257", "database": "IEDB", "categories": [ "Other" ] }, { "id": "236258", "url": "https://www.iedb.org/epitope/236258", "database": "IEDB", "categories": [ "Other" ] }, { "id": "240787", "url": "https://www.iedb.org/epitope/240787", "database": "IEDB", "categories": [ "Other" ] }, { "id": "241271", "url": "https://www.iedb.org/epitope/241271", "database": "IEDB", "categories": [ "Other" ] }, { "id": "241481", "url": "https://www.iedb.org/epitope/241481", "database": "IEDB", "categories": [ "Other" ] }, { "id": "418481", "url": "https://www.iedb.org/epitope/418481", "database": "IEDB", "categories": [ "Other" ] }, { "id": "418519", "url": "https://www.iedb.org/epitope/418519", "database": "IEDB", "categories": [ "Other" ] }, { "id": "423230", "url": "https://www.iedb.org/epitope/423230", "database": "IEDB", "categories": [ "Other" ] }, { "id": "435299", "url": "https://www.iedb.org/epitope/435299", "database": "IEDB", "categories": [ "Other" ] }, { "id": "435791", "url": "https://www.iedb.org/epitope/435791", "database": "IEDB", "categories": [ "Other" ] }, { "id": "438080", "url": "https://www.iedb.org/epitope/438080", "database": "IEDB", "categories": [ "Other" ] }, { "id": "438321", "url": "https://www.iedb.org/epitope/438321", "database": "IEDB", "categories": [ "Other" ] }, { "id": "439018", "url": "https://www.iedb.org/epitope/439018", "database": "IEDB", "categories": [ "Other" ] }, { "id": "439937", "url": "https://www.iedb.org/epitope/439937", "database": "IEDB", "categories": [ "Other" ] }, { "id": "441064", "url": "https://www.iedb.org/epitope/441064", "database": "IEDB", "categories": [ "Other" ] }, { "id": "441529", "url": "https://www.iedb.org/epitope/441529", "database": "IEDB", "categories": [ "Other" ] }, { "id": "444045", "url": "https://www.iedb.org/epitope/444045", "database": "IEDB", "categories": [ "Other" ] }, { "id": "445952", "url": "https://www.iedb.org/epitope/445952", "database": "IEDB", "categories": [ "Other" ] }, { "id": "448090", "url": "https://www.iedb.org/epitope/448090", "database": "IEDB", "categories": [ "Other" ] }, { "id": "468489", "url": "https://www.iedb.org/epitope/468489", "database": "IEDB", "categories": [ "Other" ] }, { "id": "485145", "url": "https://www.iedb.org/epitope/485145", "database": "IEDB", "categories": [ "Other" ] }, { "id": "488976", "url": "https://www.iedb.org/epitope/488976", "database": "IEDB", "categories": [ "Other" ] }, { "id": "489000", "url": "https://www.iedb.org/epitope/489000", "database": "IEDB", "categories": [ "Other" ] }, { "id": "489132", "url": "https://www.iedb.org/epitope/489132", "database": "IEDB", "categories": [ "Other" ] }, { "id": "492340", "url": "https://www.iedb.org/epitope/492340", "database": "IEDB", "categories": [ "Other" ] }, { "id": "492926", "url": "https://www.iedb.org/epitope/492926", "database": "IEDB", "categories": [ "Other" ] }, { "id": "494708", "url": "https://www.iedb.org/epitope/494708", "database": "IEDB", "categories": [ "Other" ] }, { "id": "506018", "url": "https://www.iedb.org/epitope/506018", "database": "IEDB", "categories": [ "Other" ] }, { "id": "547059", "url": "https://www.iedb.org/epitope/547059", "database": "IEDB", "categories": [ "Other" ] }, { "id": "555825", "url": "https://www.iedb.org/epitope/555825", "database": "IEDB", "categories": [ "Other" ] }, { "id": "556494", "url": "https://www.iedb.org/epitope/556494", "database": "IEDB", "categories": [ "Other" ] }, { "id": "556752", "url": "https://www.iedb.org/epitope/556752", "database": "IEDB", "categories": [ "Other" ] }, { "id": "55785", "url": "https://www.iedb.org/epitope/55785", "database": "IEDB", "categories": [ "Other" ] }, { "id": "568135", "url": "https://www.iedb.org/epitope/568135", "database": "IEDB", "categories": [ "Other" ] }, { "id": "568615", "url": "https://www.iedb.org/epitope/568615", "database": "IEDB", "categories": [ "Other" ] }, { "id": "568909", "url": "https://www.iedb.org/epitope/568909", "database": "IEDB", "categories": [ "Other" ] }, { "id": "586407", "url": "https://www.iedb.org/epitope/586407", "database": "IEDB", "categories": [ "Other" ] }, { "id": "588131", "url": "https://www.iedb.org/epitope/588131", "database": "IEDB", "categories": [ "Other" ] }, { "id": "588154", "url": "https://www.iedb.org/epitope/588154", "database": "IEDB", "categories": [ "Other" ] }, { "id": "598059", "url": "https://www.iedb.org/epitope/598059", "database": "IEDB", "categories": [ "Other" ] }, { "id": "606845", "url": "https://www.iedb.org/epitope/606845", "database": "IEDB", "categories": [ "Other" ] }, { "id": "606984", "url": "https://www.iedb.org/epitope/606984", "database": "IEDB", "categories": [ "Other" ] }, { "id": "606985", "url": "https://www.iedb.org/epitope/606985", "database": "IEDB", "categories": [ "Other" ] }, { "id": "618086", "url": "https://www.iedb.org/epitope/618086", "database": "IEDB", "categories": [ "Other" ] }, { "id": "627462", "url": "https://www.iedb.org/epitope/627462", "database": "IEDB", "categories": [ "Other" ] }, { "id": "630283", "url": "https://www.iedb.org/epitope/630283", "database": "IEDB", "categories": [ "Other" ] }, { "id": "633782", "url": "https://www.iedb.org/epitope/633782", "database": "IEDB", "categories": [ "Other" ] }, { "id": "640330", "url": "https://www.iedb.org/epitope/640330", "database": "IEDB", "categories": [ "Other" ] }, { "id": "640963", "url": "https://www.iedb.org/epitope/640963", "database": "IEDB", "categories": [ "Other" ] }, { "id": "711049", "url": "https://www.iedb.org/epitope/711049", "database": "IEDB", "categories": [ "Other" ] }, { "id": "721745", "url": "https://www.iedb.org/epitope/721745", "database": "IEDB", "categories": [ "Other" ] }, { "id": "767963", "url": "https://www.iedb.org/epitope/767963", "database": "IEDB", "categories": [ "Other" ] }, { "id": "775322", "url": "https://www.iedb.org/epitope/775322", "database": "IEDB", "categories": [ "Other" ] }, { "id": "778670", "url": "https://www.iedb.org/epitope/778670", "database": "IEDB", "categories": [ "Other" ] }, { "id": "925373", "url": "https://www.iedb.org/epitope/925373", "database": "IEDB", "categories": [ "Other" ] }, { "id": "929554", "url": "https://www.iedb.org/epitope/929554", "database": "IEDB", "categories": [ "Other" ] }, { "id": "P68431", "url": "https://www.ebi.ac.uk/intact/interactors/id:P68431*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8350", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8350", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8351", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8351", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8352", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8352", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8353", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8353", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8354", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8354", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8355", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8355", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8356", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8356", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8357", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8357", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8358", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8358", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:8968", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8968", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "137800", "url": "http://www.omim.org/entry/137800", "database": "MIM", "categories": [ "Other" ] }, { "id": "602810", "url": "http://www.omim.org/entry/602810", "database": "MIM", "categories": [ "Other" ] }, { "id": "602811", "url": "http://www.omim.org/entry/602811", "database": "MIM", "categories": [ "Other" ] }, { "id": "602812", "url": "http://www.omim.org/entry/602812", "database": "MIM", "categories": [ "Other" ] }, { "id": "602813", "url": "http://www.omim.org/entry/602813", "database": "MIM", "categories": [ "Other" ] }, { "id": "602814", "url": "http://www.omim.org/entry/602814", "database": "MIM", "categories": [ "Other" ] }, { "id": "602815", "url": "http://www.omim.org/entry/602815", "database": "MIM", "categories": [ "Other" ] }, { "id": "602816", "url": "http://www.omim.org/entry/602816", "database": "MIM", "categories": [ "Other" ] }, { "id": "602817", "url": "http://www.omim.org/entry/602817", "database": "MIM", "categories": [ "Other" ] }, { "id": "602818", "url": "http://www.omim.org/entry/602818", "database": "MIM", "categories": [ "Other" ] }, { "id": "602819", "url": "http://www.omim.org/entry/602819", "database": "MIM", "categories": [ "Other" ] }, { "id": "P68431", "url": "https://oglcnac.org/atlas/detail/P68431", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "ICIVICK", "url": "https://omabrowser.org/oma/group/ICIVICK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "P68431", "url": "https://www.orthodb.org/?gene=P68431", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11426", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001cs9", "url": "https://www.rcsb.org/structure/pdb_00001cs9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001ct6", "url": "https://www.rcsb.org/structure/pdb_00001ct6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001o9s", "url": "https://www.rcsb.org/structure/pdb_00001o9s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001q3l", "url": "https://www.rcsb.org/structure/pdb_00001q3l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002b2t", "url": "https://www.rcsb.org/structure/pdb_00002b2t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002b2u", "url": "https://www.rcsb.org/structure/pdb_00002b2u", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002b2v", "url": "https://www.rcsb.org/structure/pdb_00002b2v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002b2w", "url": "https://www.rcsb.org/structure/pdb_00002b2w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002c1j", "url": "https://www.rcsb.org/structure/pdb_00002c1j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002c1n", "url": "https://www.rcsb.org/structure/pdb_00002c1n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002co0", "url": "https://www.rcsb.org/structure/pdb_00002co0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002cv5", "url": "https://www.rcsb.org/structure/pdb_00002cv5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002fsa", "url": "https://www.rcsb.org/structure/pdb_00002fsa", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kwj", "url": "https://www.rcsb.org/structure/pdb_00002kwj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kwk", "url": "https://www.rcsb.org/structure/pdb_00002kwk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002l75", "url": "https://www.rcsb.org/structure/pdb_00002l75", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002lbm", "url": "https://www.rcsb.org/structure/pdb_00002lbm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002lgg", "url": "https://www.rcsb.org/structure/pdb_00002lgg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002m0o", "url": "https://www.rcsb.org/structure/pdb_00002m0o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ndf", "url": "https://www.rcsb.org/structure/pdb_00002ndf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ndg", "url": "https://www.rcsb.org/structure/pdb_00002ndg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002oq6", "url": "https://www.rcsb.org/structure/pdb_00002oq6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ot7", "url": "https://www.rcsb.org/structure/pdb_00002ot7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ox0", "url": "https://www.rcsb.org/structure/pdb_00002ox0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002ri7", "url": "https://www.rcsb.org/structure/pdb_00002ri7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002rr4", "url": "https://www.rcsb.org/structure/pdb_00002rr4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002uxn", "url": "https://www.rcsb.org/structure/pdb_00002uxn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002v85", "url": "https://www.rcsb.org/structure/pdb_00002v85", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002v89", "url": "https://www.rcsb.org/structure/pdb_00002v89", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002vnf", "url": "https://www.rcsb.org/structure/pdb_00002vnf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002vpg", "url": "https://www.rcsb.org/structure/pdb_00002vpg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002x0l", "url": "https://www.rcsb.org/structure/pdb_00002x0l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003a1b", "url": "https://www.rcsb.org/structure/pdb_00003a1b", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003afa", "url": "https://www.rcsb.org/structure/pdb_00003afa", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003avr", "url": "https://www.rcsb.org/structure/pdb_00003avr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003ayw", "url": "https://www.rcsb.org/structure/pdb_00003ayw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003aze", "url": "https://www.rcsb.org/structure/pdb_00003aze", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azf", "url": "https://www.rcsb.org/structure/pdb_00003azf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azg", "url": "https://www.rcsb.org/structure/pdb_00003azg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azh", "url": "https://www.rcsb.org/structure/pdb_00003azh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azi", "url": "https://www.rcsb.org/structure/pdb_00003azi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azj", "url": "https://www.rcsb.org/structure/pdb_00003azj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azk", "url": "https://www.rcsb.org/structure/pdb_00003azk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azl", "url": "https://www.rcsb.org/structure/pdb_00003azl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azm", "url": "https://www.rcsb.org/structure/pdb_00003azm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003azn", "url": "https://www.rcsb.org/structure/pdb_00003azn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003b95", "url": "https://www.rcsb.org/structure/pdb_00003b95", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003fdt", "url": "https://www.rcsb.org/structure/pdb_00003fdt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003kmt", "url": "https://www.rcsb.org/structure/pdb_00003kmt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003kqi", "url": "https://www.rcsb.org/structure/pdb_00003kqi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003lqi", "url": "https://www.rcsb.org/structure/pdb_00003lqi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003lqj", "url": "https://www.rcsb.org/structure/pdb_00003lqj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003mp1", "url": "https://www.rcsb.org/structure/pdb_00003mp1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003o34", "url": "https://www.rcsb.org/structure/pdb_00003o34", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003o35", "url": "https://www.rcsb.org/structure/pdb_00003o35", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003o37", "url": "https://www.rcsb.org/structure/pdb_00003o37", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003qj6", "url": "https://www.rcsb.org/structure/pdb_00003qj6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003rig", "url": "https://www.rcsb.org/structure/pdb_00003rig", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003riy", "url": "https://www.rcsb.org/structure/pdb_00003riy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sou", "url": "https://www.rcsb.org/structure/pdb_00003sou", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003sow", "url": "https://www.rcsb.org/structure/pdb_00003sow", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003u31", "url": "https://www.rcsb.org/structure/pdb_00003u31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003u3d", "url": "https://www.rcsb.org/structure/pdb_00003u3d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003u4s", "url": "https://www.rcsb.org/structure/pdb_00003u4s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003u5n", "url": "https://www.rcsb.org/structure/pdb_00003u5n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003u5o", "url": "https://www.rcsb.org/structure/pdb_00003u5o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003u5p", "url": "https://www.rcsb.org/structure/pdb_00003u5p", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003uee", "url": "https://www.rcsb.org/structure/pdb_00003uee", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003uef", "url": "https://www.rcsb.org/structure/pdb_00003uef", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003uig", "url": "https://www.rcsb.org/structure/pdb_00003uig", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003uii", "url": "https://www.rcsb.org/structure/pdb_00003uii", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003uik", "url": "https://www.rcsb.org/structure/pdb_00003uik", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003v43", "url": "https://www.rcsb.org/structure/pdb_00003v43", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003w96", "url": "https://www.rcsb.org/structure/pdb_00003w96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003w97", "url": "https://www.rcsb.org/structure/pdb_00003w97", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003w98", "url": "https://www.rcsb.org/structure/pdb_00003w98", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003w99", "url": "https://www.rcsb.org/structure/pdb_00003w99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003wa9", "url": "https://www.rcsb.org/structure/pdb_00003wa9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003waa", "url": "https://www.rcsb.org/structure/pdb_00003waa", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003wkj", "url": "https://www.rcsb.org/structure/pdb_00003wkj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003x1s", "url": "https://www.rcsb.org/structure/pdb_00003x1s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003x1t", "url": "https://www.rcsb.org/structure/pdb_00003x1t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003x1u", "url": "https://www.rcsb.org/structure/pdb_00003x1u", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003x1v", "url": "https://www.rcsb.org/structure/pdb_00003x1v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003zg6", "url": "https://www.rcsb.org/structure/pdb_00003zg6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003zvy", "url": "https://www.rcsb.org/structure/pdb_00003zvy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004a0j", "url": "https://www.rcsb.org/structure/pdb_00004a0j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004a0n", "url": "https://www.rcsb.org/structure/pdb_00004a0n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004a7j", "url": "https://www.rcsb.org/structure/pdb_00004a7j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004bd3", "url": "https://www.rcsb.org/structure/pdb_00004bd3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004c1q", "url": "https://www.rcsb.org/structure/pdb_00004c1q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004f4u", "url": "https://www.rcsb.org/structure/pdb_00004f4u", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004f56", "url": "https://www.rcsb.org/structure/pdb_00004f56", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004fwf", "url": "https://www.rcsb.org/structure/pdb_00004fwf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004hon", "url": "https://www.rcsb.org/structure/pdb_00004hon", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004i51", "url": "https://www.rcsb.org/structure/pdb_00004i51", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004l7x", "url": "https://www.rcsb.org/structure/pdb_00004l7x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004lk9", "url": "https://www.rcsb.org/structure/pdb_00004lk9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004lka", "url": "https://www.rcsb.org/structure/pdb_00004lka", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004llb", "url": "https://www.rcsb.org/structure/pdb_00004llb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004lxl", "url": "https://www.rcsb.org/structure/pdb_00004lxl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004n4h", "url": "https://www.rcsb.org/structure/pdb_00004n4h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004qbq", "url": "https://www.rcsb.org/structure/pdb_00004qbq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004qbr", "url": "https://www.rcsb.org/structure/pdb_00004qbr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004qbs", "url": "https://www.rcsb.org/structure/pdb_00004qbs", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004tn7", "url": "https://www.rcsb.org/structure/pdb_00004tn7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004u68", "url": "https://www.rcsb.org/structure/pdb_00004u68", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004up0", "url": "https://www.rcsb.org/structure/pdb_00004up0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004uy4", "url": "https://www.rcsb.org/structure/pdb_00004uy4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004x3k", "url": "https://www.rcsb.org/structure/pdb_00004x3k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004y6l", "url": "https://www.rcsb.org/structure/pdb_00004y6l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004yhp", "url": "https://www.rcsb.org/structure/pdb_00004yhp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004yhz", "url": "https://www.rcsb.org/structure/pdb_00004yhz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ym5", "url": "https://www.rcsb.org/structure/pdb_00004ym5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ym6", "url": "https://www.rcsb.org/structure/pdb_00004ym6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004z0r", "url": "https://www.rcsb.org/structure/pdb_00004z0r", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004z2m", "url": "https://www.rcsb.org/structure/pdb_00004z2m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005av5", "url": "https://www.rcsb.org/structure/pdb_00005av5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005av6", "url": "https://www.rcsb.org/structure/pdb_00005av6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005av8", "url": "https://www.rcsb.org/structure/pdb_00005av8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005av9", "url": "https://www.rcsb.org/structure/pdb_00005av9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005avb", "url": "https://www.rcsb.org/structure/pdb_00005avb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005avc", "url": "https://www.rcsb.org/structure/pdb_00005avc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005b24", "url": "https://www.rcsb.org/structure/pdb_00005b24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005b2i", "url": "https://www.rcsb.org/structure/pdb_00005b2i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005b2j", "url": "https://www.rcsb.org/structure/pdb_00005b2j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005b31", "url": "https://www.rcsb.org/structure/pdb_00005b31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c11", "url": "https://www.rcsb.org/structure/pdb_00005c11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c13", "url": "https://www.rcsb.org/structure/pdb_00005c13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005c3i", "url": "https://www.rcsb.org/structure/pdb_00005c3i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005cpi", "url": "https://www.rcsb.org/structure/pdb_00005cpi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005cpj", "url": "https://www.rcsb.org/structure/pdb_00005cpj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005cpk", "url": "https://www.rcsb.org/structure/pdb_00005cpk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005d6y", "url": "https://www.rcsb.org/structure/pdb_00005d6y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005dah", "url": "https://www.rcsb.org/structure/pdb_00005dah", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005fb0", "url": "https://www.rcsb.org/structure/pdb_00005fb0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005fb1", "url": "https://www.rcsb.org/structure/pdb_00005fb1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005ffv", "url": "https://www.rcsb.org/structure/pdb_00005ffv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005gh9", "url": "https://www.rcsb.org/structure/pdb_00005gh9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005gse", "url": "https://www.rcsb.org/structure/pdb_00005gse", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005gsu", "url": "https://www.rcsb.org/structure/pdb_00005gsu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005gt0", "url": "https://www.rcsb.org/structure/pdb_00005gt0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005gt3", "url": "https://www.rcsb.org/structure/pdb_00005gt3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005gtc", "url": "https://www.rcsb.org/structure/pdb_00005gtc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005h6q", "url": "https://www.rcsb.org/structure/pdb_00005h6q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005h6r", "url": "https://www.rcsb.org/structure/pdb_00005h6r", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005hjb", "url": "https://www.rcsb.org/structure/pdb_00005hjb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005hjc", "url": "https://www.rcsb.org/structure/pdb_00005hjc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005hjd", "url": "https://www.rcsb.org/structure/pdb_00005hjd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005hyn", "url": "https://www.rcsb.org/structure/pdb_00005hyn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005iql", "url": "https://www.rcsb.org/structure/pdb_00005iql", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005j3v", "url": "https://www.rcsb.org/structure/pdb_00005j3v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005j9s", "url": "https://www.rcsb.org/structure/pdb_00005j9s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jhn", "url": "https://www.rcsb.org/structure/pdb_00005jhn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jin", "url": "https://www.rcsb.org/structure/pdb_00005jin", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jiy", "url": "https://www.rcsb.org/structure/pdb_00005jiy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jj0", "url": "https://www.rcsb.org/structure/pdb_00005jj0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jrg", "url": "https://www.rcsb.org/structure/pdb_00005jrg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005kjh", "url": "https://www.rcsb.org/structure/pdb_00005kjh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005kji", "url": "https://www.rcsb.org/structure/pdb_00005kji", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005kkl", "url": "https://www.rcsb.org/structure/pdb_00005kkl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005lug", "url": "https://www.rcsb.org/structure/pdb_00005lug", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005m5g", "url": "https://www.rcsb.org/structure/pdb_00005m5g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005mr8", "url": "https://www.rcsb.org/structure/pdb_00005mr8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005nnc", "url": "https://www.rcsb.org/structure/pdb_00005nnc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005nnd", "url": "https://www.rcsb.org/structure/pdb_00005nnd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005oy3", "url": "https://www.rcsb.org/structure/pdb_00005oy3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005svx", "url": "https://www.rcsb.org/structure/pdb_00005svx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005svy", "url": "https://www.rcsb.org/structure/pdb_00005svy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005szb", "url": "https://www.rcsb.org/structure/pdb_00005szb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005szc", "url": "https://www.rcsb.org/structure/pdb_00005szc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t0k", "url": "https://www.rcsb.org/structure/pdb_00005t0k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t0m", "url": "https://www.rcsb.org/structure/pdb_00005t0m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t1g", "url": "https://www.rcsb.org/structure/pdb_00005t1g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t1i", "url": "https://www.rcsb.org/structure/pdb_00005t1i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t8r", "url": "https://www.rcsb.org/structure/pdb_00005t8r", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005tbn", "url": "https://www.rcsb.org/structure/pdb_00005tbn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005tdr", "url": "https://www.rcsb.org/structure/pdb_00005tdr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005tdw", "url": "https://www.rcsb.org/structure/pdb_00005tdw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005u2j", "url": "https://www.rcsb.org/structure/pdb_00005u2j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005v21", "url": "https://www.rcsb.org/structure/pdb_00005v21", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005v22", "url": "https://www.rcsb.org/structure/pdb_00005v22", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005va6", "url": "https://www.rcsb.org/structure/pdb_00005va6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005vab", "url": "https://www.rcsb.org/structure/pdb_00005vab", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005vge", "url": "https://www.rcsb.org/structure/pdb_00005vge", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005vnb", "url": "https://www.rcsb.org/structure/pdb_00005vnb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wfc", "url": "https://www.rcsb.org/structure/pdb_00005wfc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wle", "url": "https://www.rcsb.org/structure/pdb_00005wle", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wvo", "url": "https://www.rcsb.org/structure/pdb_00005wvo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wxg", "url": "https://www.rcsb.org/structure/pdb_00005wxg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wxh", "url": "https://www.rcsb.org/structure/pdb_00005wxh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005wyi", "url": "https://www.rcsb.org/structure/pdb_00005wyi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005x60", "url": "https://www.rcsb.org/structure/pdb_00005x60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xf3", "url": "https://www.rcsb.org/structure/pdb_00005xf3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xf4", "url": "https://www.rcsb.org/structure/pdb_00005xf4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xf5", "url": "https://www.rcsb.org/structure/pdb_00005xf5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xfq", "url": "https://www.rcsb.org/structure/pdb_00005xfq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xfr", "url": "https://www.rcsb.org/structure/pdb_00005xfr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xnv", "url": "https://www.rcsb.org/structure/pdb_00005xnv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005xtz", "url": "https://www.rcsb.org/structure/pdb_00005xtz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005y0c", "url": "https://www.rcsb.org/structure/pdb_00005y0c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005y0d", "url": "https://www.rcsb.org/structure/pdb_00005y0d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005y20", "url": "https://www.rcsb.org/structure/pdb_00005y20", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005y2f", "url": "https://www.rcsb.org/structure/pdb_00005y2f", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005z23", "url": "https://www.rcsb.org/structure/pdb_00005z23", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005z30", "url": "https://www.rcsb.org/structure/pdb_00005z30", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005zbx", "url": "https://www.rcsb.org/structure/pdb_00005zbx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006axj", "url": "https://www.rcsb.org/structure/pdb_00006axj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006aze", "url": "https://www.rcsb.org/structure/pdb_00006aze", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006bhd", "url": "https://www.rcsb.org/structure/pdb_00006bhd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006bhe", "url": "https://www.rcsb.org/structure/pdb_00006bhe", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006bhg", "url": "https://www.rcsb.org/structure/pdb_00006bhg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006bhh", "url": "https://www.rcsb.org/structure/pdb_00006bhh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006bhi", "url": "https://www.rcsb.org/structure/pdb_00006bhi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006d07", "url": "https://www.rcsb.org/structure/pdb_00006d07", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006d08", "url": "https://www.rcsb.org/structure/pdb_00006d08", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006e83", "url": "https://www.rcsb.org/structure/pdb_00006e83", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006e86", "url": "https://www.rcsb.org/structure/pdb_00006e86", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006f6d", "url": "https://www.rcsb.org/structure/pdb_00006f6d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006hkt", "url": "https://www.rcsb.org/structure/pdb_00006hkt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006hts", "url": "https://www.rcsb.org/structure/pdb_00006hts", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ieu", "url": "https://www.rcsb.org/structure/pdb_00006ieu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006iis", "url": "https://www.rcsb.org/structure/pdb_00006iis", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006iit", "url": "https://www.rcsb.org/structure/pdb_00006iit", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ipu", "url": "https://www.rcsb.org/structure/pdb_00006ipu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006iq4", "url": "https://www.rcsb.org/structure/pdb_00006iq4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006jou", "url": "https://www.rcsb.org/structure/pdb_00006jou", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006jr0", "url": "https://www.rcsb.org/structure/pdb_00006jr0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006jr1", "url": "https://www.rcsb.org/structure/pdb_00006jr1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006jxd", "url": "https://www.rcsb.org/structure/pdb_00006jxd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006k1i", "url": "https://www.rcsb.org/structure/pdb_00006k1i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006k1j", "url": "https://www.rcsb.org/structure/pdb_00006k1j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006k1k", "url": "https://www.rcsb.org/structure/pdb_00006k1k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ke9", "url": "https://www.rcsb.org/structure/pdb_00006ke9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006kvd", "url": "https://www.rcsb.org/structure/pdb_00006kvd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006l49", "url": "https://www.rcsb.org/structure/pdb_00006l49", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006l4a", "url": "https://www.rcsb.org/structure/pdb_00006l4a", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006l9h", "url": "https://www.rcsb.org/structure/pdb_00006l9h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006l9z", "url": "https://www.rcsb.org/structure/pdb_00006l9z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006la2", "url": "https://www.rcsb.org/structure/pdb_00006la2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006la8", "url": "https://www.rcsb.org/structure/pdb_00006la8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006la9", "url": "https://www.rcsb.org/structure/pdb_00006la9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006lab", "url": "https://www.rcsb.org/structure/pdb_00006lab", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006le9", "url": "https://www.rcsb.org/structure/pdb_00006le9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ler", "url": "https://www.rcsb.org/structure/pdb_00006ler", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ls6", "url": "https://www.rcsb.org/structure/pdb_00006ls6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006lsd", "url": "https://www.rcsb.org/structure/pdb_00006lsd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006m3v", "url": "https://www.rcsb.org/structure/pdb_00006m3v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006m44", "url": "https://www.rcsb.org/structure/pdb_00006m44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006m4d", "url": "https://www.rcsb.org/structure/pdb_00006m4d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006m4g", "url": "https://www.rcsb.org/structure/pdb_00006m4g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006m4h", "url": "https://www.rcsb.org/structure/pdb_00006m4h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006mil", "url": "https://www.rcsb.org/structure/pdb_00006mil", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006mim", "url": "https://www.rcsb.org/structure/pdb_00006mim", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006min", "url": "https://www.rcsb.org/structure/pdb_00006min", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006mio", "url": "https://www.rcsb.org/structure/pdb_00006mio", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006miq", "url": "https://www.rcsb.org/structure/pdb_00006miq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006pa1", "url": "https://www.rcsb.org/structure/pdb_00006pa1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006pag", "url": "https://www.rcsb.org/structure/pdb_00006pag", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r8y", "url": "https://www.rcsb.org/structure/pdb_00006r8y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r8z", "url": "https://www.rcsb.org/structure/pdb_00006r8z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r90", "url": "https://www.rcsb.org/structure/pdb_00006r90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r91", "url": "https://www.rcsb.org/structure/pdb_00006r91", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r92", "url": "https://www.rcsb.org/structure/pdb_00006r92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r93", "url": "https://www.rcsb.org/structure/pdb_00006r93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006r94", "url": "https://www.rcsb.org/structure/pdb_00006r94", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006t90", "url": "https://www.rcsb.org/structure/pdb_00006t90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006t93", "url": "https://www.rcsb.org/structure/pdb_00006t93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006upk", "url": "https://www.rcsb.org/structure/pdb_00006upk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006upl", "url": "https://www.rcsb.org/structure/pdb_00006upl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006usj", "url": "https://www.rcsb.org/structure/pdb_00006usj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006v2h", "url": "https://www.rcsb.org/structure/pdb_00006v2h", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006v2k", "url": "https://www.rcsb.org/structure/pdb_00006v2k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006v3n", "url": "https://www.rcsb.org/structure/pdb_00006v3n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006v41", "url": "https://www.rcsb.org/structure/pdb_00006v41", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006v92", "url": "https://www.rcsb.org/structure/pdb_00006v92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006vil", "url": "https://www.rcsb.org/structure/pdb_00006vil", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006wav", "url": "https://www.rcsb.org/structure/pdb_00006wav", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ww4", "url": "https://www.rcsb.org/structure/pdb_00006ww4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006yif", "url": "https://www.rcsb.org/structure/pdb_00006yif", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006yih", "url": "https://www.rcsb.org/structure/pdb_00006yih", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006yov", "url": "https://www.rcsb.org/structure/pdb_00006yov", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007bwd", "url": "https://www.rcsb.org/structure/pdb_00007bwd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007c0m", "url": "https://www.rcsb.org/structure/pdb_00007c0m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ccq", "url": "https://www.rcsb.org/structure/pdb_00007ccq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ccr", "url": "https://www.rcsb.org/structure/pdb_00007ccr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007cfp", "url": "https://www.rcsb.org/structure/pdb_00007cfp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007cfq", "url": "https://www.rcsb.org/structure/pdb_00007cfq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007cow", "url": "https://www.rcsb.org/structure/pdb_00007cow", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007d1z", "url": "https://www.rcsb.org/structure/pdb_00007d1z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007dbp", "url": "https://www.rcsb.org/structure/pdb_00007dbp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007e8d", "url": "https://www.rcsb.org/structure/pdb_00007e8d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ebk", "url": "https://www.rcsb.org/structure/pdb_00007ebk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k5x", "url": "https://www.rcsb.org/structure/pdb_00007k5x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k5y", "url": "https://www.rcsb.org/structure/pdb_00007k5y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k60", "url": "https://www.rcsb.org/structure/pdb_00007k60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k61", "url": "https://www.rcsb.org/structure/pdb_00007k61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k63", "url": "https://www.rcsb.org/structure/pdb_00007k63", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007klr", "url": "https://www.rcsb.org/structure/pdb_00007klr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lbk", "url": "https://www.rcsb.org/structure/pdb_00007lbk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lbo", "url": "https://www.rcsb.org/structure/pdb_00007lbo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lbp", "url": "https://www.rcsb.org/structure/pdb_00007lbp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lbq", "url": "https://www.rcsb.org/structure/pdb_00007lbq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lya", "url": "https://www.rcsb.org/structure/pdb_00007lya", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lyb", "url": "https://www.rcsb.org/structure/pdb_00007lyb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lyc", "url": "https://www.rcsb.org/structure/pdb_00007lyc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007mju", "url": "https://www.rcsb.org/structure/pdb_00007mju", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007nl0", "url": "https://www.rcsb.org/structure/pdb_00007nl0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007scy", "url": "https://www.rcsb.org/structure/pdb_00007scy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007scz", "url": "https://www.rcsb.org/structure/pdb_00007scz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007td5", "url": "https://www.rcsb.org/structure/pdb_00007td5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007u0g", "url": "https://www.rcsb.org/structure/pdb_00007u0g", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007u0i", "url": "https://www.rcsb.org/structure/pdb_00007u0i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007u0j", "url": "https://www.rcsb.org/structure/pdb_00007u0j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v6q", "url": "https://www.rcsb.org/structure/pdb_00007v6q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v90", "url": "https://www.rcsb.org/structure/pdb_00007v90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v96", "url": "https://www.rcsb.org/structure/pdb_00007v96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v9c", "url": "https://www.rcsb.org/structure/pdb_00007v9c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v9j", "url": "https://www.rcsb.org/structure/pdb_00007v9j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v9k", "url": "https://www.rcsb.org/structure/pdb_00007v9k", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007v9s", "url": "https://www.rcsb.org/structure/pdb_00007v9s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007va4", "url": "https://www.rcsb.org/structure/pdb_00007va4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007vz4", "url": "https://www.rcsb.org/structure/pdb_00007vz4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007w9v", "url": "https://www.rcsb.org/structure/pdb_00007w9v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007x57", "url": "https://www.rcsb.org/structure/pdb_00007x57", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007x58", "url": "https://www.rcsb.org/structure/pdb_00007x58", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xd1", "url": "https://www.rcsb.org/structure/pdb_00007xd1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xvl", "url": "https://www.rcsb.org/structure/pdb_00007xvl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xvm", "url": "https://www.rcsb.org/structure/pdb_00007xvm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xx5", "url": "https://www.rcsb.org/structure/pdb_00007xx5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xx6", "url": "https://www.rcsb.org/structure/pdb_00007xx6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xzx", "url": "https://www.rcsb.org/structure/pdb_00007xzx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xzy", "url": "https://www.rcsb.org/structure/pdb_00007xzy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007xzz", "url": "https://www.rcsb.org/structure/pdb_00007xzz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y00", "url": "https://www.rcsb.org/structure/pdb_00007y00", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y5u", "url": "https://www.rcsb.org/structure/pdb_00007y5u", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y5v", "url": "https://www.rcsb.org/structure/pdb_00007y5v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y5w", "url": "https://www.rcsb.org/structure/pdb_00007y5w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y60", "url": "https://www.rcsb.org/structure/pdb_00007y60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y61", "url": "https://www.rcsb.org/structure/pdb_00007y61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y7i", "url": "https://www.rcsb.org/structure/pdb_00007y7i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007y8r", "url": "https://www.rcsb.org/structure/pdb_00007y8r", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007yoz", "url": "https://www.rcsb.org/structure/pdb_00007yoz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007yqk", "url": "https://www.rcsb.org/structure/pdb_00007yqk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007zi4", "url": "https://www.rcsb.org/structure/pdb_00007zi4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008dk5", "url": "https://www.rcsb.org/structure/pdb_00008dk5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ds8", "url": "https://www.rcsb.org/structure/pdb_00008ds8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008evg", "url": "https://www.rcsb.org/structure/pdb_00008evg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008evh", "url": "https://www.rcsb.org/structure/pdb_00008evh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008evi", "url": "https://www.rcsb.org/structure/pdb_00008evi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008evj", "url": "https://www.rcsb.org/structure/pdb_00008evj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ge0", "url": "https://www.rcsb.org/structure/pdb_00008ge0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008grm", "url": "https://www.rcsb.org/structure/pdb_00008grm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008gui", "url": "https://www.rcsb.org/structure/pdb_00008gui", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008guj", "url": "https://www.rcsb.org/structure/pdb_00008guj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008guk", "url": "https://www.rcsb.org/structure/pdb_00008guk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h0v", "url": "https://www.rcsb.org/structure/pdb_00008h0v", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h0w", "url": "https://www.rcsb.org/structure/pdb_00008h0w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008h1t", "url": "https://www.rcsb.org/structure/pdb_00008h1t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hag", "url": "https://www.rcsb.org/structure/pdb_00008hag", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hah", "url": "https://www.rcsb.org/structure/pdb_00008hah", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hai", "url": "https://www.rcsb.org/structure/pdb_00008hai", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008haj", "url": "https://www.rcsb.org/structure/pdb_00008haj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hak", "url": "https://www.rcsb.org/structure/pdb_00008hak", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hal", "url": "https://www.rcsb.org/structure/pdb_00008hal", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ham", "url": "https://www.rcsb.org/structure/pdb_00008ham", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008han", "url": "https://www.rcsb.org/structure/pdb_00008han", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008he5", "url": "https://www.rcsb.org/structure/pdb_00008he5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hly", "url": "https://www.rcsb.org/structure/pdb_00008hly", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008hmx", "url": "https://www.rcsb.org/structure/pdb_00008hmx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008i60", "url": "https://www.rcsb.org/structure/pdb_00008i60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ieg", "url": "https://www.rcsb.org/structure/pdb_00008ieg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008iej", "url": "https://www.rcsb.org/structure/pdb_00008iej", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ihl", "url": "https://www.rcsb.org/structure/pdb_00008ihl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008iiy", "url": "https://www.rcsb.org/structure/pdb_00008iiy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008iiz", "url": "https://www.rcsb.org/structure/pdb_00008iiz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ij0", "url": "https://www.rcsb.org/structure/pdb_00008ij0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008iqf", "url": "https://www.rcsb.org/structure/pdb_00008iqf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008iqg", "url": "https://www.rcsb.org/structure/pdb_00008iqg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008j6s", "url": "https://www.rcsb.org/structure/pdb_00008j6s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008j6t", "url": "https://www.rcsb.org/structure/pdb_00008j6t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jbx", "url": "https://www.rcsb.org/structure/pdb_00008jbx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jcc", "url": "https://www.rcsb.org/structure/pdb_00008jcc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jcd", "url": "https://www.rcsb.org/structure/pdb_00008jcd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jhf", "url": "https://www.rcsb.org/structure/pdb_00008jhf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jhg", "url": "https://www.rcsb.org/structure/pdb_00008jhg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jl9", "url": "https://www.rcsb.org/structure/pdb_00008jl9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jla", "url": "https://www.rcsb.org/structure/pdb_00008jla", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jnd", "url": "https://www.rcsb.org/structure/pdb_00008jnd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jne", "url": "https://www.rcsb.org/structure/pdb_00008jne", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008jnf", "url": "https://www.rcsb.org/structure/pdb_00008jnf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008kcy", "url": "https://www.rcsb.org/structure/pdb_00008kcy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008kd1", "url": "https://www.rcsb.org/structure/pdb_00008kd1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ke0", "url": "https://www.rcsb.org/structure/pdb_00008ke0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008off", "url": "https://www.rcsb.org/structure/pdb_00008off", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008oo7", "url": "https://www.rcsb.org/structure/pdb_00008oo7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ooa", "url": "https://www.rcsb.org/structure/pdb_00008ooa", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008oop", "url": "https://www.rcsb.org/structure/pdb_00008oop", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008oos", "url": "https://www.rcsb.org/structure/pdb_00008oos", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008osj", "url": "https://www.rcsb.org/structure/pdb_00008osj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008osk", "url": "https://www.rcsb.org/structure/pdb_00008osk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008osl", "url": "https://www.rcsb.org/structure/pdb_00008osl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ots", "url": "https://www.rcsb.org/structure/pdb_00008ots", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ott", "url": "https://www.rcsb.org/structure/pdb_00008ott", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ox0", "url": "https://www.rcsb.org/structure/pdb_00008ox0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ox1", "url": "https://www.rcsb.org/structure/pdb_00008ox1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008q36", "url": "https://www.rcsb.org/structure/pdb_00008q36", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008q3e", "url": "https://www.rcsb.org/structure/pdb_00008q3e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008q3m", "url": "https://www.rcsb.org/structure/pdb_00008q3m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008q3x", "url": "https://www.rcsb.org/structure/pdb_00008q3x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008qkt", "url": "https://www.rcsb.org/structure/pdb_00008qkt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008rgm", "url": "https://www.rcsb.org/structure/pdb_00008rgm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008smw", "url": "https://www.rcsb.org/structure/pdb_00008smw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008smx", "url": "https://www.rcsb.org/structure/pdb_00008smx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008smy", "url": "https://www.rcsb.org/structure/pdb_00008smy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008smz", "url": "https://www.rcsb.org/structure/pdb_00008smz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn0", "url": "https://www.rcsb.org/structure/pdb_00008sn0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn1", "url": "https://www.rcsb.org/structure/pdb_00008sn1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn2", "url": "https://www.rcsb.org/structure/pdb_00008sn2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn3", "url": "https://www.rcsb.org/structure/pdb_00008sn3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn4", "url": "https://www.rcsb.org/structure/pdb_00008sn4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn5", "url": "https://www.rcsb.org/structure/pdb_00008sn5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn6", "url": "https://www.rcsb.org/structure/pdb_00008sn6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn7", "url": "https://www.rcsb.org/structure/pdb_00008sn7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn8", "url": "https://www.rcsb.org/structure/pdb_00008sn8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sn9", "url": "https://www.rcsb.org/structure/pdb_00008sn9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sna", "url": "https://www.rcsb.org/structure/pdb_00008sna", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008sps", "url": "https://www.rcsb.org/structure/pdb_00008sps", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008spu", "url": "https://www.rcsb.org/structure/pdb_00008spu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008swi", "url": "https://www.rcsb.org/structure/pdb_00008swi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008syp", "url": "https://www.rcsb.org/structure/pdb_00008syp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008txv", "url": "https://www.rcsb.org/structure/pdb_00008txv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008txw", "url": "https://www.rcsb.org/structure/pdb_00008txw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008txx", "url": "https://www.rcsb.org/structure/pdb_00008txx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008u13", "url": "https://www.rcsb.org/structure/pdb_00008u13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008u14", "url": "https://www.rcsb.org/structure/pdb_00008u14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008upf", "url": "https://www.rcsb.org/structure/pdb_00008upf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vfx", "url": "https://www.rcsb.org/structure/pdb_00008vfx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vfy", "url": "https://www.rcsb.org/structure/pdb_00008vfy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vfz", "url": "https://www.rcsb.org/structure/pdb_00008vfz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vg0", "url": "https://www.rcsb.org/structure/pdb_00008vg0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vg1", "url": "https://www.rcsb.org/structure/pdb_00008vg1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vg2", "url": "https://www.rcsb.org/structure/pdb_00008vg2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vlr", "url": "https://www.rcsb.org/structure/pdb_00008vlr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vmi", "url": "https://www.rcsb.org/structure/pdb_00008vmi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vml", "url": "https://www.rcsb.org/structure/pdb_00008vml", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008vnv", "url": "https://www.rcsb.org/structure/pdb_00008vnv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008w9d", "url": "https://www.rcsb.org/structure/pdb_00008w9d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008w9e", "url": "https://www.rcsb.org/structure/pdb_00008w9e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008w9f", "url": "https://www.rcsb.org/structure/pdb_00008w9f", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008wg5", "url": "https://www.rcsb.org/structure/pdb_00008wg5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008x15", "url": "https://www.rcsb.org/structure/pdb_00008x15", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008x19", "url": "https://www.rcsb.org/structure/pdb_00008x19", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008x1c", "url": "https://www.rcsb.org/structure/pdb_00008x1c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008xbt", "url": "https://www.rcsb.org/structure/pdb_00008xbt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008xbu", "url": "https://www.rcsb.org/structure/pdb_00008xbu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008xbw", "url": "https://www.rcsb.org/structure/pdb_00008xbw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008xrj", "url": "https://www.rcsb.org/structure/pdb_00008xrj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008xvs", "url": "https://www.rcsb.org/structure/pdb_00008xvs", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y3c", "url": "https://www.rcsb.org/structure/pdb_00008y3c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y3d", "url": "https://www.rcsb.org/structure/pdb_00008y3d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y3e", "url": "https://www.rcsb.org/structure/pdb_00008y3e", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y3f", "url": "https://www.rcsb.org/structure/pdb_00008y3f", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ybj", "url": "https://www.rcsb.org/structure/pdb_00008ybj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ybk", "url": "https://www.rcsb.org/structure/pdb_00008ybk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008yjf", "url": "https://www.rcsb.org/structure/pdb_00008yjf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008yjm", "url": "https://www.rcsb.org/structure/pdb_00008yjm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008yny", "url": "https://www.rcsb.org/structure/pdb_00008yny", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008yti", "url": "https://www.rcsb.org/structure/pdb_00008yti", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008yv8", "url": "https://www.rcsb.org/structure/pdb_00008yv8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009ecp", "url": "https://www.rcsb.org/structure/pdb_00009ecp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009ehi", "url": "https://www.rcsb.org/structure/pdb_00009ehi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009fgq", "url": "https://www.rcsb.org/structure/pdb_00009fgq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009fh9", "url": "https://www.rcsb.org/structure/pdb_00009fh9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009gcg", "url": "https://www.rcsb.org/structure/pdb_00009gcg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009ge4", "url": "https://www.rcsb.org/structure/pdb_00009ge4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009ge5", "url": "https://www.rcsb.org/structure/pdb_00009ge5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009gel", "url": "https://www.rcsb.org/structure/pdb_00009gel", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009gev", "url": "https://www.rcsb.org/structure/pdb_00009gev", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009gf6", "url": "https://www.rcsb.org/structure/pdb_00009gf6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009gfb", "url": "https://www.rcsb.org/structure/pdb_00009gfb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009gfm", "url": "https://www.rcsb.org/structure/pdb_00009gfm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009igw", "url": "https://www.rcsb.org/structure/pdb_00009igw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009igx", "url": "https://www.rcsb.org/structure/pdb_00009igx", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009j8m", "url": "https://www.rcsb.org/structure/pdb_00009j8m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009j8n", "url": "https://www.rcsb.org/structure/pdb_00009j8n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009j8o", "url": "https://www.rcsb.org/structure/pdb_00009j8o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009j8w", "url": "https://www.rcsb.org/structure/pdb_00009j8w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009jc6", "url": "https://www.rcsb.org/structure/pdb_00009jc6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mll", "url": "https://www.rcsb.org/structure/pdb_00009mll", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mln", "url": "https://www.rcsb.org/structure/pdb_00009mln", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mlr", "url": "https://www.rcsb.org/structure/pdb_00009mlr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mls", "url": "https://www.rcsb.org/structure/pdb_00009mls", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mmk", "url": "https://www.rcsb.org/structure/pdb_00009mmk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mmm", "url": "https://www.rcsb.org/structure/pdb_00009mmm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mmn", "url": "https://www.rcsb.org/structure/pdb_00009mmn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mmo", "url": "https://www.rcsb.org/structure/pdb_00009mmo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mmt", "url": "https://www.rcsb.org/structure/pdb_00009mmt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009q80", "url": "https://www.rcsb.org/structure/pdb_00009q80", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009q8x", "url": "https://www.rcsb.org/structure/pdb_00009q8x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009q9f", "url": "https://www.rcsb.org/structure/pdb_00009q9f", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009qcr", "url": "https://www.rcsb.org/structure/pdb_00009qcr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009qcs", "url": "https://www.rcsb.org/structure/pdb_00009qcs", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009qlm", "url": "https://www.rcsb.org/structure/pdb_00009qlm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009qms", "url": "https://www.rcsb.org/structure/pdb_00009qms", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009r04", "url": "https://www.rcsb.org/structure/pdb_00009r04", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009r2m", "url": "https://www.rcsb.org/structure/pdb_00009r2m", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009r2p", "url": "https://www.rcsb.org/structure/pdb_00009r2p", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009r2q", "url": "https://www.rcsb.org/structure/pdb_00009r2q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vem", "url": "https://www.rcsb.org/structure/pdb_00009vem", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vew", "url": "https://www.rcsb.org/structure/pdb_00009vew", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vg0", "url": "https://www.rcsb.org/structure/pdb_00009vg0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vg3", "url": "https://www.rcsb.org/structure/pdb_00009vg3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vge", "url": "https://www.rcsb.org/structure/pdb_00009vge", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vgz", "url": "https://www.rcsb.org/structure/pdb_00009vgz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009vh0", "url": "https://www.rcsb.org/structure/pdb_00009vh0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CS9", "url": "https://www.rcsb.org/structure/1CS9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CT6", "url": "https://www.rcsb.org/structure/1CT6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1O9S", "url": "https://www.rcsb.org/structure/1O9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Q3L", "url": "https://www.rcsb.org/structure/1Q3L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B2T", "url": "https://www.rcsb.org/structure/2B2T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B2U", "url": "https://www.rcsb.org/structure/2B2U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B2V", "url": "https://www.rcsb.org/structure/2B2V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B2W", "url": "https://www.rcsb.org/structure/2B2W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2C1J", "url": "https://www.rcsb.org/structure/2C1J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2C1N", "url": "https://www.rcsb.org/structure/2C1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2CO0", "url": "https://www.rcsb.org/structure/2CO0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2CV5", "url": "https://www.rcsb.org/structure/2CV5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FSA", "url": "https://www.rcsb.org/structure/2FSA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KWJ", "url": "https://www.rcsb.org/structure/2KWJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KWK", "url": "https://www.rcsb.org/structure/2KWK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L75", "url": "https://www.rcsb.org/structure/2L75", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LBM", "url": "https://www.rcsb.org/structure/2LBM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LGG", "url": "https://www.rcsb.org/structure/2LGG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M0O", "url": "https://www.rcsb.org/structure/2M0O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NDF", "url": "https://www.rcsb.org/structure/2NDF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NDG", "url": "https://www.rcsb.org/structure/2NDG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OQ6", "url": "https://www.rcsb.org/structure/2OQ6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OT7", "url": "https://www.rcsb.org/structure/2OT7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OX0", "url": "https://www.rcsb.org/structure/2OX0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RI7", "url": "https://www.rcsb.org/structure/2RI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RR4", "url": "https://www.rcsb.org/structure/2RR4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UXN", "url": "https://www.rcsb.org/structure/2UXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V85", "url": "https://www.rcsb.org/structure/2V85", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V89", "url": "https://www.rcsb.org/structure/2V89", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VNF", "url": "https://www.rcsb.org/structure/2VNF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VPG", "url": "https://www.rcsb.org/structure/2VPG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2X0L", "url": "https://www.rcsb.org/structure/2X0L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A1B", "url": "https://www.rcsb.org/structure/3A1B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AFA", "url": "https://www.rcsb.org/structure/3AFA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AVR", "url": "https://www.rcsb.org/structure/3AVR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AYW", "url": "https://www.rcsb.org/structure/3AYW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZE", "url": "https://www.rcsb.org/structure/3AZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZF", "url": "https://www.rcsb.org/structure/3AZF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZG", "url": "https://www.rcsb.org/structure/3AZG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZH", "url": "https://www.rcsb.org/structure/3AZH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZI", "url": "https://www.rcsb.org/structure/3AZI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZJ", "url": "https://www.rcsb.org/structure/3AZJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZK", "url": "https://www.rcsb.org/structure/3AZK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZL", "url": "https://www.rcsb.org/structure/3AZL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZM", "url": "https://www.rcsb.org/structure/3AZM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AZN", "url": "https://www.rcsb.org/structure/3AZN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3B95", "url": "https://www.rcsb.org/structure/3B95", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FDT", "url": "https://www.rcsb.org/structure/3FDT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KMT", "url": "https://www.rcsb.org/structure/3KMT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KQI", "url": "https://www.rcsb.org/structure/3KQI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LQI", "url": "https://www.rcsb.org/structure/3LQI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LQJ", "url": "https://www.rcsb.org/structure/3LQJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MP1", "url": "https://www.rcsb.org/structure/3MP1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3O34", "url": "https://www.rcsb.org/structure/3O34", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3O35", "url": "https://www.rcsb.org/structure/3O35", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3O37", "url": "https://www.rcsb.org/structure/3O37", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3QJ6", "url": "https://www.rcsb.org/structure/3QJ6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RIG", "url": "https://www.rcsb.org/structure/3RIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RIY", "url": "https://www.rcsb.org/structure/3RIY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SOU", "url": "https://www.rcsb.org/structure/3SOU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SOW", "url": "https://www.rcsb.org/structure/3SOW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U31", "url": "https://www.rcsb.org/structure/3U31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U3D", "url": "https://www.rcsb.org/structure/3U3D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U4S", "url": "https://www.rcsb.org/structure/3U4S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U5N", "url": "https://www.rcsb.org/structure/3U5N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U5O", "url": "https://www.rcsb.org/structure/3U5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U5P", "url": "https://www.rcsb.org/structure/3U5P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UEE", "url": "https://www.rcsb.org/structure/3UEE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UEF", "url": "https://www.rcsb.org/structure/3UEF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UIG", "url": "https://www.rcsb.org/structure/3UIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UII", "url": "https://www.rcsb.org/structure/3UII", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UIK", "url": "https://www.rcsb.org/structure/3UIK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3V43", "url": "https://www.rcsb.org/structure/3V43", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W96", "url": "https://www.rcsb.org/structure/3W96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W97", "url": "https://www.rcsb.org/structure/3W97", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W98", "url": "https://www.rcsb.org/structure/3W98", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W99", "url": "https://www.rcsb.org/structure/3W99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WA9", "url": "https://www.rcsb.org/structure/3WA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WAA", "url": "https://www.rcsb.org/structure/3WAA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WKJ", "url": "https://www.rcsb.org/structure/3WKJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X1S", "url": "https://www.rcsb.org/structure/3X1S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X1T", "url": "https://www.rcsb.org/structure/3X1T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X1U", "url": "https://www.rcsb.org/structure/3X1U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X1V", "url": "https://www.rcsb.org/structure/3X1V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZG6", "url": "https://www.rcsb.org/structure/3ZG6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZVY", "url": "https://www.rcsb.org/structure/3ZVY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4A0J", "url": "https://www.rcsb.org/structure/4A0J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4A0N", "url": "https://www.rcsb.org/structure/4A0N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4A7J", "url": "https://www.rcsb.org/structure/4A7J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4BD3", "url": "https://www.rcsb.org/structure/4BD3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4C1Q", "url": "https://www.rcsb.org/structure/4C1Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4F4U", "url": "https://www.rcsb.org/structure/4F4U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4F56", "url": "https://www.rcsb.org/structure/4F56", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FWF", "url": "https://www.rcsb.org/structure/4FWF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HON", "url": "https://www.rcsb.org/structure/4HON", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4I51", "url": "https://www.rcsb.org/structure/4I51", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4L7X", "url": "https://www.rcsb.org/structure/4L7X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LK9", "url": "https://www.rcsb.org/structure/4LK9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LKA", "url": "https://www.rcsb.org/structure/4LKA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LLB", "url": "https://www.rcsb.org/structure/4LLB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LXL", "url": "https://www.rcsb.org/structure/4LXL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4N4H", "url": "https://www.rcsb.org/structure/4N4H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QBQ", "url": "https://www.rcsb.org/structure/4QBQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QBR", "url": "https://www.rcsb.org/structure/4QBR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QBS", "url": "https://www.rcsb.org/structure/4QBS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TN7", "url": "https://www.rcsb.org/structure/4TN7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U68", "url": "https://www.rcsb.org/structure/4U68", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UP0", "url": "https://www.rcsb.org/structure/4UP0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UY4", "url": "https://www.rcsb.org/structure/4UY4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X3K", "url": "https://www.rcsb.org/structure/4X3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Y6L", "url": "https://www.rcsb.org/structure/4Y6L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YHP", "url": "https://www.rcsb.org/structure/4YHP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YHZ", "url": "https://www.rcsb.org/structure/4YHZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YM5", "url": "https://www.rcsb.org/structure/4YM5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YM6", "url": "https://www.rcsb.org/structure/4YM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z0R", "url": "https://www.rcsb.org/structure/4Z0R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z2M", "url": "https://www.rcsb.org/structure/4Z2M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV5", "url": "https://www.rcsb.org/structure/5AV5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV6", "url": "https://www.rcsb.org/structure/5AV6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV8", "url": "https://www.rcsb.org/structure/5AV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AV9", "url": "https://www.rcsb.org/structure/5AV9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AVB", "url": "https://www.rcsb.org/structure/5AVB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AVC", "url": "https://www.rcsb.org/structure/5AVC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B24", "url": "https://www.rcsb.org/structure/5B24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B2I", "url": "https://www.rcsb.org/structure/5B2I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B2J", "url": "https://www.rcsb.org/structure/5B2J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B31", "url": "https://www.rcsb.org/structure/5B31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C11", "url": "https://www.rcsb.org/structure/5C11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C13", "url": "https://www.rcsb.org/structure/5C13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C3I", "url": "https://www.rcsb.org/structure/5C3I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CPI", "url": "https://www.rcsb.org/structure/5CPI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CPJ", "url": "https://www.rcsb.org/structure/5CPJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CPK", "url": "https://www.rcsb.org/structure/5CPK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5D6Y", "url": "https://www.rcsb.org/structure/5D6Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DAH", "url": "https://www.rcsb.org/structure/5DAH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FB0", "url": "https://www.rcsb.org/structure/5FB0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FB1", "url": "https://www.rcsb.org/structure/5FB1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FFV", "url": "https://www.rcsb.org/structure/5FFV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GH9", "url": "https://www.rcsb.org/structure/5GH9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GSE", "url": "https://www.rcsb.org/structure/5GSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GSU", "url": "https://www.rcsb.org/structure/5GSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GT0", "url": "https://www.rcsb.org/structure/5GT0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GT3", "url": "https://www.rcsb.org/structure/5GT3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GTC", "url": "https://www.rcsb.org/structure/5GTC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H6Q", "url": "https://www.rcsb.org/structure/5H6Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H6R", "url": "https://www.rcsb.org/structure/5H6R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HJB", "url": "https://www.rcsb.org/structure/5HJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HJC", "url": "https://www.rcsb.org/structure/5HJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HJD", "url": "https://www.rcsb.org/structure/5HJD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HYN", "url": "https://www.rcsb.org/structure/5HYN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IQL", "url": "https://www.rcsb.org/structure/5IQL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5J3V", "url": "https://www.rcsb.org/structure/5J3V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5J9S", "url": "https://www.rcsb.org/structure/5J9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JHN", "url": "https://www.rcsb.org/structure/5JHN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JIN", "url": "https://www.rcsb.org/structure/5JIN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JIY", "url": "https://www.rcsb.org/structure/5JIY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JJ0", "url": "https://www.rcsb.org/structure/5JJ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JRG", "url": "https://www.rcsb.org/structure/5JRG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KJH", "url": "https://www.rcsb.org/structure/5KJH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KJI", "url": "https://www.rcsb.org/structure/5KJI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KKL", "url": "https://www.rcsb.org/structure/5KKL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LUG", "url": "https://www.rcsb.org/structure/5LUG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M5G", "url": "https://www.rcsb.org/structure/5M5G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MR8", "url": "https://www.rcsb.org/structure/5MR8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NNC", "url": "https://www.rcsb.org/structure/5NNC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NND", "url": "https://www.rcsb.org/structure/5NND", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OY3", "url": "https://www.rcsb.org/structure/5OY3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5SVX", "url": "https://www.rcsb.org/structure/5SVX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5SVY", "url": "https://www.rcsb.org/structure/5SVY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5SZB", "url": "https://www.rcsb.org/structure/5SZB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5SZC", "url": "https://www.rcsb.org/structure/5SZC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0K", "url": "https://www.rcsb.org/structure/5T0K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T0M", "url": "https://www.rcsb.org/structure/5T0M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T1G", "url": "https://www.rcsb.org/structure/5T1G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T1I", "url": "https://www.rcsb.org/structure/5T1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T8R", "url": "https://www.rcsb.org/structure/5T8R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TBN", "url": "https://www.rcsb.org/structure/5TBN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TDR", "url": "https://www.rcsb.org/structure/5TDR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TDW", "url": "https://www.rcsb.org/structure/5TDW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5U2J", "url": "https://www.rcsb.org/structure/5U2J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V21", "url": "https://www.rcsb.org/structure/5V21", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V22", "url": "https://www.rcsb.org/structure/5V22", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VA6", "url": "https://www.rcsb.org/structure/5VA6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VAB", "url": "https://www.rcsb.org/structure/5VAB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VGE", "url": "https://www.rcsb.org/structure/5VGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VNB", "url": "https://www.rcsb.org/structure/5VNB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WFC", "url": "https://www.rcsb.org/structure/5WFC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WLE", "url": "https://www.rcsb.org/structure/5WLE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WVO", "url": "https://www.rcsb.org/structure/5WVO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXG", "url": "https://www.rcsb.org/structure/5WXG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WXH", "url": "https://www.rcsb.org/structure/5WXH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WYI", "url": "https://www.rcsb.org/structure/5WYI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X60", "url": "https://www.rcsb.org/structure/5X60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XF3", "url": "https://www.rcsb.org/structure/5XF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XF4", "url": "https://www.rcsb.org/structure/5XF4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XF5", "url": "https://www.rcsb.org/structure/5XF5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XFQ", "url": "https://www.rcsb.org/structure/5XFQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XFR", "url": "https://www.rcsb.org/structure/5XFR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XNV", "url": "https://www.rcsb.org/structure/5XNV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTZ", "url": "https://www.rcsb.org/structure/5XTZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y0C", "url": "https://www.rcsb.org/structure/5Y0C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y0D", "url": "https://www.rcsb.org/structure/5Y0D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y20", "url": "https://www.rcsb.org/structure/5Y20", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y2F", "url": "https://www.rcsb.org/structure/5Y2F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Z23", "url": "https://www.rcsb.org/structure/5Z23", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Z30", "url": "https://www.rcsb.org/structure/5Z30", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZBX", "url": "https://www.rcsb.org/structure/5ZBX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AXJ", "url": "https://www.rcsb.org/structure/6AXJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AZE", "url": "https://www.rcsb.org/structure/6AZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BHD", "url": "https://www.rcsb.org/structure/6BHD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BHE", "url": "https://www.rcsb.org/structure/6BHE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BHG", "url": "https://www.rcsb.org/structure/6BHG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BHH", "url": "https://www.rcsb.org/structure/6BHH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BHI", "url": "https://www.rcsb.org/structure/6BHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D07", "url": "https://www.rcsb.org/structure/6D07", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D08", "url": "https://www.rcsb.org/structure/6D08", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6E83", "url": "https://www.rcsb.org/structure/6E83", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6E86", "url": "https://www.rcsb.org/structure/6E86", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F6D", "url": "https://www.rcsb.org/structure/6F6D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HKT", "url": "https://www.rcsb.org/structure/6HKT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HTS", "url": "https://www.rcsb.org/structure/6HTS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IEU", "url": "https://www.rcsb.org/structure/6IEU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IIS", "url": "https://www.rcsb.org/structure/6IIS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IIT", "url": "https://www.rcsb.org/structure/6IIT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IPU", "url": "https://www.rcsb.org/structure/6IPU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IQ4", "url": "https://www.rcsb.org/structure/6IQ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JOU", "url": "https://www.rcsb.org/structure/6JOU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JR0", "url": "https://www.rcsb.org/structure/6JR0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JR1", "url": "https://www.rcsb.org/structure/6JR1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JXD", "url": "https://www.rcsb.org/structure/6JXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K1I", "url": "https://www.rcsb.org/structure/6K1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K1J", "url": "https://www.rcsb.org/structure/6K1J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6K1K", "url": "https://www.rcsb.org/structure/6K1K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KE9", "url": "https://www.rcsb.org/structure/6KE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KVD", "url": "https://www.rcsb.org/structure/6KVD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L49", "url": "https://www.rcsb.org/structure/6L49", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L4A", "url": "https://www.rcsb.org/structure/6L4A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L9H", "url": "https://www.rcsb.org/structure/6L9H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L9Z", "url": "https://www.rcsb.org/structure/6L9Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LA2", "url": "https://www.rcsb.org/structure/6LA2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LA8", "url": "https://www.rcsb.org/structure/6LA8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LA9", "url": "https://www.rcsb.org/structure/6LA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LAB", "url": "https://www.rcsb.org/structure/6LAB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LE9", "url": "https://www.rcsb.org/structure/6LE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LER", "url": "https://www.rcsb.org/structure/6LER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LS6", "url": "https://www.rcsb.org/structure/6LS6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LSD", "url": "https://www.rcsb.org/structure/6LSD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M3V", "url": "https://www.rcsb.org/structure/6M3V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M44", "url": "https://www.rcsb.org/structure/6M44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M4D", "url": "https://www.rcsb.org/structure/6M4D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M4G", "url": "https://www.rcsb.org/structure/6M4G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M4H", "url": "https://www.rcsb.org/structure/6M4H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MIL", "url": "https://www.rcsb.org/structure/6MIL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MIM", "url": "https://www.rcsb.org/structure/6MIM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MIN", "url": "https://www.rcsb.org/structure/6MIN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MIO", "url": "https://www.rcsb.org/structure/6MIO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MIQ", "url": "https://www.rcsb.org/structure/6MIQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PA1", "url": "https://www.rcsb.org/structure/6PA1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PAG", "url": "https://www.rcsb.org/structure/6PAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R8Y", "url": "https://www.rcsb.org/structure/6R8Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R8Z", "url": "https://www.rcsb.org/structure/6R8Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R90", "url": "https://www.rcsb.org/structure/6R90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R91", "url": "https://www.rcsb.org/structure/6R91", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R92", "url": "https://www.rcsb.org/structure/6R92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R93", "url": "https://www.rcsb.org/structure/6R93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R94", "url": "https://www.rcsb.org/structure/6R94", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T90", "url": "https://www.rcsb.org/structure/6T90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T93", "url": "https://www.rcsb.org/structure/6T93", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UPK", "url": "https://www.rcsb.org/structure/6UPK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UPL", "url": "https://www.rcsb.org/structure/6UPL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6USJ", "url": "https://www.rcsb.org/structure/6USJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V2H", "url": "https://www.rcsb.org/structure/6V2H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V2K", "url": "https://www.rcsb.org/structure/6V2K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V3N", "url": "https://www.rcsb.org/structure/6V3N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V41", "url": "https://www.rcsb.org/structure/6V41", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6V92", "url": "https://www.rcsb.org/structure/6V92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VIL", "url": "https://www.rcsb.org/structure/6VIL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WAV", "url": "https://www.rcsb.org/structure/6WAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WW4", "url": "https://www.rcsb.org/structure/6WW4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YIF", "url": "https://www.rcsb.org/structure/6YIF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YIH", "url": "https://www.rcsb.org/structure/6YIH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YOV", "url": "https://www.rcsb.org/structure/6YOV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BWD", "url": "https://www.rcsb.org/structure/7BWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7C0M", "url": "https://www.rcsb.org/structure/7C0M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CCQ", "url": "https://www.rcsb.org/structure/7CCQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CCR", "url": "https://www.rcsb.org/structure/7CCR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CFP", "url": "https://www.rcsb.org/structure/7CFP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CFQ", "url": "https://www.rcsb.org/structure/7CFQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7COW", "url": "https://www.rcsb.org/structure/7COW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D1Z", "url": "https://www.rcsb.org/structure/7D1Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DBP", "url": "https://www.rcsb.org/structure/7DBP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E8D", "url": "https://www.rcsb.org/structure/7E8D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EBK", "url": "https://www.rcsb.org/structure/7EBK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K5X", "url": "https://www.rcsb.org/structure/7K5X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K5Y", "url": "https://www.rcsb.org/structure/7K5Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K60", "url": "https://www.rcsb.org/structure/7K60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K61", "url": "https://www.rcsb.org/structure/7K61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K63", "url": "https://www.rcsb.org/structure/7K63", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KLR", "url": "https://www.rcsb.org/structure/7KLR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LBK", "url": "https://www.rcsb.org/structure/7LBK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LBO", "url": "https://www.rcsb.org/structure/7LBO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LBP", "url": "https://www.rcsb.org/structure/7LBP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LBQ", "url": "https://www.rcsb.org/structure/7LBQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYA", "url": "https://www.rcsb.org/structure/7LYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYB", "url": "https://www.rcsb.org/structure/7LYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYC", "url": "https://www.rcsb.org/structure/7LYC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MJU", "url": "https://www.rcsb.org/structure/7MJU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NL0", "url": "https://www.rcsb.org/structure/7NL0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SCY", "url": "https://www.rcsb.org/structure/7SCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SCZ", "url": "https://www.rcsb.org/structure/7SCZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TD5", "url": "https://www.rcsb.org/structure/7TD5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U0G", "url": "https://www.rcsb.org/structure/7U0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U0I", "url": "https://www.rcsb.org/structure/7U0I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U0J", "url": "https://www.rcsb.org/structure/7U0J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V6Q", "url": "https://www.rcsb.org/structure/7V6Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V90", "url": "https://www.rcsb.org/structure/7V90", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V96", "url": "https://www.rcsb.org/structure/7V96", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9C", "url": "https://www.rcsb.org/structure/7V9C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9J", "url": "https://www.rcsb.org/structure/7V9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9K", "url": "https://www.rcsb.org/structure/7V9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V9S", "url": "https://www.rcsb.org/structure/7V9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VA4", "url": "https://www.rcsb.org/structure/7VA4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VZ4", "url": "https://www.rcsb.org/structure/7VZ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7W9V", "url": "https://www.rcsb.org/structure/7W9V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7X57", "url": "https://www.rcsb.org/structure/7X57", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7X58", "url": "https://www.rcsb.org/structure/7X58", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XD1", "url": "https://www.rcsb.org/structure/7XD1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XVL", "url": "https://www.rcsb.org/structure/7XVL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XVM", "url": "https://www.rcsb.org/structure/7XVM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XX5", "url": "https://www.rcsb.org/structure/7XX5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XX6", "url": "https://www.rcsb.org/structure/7XX6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XZX", "url": "https://www.rcsb.org/structure/7XZX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XZY", "url": "https://www.rcsb.org/structure/7XZY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XZZ", "url": "https://www.rcsb.org/structure/7XZZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y00", "url": "https://www.rcsb.org/structure/7Y00", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y5U", "url": "https://www.rcsb.org/structure/7Y5U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y5V", "url": "https://www.rcsb.org/structure/7Y5V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y5W", "url": "https://www.rcsb.org/structure/7Y5W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y60", "url": "https://www.rcsb.org/structure/7Y60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y61", "url": "https://www.rcsb.org/structure/7Y61", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y7I", "url": "https://www.rcsb.org/structure/7Y7I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y8R", "url": "https://www.rcsb.org/structure/7Y8R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7YOZ", "url": "https://www.rcsb.org/structure/7YOZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7YQK", "url": "https://www.rcsb.org/structure/7YQK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZI4", "url": "https://www.rcsb.org/structure/7ZI4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DK5", "url": "https://www.rcsb.org/structure/8DK5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DS8", "url": "https://www.rcsb.org/structure/8DS8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EVG", "url": "https://www.rcsb.org/structure/8EVG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EVH", "url": "https://www.rcsb.org/structure/8EVH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EVI", "url": "https://www.rcsb.org/structure/8EVI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EVJ", "url": "https://www.rcsb.org/structure/8EVJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GE0", "url": "https://www.rcsb.org/structure/8GE0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GRM", "url": "https://www.rcsb.org/structure/8GRM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GUI", "url": "https://www.rcsb.org/structure/8GUI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GUJ", "url": "https://www.rcsb.org/structure/8GUJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GUK", "url": "https://www.rcsb.org/structure/8GUK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0V", "url": "https://www.rcsb.org/structure/8H0V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H0W", "url": "https://www.rcsb.org/structure/8H0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8H1T", "url": "https://www.rcsb.org/structure/8H1T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAG", "url": "https://www.rcsb.org/structure/8HAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAH", "url": "https://www.rcsb.org/structure/8HAH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAI", "url": "https://www.rcsb.org/structure/8HAI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAJ", "url": "https://www.rcsb.org/structure/8HAJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAK", "url": "https://www.rcsb.org/structure/8HAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAL", "url": "https://www.rcsb.org/structure/8HAL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAM", "url": "https://www.rcsb.org/structure/8HAM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HAN", "url": "https://www.rcsb.org/structure/8HAN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HE5", "url": "https://www.rcsb.org/structure/8HE5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HLY", "url": "https://www.rcsb.org/structure/8HLY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8HMX", "url": "https://www.rcsb.org/structure/8HMX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8I60", "url": "https://www.rcsb.org/structure/8I60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IEG", "url": "https://www.rcsb.org/structure/8IEG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IEJ", "url": "https://www.rcsb.org/structure/8IEJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IHL", "url": "https://www.rcsb.org/structure/8IHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IIY", "url": "https://www.rcsb.org/structure/8IIY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IIZ", "url": "https://www.rcsb.org/structure/8IIZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IJ0", "url": "https://www.rcsb.org/structure/8IJ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IQF", "url": "https://www.rcsb.org/structure/8IQF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IQG", "url": "https://www.rcsb.org/structure/8IQG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8J6S", "url": "https://www.rcsb.org/structure/8J6S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8J6T", "url": "https://www.rcsb.org/structure/8J6T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JBX", "url": "https://www.rcsb.org/structure/8JBX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JCC", "url": "https://www.rcsb.org/structure/8JCC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JCD", "url": "https://www.rcsb.org/structure/8JCD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JHF", "url": "https://www.rcsb.org/structure/8JHF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JHG", "url": "https://www.rcsb.org/structure/8JHG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JL9", "url": "https://www.rcsb.org/structure/8JL9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JLA", "url": "https://www.rcsb.org/structure/8JLA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JND", "url": "https://www.rcsb.org/structure/8JND", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JNE", "url": "https://www.rcsb.org/structure/8JNE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8JNF", "url": "https://www.rcsb.org/structure/8JNF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KCY", "url": "https://www.rcsb.org/structure/8KCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KD1", "url": "https://www.rcsb.org/structure/8KD1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8KE0", "url": "https://www.rcsb.org/structure/8KE0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OFF", "url": "https://www.rcsb.org/structure/8OFF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OO7", "url": "https://www.rcsb.org/structure/8OO7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OOA", "url": "https://www.rcsb.org/structure/8OOA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OOP", "url": "https://www.rcsb.org/structure/8OOP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OOS", "url": "https://www.rcsb.org/structure/8OOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OSJ", "url": "https://www.rcsb.org/structure/8OSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OSK", "url": "https://www.rcsb.org/structure/8OSK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OSL", "url": "https://www.rcsb.org/structure/8OSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OTS", "url": "https://www.rcsb.org/structure/8OTS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OTT", "url": "https://www.rcsb.org/structure/8OTT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OX0", "url": "https://www.rcsb.org/structure/8OX0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8OX1", "url": "https://www.rcsb.org/structure/8OX1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Q36", "url": "https://www.rcsb.org/structure/8Q36", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Q3E", "url": "https://www.rcsb.org/structure/8Q3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Q3M", "url": "https://www.rcsb.org/structure/8Q3M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Q3X", "url": "https://www.rcsb.org/structure/8Q3X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8QKT", "url": "https://www.rcsb.org/structure/8QKT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8RGM", "url": "https://www.rcsb.org/structure/8RGM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SMW", "url": "https://www.rcsb.org/structure/8SMW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SMX", "url": "https://www.rcsb.org/structure/8SMX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SMY", "url": "https://www.rcsb.org/structure/8SMY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SMZ", "url": "https://www.rcsb.org/structure/8SMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN0", "url": "https://www.rcsb.org/structure/8SN0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN1", "url": "https://www.rcsb.org/structure/8SN1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN2", "url": "https://www.rcsb.org/structure/8SN2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN3", "url": "https://www.rcsb.org/structure/8SN3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN4", "url": "https://www.rcsb.org/structure/8SN4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN5", "url": "https://www.rcsb.org/structure/8SN5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN6", "url": "https://www.rcsb.org/structure/8SN6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN7", "url": "https://www.rcsb.org/structure/8SN7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN8", "url": "https://www.rcsb.org/structure/8SN8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SN9", "url": "https://www.rcsb.org/structure/8SN9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SNA", "url": "https://www.rcsb.org/structure/8SNA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SPS", "url": "https://www.rcsb.org/structure/8SPS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SPU", "url": "https://www.rcsb.org/structure/8SPU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SWI", "url": "https://www.rcsb.org/structure/8SWI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8SYP", "url": "https://www.rcsb.org/structure/8SYP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8TXV", "url": "https://www.rcsb.org/structure/8TXV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8TXW", "url": "https://www.rcsb.org/structure/8TXW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8TXX", "url": "https://www.rcsb.org/structure/8TXX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8U13", "url": "https://www.rcsb.org/structure/8U13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8U14", "url": "https://www.rcsb.org/structure/8U14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8UPF", "url": "https://www.rcsb.org/structure/8UPF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VFX", "url": "https://www.rcsb.org/structure/8VFX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VFY", "url": "https://www.rcsb.org/structure/8VFY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VFZ", "url": "https://www.rcsb.org/structure/8VFZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VG0", "url": "https://www.rcsb.org/structure/8VG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VG1", "url": "https://www.rcsb.org/structure/8VG1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VG2", "url": "https://www.rcsb.org/structure/8VG2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VLR", "url": "https://www.rcsb.org/structure/8VLR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VMI", "url": "https://www.rcsb.org/structure/8VMI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VML", "url": "https://www.rcsb.org/structure/8VML", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8VNV", "url": "https://www.rcsb.org/structure/8VNV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8W9D", "url": "https://www.rcsb.org/structure/8W9D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8W9E", "url": "https://www.rcsb.org/structure/8W9E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8W9F", "url": "https://www.rcsb.org/structure/8W9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8WG5", "url": "https://www.rcsb.org/structure/8WG5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8X15", "url": "https://www.rcsb.org/structure/8X15", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8X19", "url": "https://www.rcsb.org/structure/8X19", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8X1C", "url": "https://www.rcsb.org/structure/8X1C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8XBT", "url": "https://www.rcsb.org/structure/8XBT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8XBU", "url": "https://www.rcsb.org/structure/8XBU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8XBW", "url": "https://www.rcsb.org/structure/8XBW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8XRJ", "url": "https://www.rcsb.org/structure/8XRJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8XVS", "url": "https://www.rcsb.org/structure/8XVS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y3C", "url": "https://www.rcsb.org/structure/8Y3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y3D", "url": "https://www.rcsb.org/structure/8Y3D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y3E", "url": "https://www.rcsb.org/structure/8Y3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y3F", "url": "https://www.rcsb.org/structure/8Y3F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YBJ", "url": "https://www.rcsb.org/structure/8YBJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YBK", "url": "https://www.rcsb.org/structure/8YBK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YJF", "url": "https://www.rcsb.org/structure/8YJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YJM", "url": "https://www.rcsb.org/structure/8YJM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YNY", "url": "https://www.rcsb.org/structure/8YNY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YTI", "url": "https://www.rcsb.org/structure/8YTI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8YV8", "url": "https://www.rcsb.org/structure/8YV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9ECP", "url": "https://www.rcsb.org/structure/9ECP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9EHI", "url": "https://www.rcsb.org/structure/9EHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9FGQ", "url": "https://www.rcsb.org/structure/9FGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9FH9", "url": "https://www.rcsb.org/structure/9FH9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GCG", "url": "https://www.rcsb.org/structure/9GCG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GE4", "url": "https://www.rcsb.org/structure/9GE4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GE5", "url": "https://www.rcsb.org/structure/9GE5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GEL", "url": "https://www.rcsb.org/structure/9GEL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GEV", "url": "https://www.rcsb.org/structure/9GEV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GF6", "url": "https://www.rcsb.org/structure/9GF6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GFB", "url": "https://www.rcsb.org/structure/9GFB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GFM", "url": "https://www.rcsb.org/structure/9GFM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9IGW", "url": "https://www.rcsb.org/structure/9IGW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9IGX", "url": "https://www.rcsb.org/structure/9IGX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9J8M", "url": "https://www.rcsb.org/structure/9J8M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9J8N", "url": "https://www.rcsb.org/structure/9J8N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9J8O", "url": "https://www.rcsb.org/structure/9J8O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9J8W", "url": "https://www.rcsb.org/structure/9J8W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9JC6", "url": "https://www.rcsb.org/structure/9JC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MLL", "url": "https://www.rcsb.org/structure/9MLL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MLN", "url": "https://www.rcsb.org/structure/9MLN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MLR", "url": "https://www.rcsb.org/structure/9MLR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MLS", "url": "https://www.rcsb.org/structure/9MLS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MMK", "url": "https://www.rcsb.org/structure/9MMK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MMM", "url": "https://www.rcsb.org/structure/9MMM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MMN", "url": "https://www.rcsb.org/structure/9MMN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MMO", "url": "https://www.rcsb.org/structure/9MMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MMT", "url": "https://www.rcsb.org/structure/9MMT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9Q80", "url": "https://www.rcsb.org/structure/9Q80", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9Q8X", "url": "https://www.rcsb.org/structure/9Q8X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9Q9F", "url": "https://www.rcsb.org/structure/9Q9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9QCR", "url": "https://www.rcsb.org/structure/9QCR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9QCS", "url": "https://www.rcsb.org/structure/9QCS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9QLM", "url": "https://www.rcsb.org/structure/9QLM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9QMS", "url": "https://www.rcsb.org/structure/9QMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9R04", "url": "https://www.rcsb.org/structure/9R04", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9R2M", "url": "https://www.rcsb.org/structure/9R2M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9R2P", "url": "https://www.rcsb.org/structure/9R2P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9R2Q", "url": "https://www.rcsb.org/structure/9R2Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VEM", "url": "https://www.rcsb.org/structure/9VEM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VEW", "url": "https://www.rcsb.org/structure/9VEW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VG0", "url": "https://www.rcsb.org/structure/9VG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VG3", "url": "https://www.rcsb.org/structure/9VG3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VGE", "url": "https://www.rcsb.org/structure/9VGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VGZ", "url": "https://www.rcsb.org/structure/9VGZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9VH0", "url": "https://www.rcsb.org/structure/9VH0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00125", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00125", "database": "Pfam", "categories": [ "Other", "Protein Classification" ] }, { "id": "P68431", "url": "https://pharos.nih.gov/targets/P68431", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:P68431", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9610379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9845323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845323", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9909649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9909649", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9940465", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940465", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "NP_003520", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P68431-1", "url": "https://www.uniprot.org/uniprotkb/P68431-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136, "header": "sp|P68431-1|H31_HUMAN Isoform 1 of Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C6 PE=1 SV=2 CANONICAL=P68431-1" }, "isoforms": [ { "isoform_ac": "P68431-1", "url": "https://www.uniprot.org/uniprotkb/P68431/entry#P68431-1", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136, "header": "sp|P68431-1|H31_HUMAN Isoform 1 of Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C6 PE=1 SV=2 CANONICAL=P68431-1" }, "locus": { "chromosome": "6", "start_pos": 26271384, "end_pos": 26270977, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000614378.2", "url": "https://www.ensembl.org/id/ENST00000614378.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000484638.1", "url": "https://www.ensembl.org/id/ENSP00000484638.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 11, "start_aa": "Ser", "end_pos": 11, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser11", "evidence": [ { "id": "36357422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36357422" }, { "id": "P68431", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" }, { "id": "37639774", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37639774" }, { "id": "21896475", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21896475" }, { "id": "40914422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40914422" }, { "id": "28298630", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28298630" }, { "id": "22371497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22371497" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "P68431", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68431" }, { "id": "2886", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2886" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 29, "start_aa": "Ser", "end_pos": 29, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser29", "evidence": [ { "id": "36357422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36357422" }, { "id": "P68431", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" }, { "id": "37639774", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37639774" }, { "id": "21896475", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21896475" }, { "id": "40914422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40914422" }, { "id": "28298630", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28298630" }, { "id": "22371497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22371497" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "P68431", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68431" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 33, "start_aa": "Thr", "end_pos": 33, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr33", "evidence": [ { "id": "36357422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36357422" }, { "id": "P68431", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" }, { "id": "37639774", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37639774" }, { "id": "21896475", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21896475" }, { "id": "40914422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40914422" }, { "id": "28298630", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28298630" }, { "id": "22371497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22371497" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "P68431", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68431" } ], "filter_code": "00000000000000001000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 46, "start_aa": "Thr", "end_pos": 46, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr46", "evidence": [ { "id": "36357422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36357422" }, { "id": "P68431", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" }, { "id": "37639774", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37639774" }, { "id": "21896475", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21896475" }, { "id": "40914422", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40914422" }, { "id": "28298630", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28298630" }, { "id": "22371497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22371497" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" } ], "filter_code": "00000000000000001000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" } ], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "site_lbl": "Thr108" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "O14965-1", "kinase_gene_name": "AURKA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "12588998", "url": "https://glygen.org/publication/PubMed/12588998" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "O75582-1", "kinase_gene_name": "RPS6KA5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" }, { "database": "PubMed", "id": "14625384", "url": "https://glygen.org/publication/PubMed/14625384" }, { "database": "PubMed", "id": "15994958", "url": "https://glygen.org/publication/PubMed/15994958" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P11309-1", "kinase_gene_name": "PIM1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "17643117", "url": "https://glygen.org/publication/PubMed/17643117" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P21980-1", "kinase_gene_name": "TGM2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "16407273", "url": "https://glygen.org/publication/PubMed/16407273" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P31751-1", "kinase_gene_name": "AKT2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "22158034", "url": "https://glygen.org/publication/PubMed/22158034" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" }, { "database": "PubMed", "id": "14625384", "url": "https://glygen.org/publication/PubMed/14625384" }, { "database": "PubMed", "id": "15994958", "url": "https://glygen.org/publication/PubMed/15994958" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "12151336", "url": "https://glygen.org/publication/PubMed/12151336" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "Q16539-1", "kinase_gene_name": "MAPK14", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "20626350", "url": "https://glygen.org/publication/PubMed/20626350" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "12588998", "url": "https://glygen.org/publication/PubMed/12588998" }, { "database": "PubMed", "id": "14583461", "url": "https://glygen.org/publication/PubMed/14583461" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "Q96KB5-1", "kinase_gene_name": "PBK", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "16982762", "url": "https://glygen.org/publication/PubMed/16982762" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "Q99986-1", "kinase_gene_name": "VRK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "17938195", "url": "https://glygen.org/publication/PubMed/17938195" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "Q9UQB9-1", "kinase_gene_name": "AURKC", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "12588998", "url": "https://glygen.org/publication/PubMed/12588998" }, { "database": "PubMed", "id": "14583461", "url": "https://glygen.org/publication/PubMed/14583461" } ], "site_lbl": "Ser11" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "10436156", "url": "https://glygen.org/publication/PubMed/10436156" }, { "database": "PubMed", "id": "12677454", "url": "https://glygen.org/publication/PubMed/12677454" }, { "database": "PubMed", "id": "14583461", "url": "https://glygen.org/publication/PubMed/14583461" }, { "database": "PubMed", "id": "16651411", "url": "https://glygen.org/publication/PubMed/16651411" }, { "database": "PubMed", "id": "18256527", "url": "https://glygen.org/publication/PubMed/18256527" }, { "database": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" }, { "database": "PubMed", "id": "11856369", "url": "https://glygen.org/publication/PubMed/11856369" }, { "database": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" }, { "database": "PubMed", "id": "15681610", "url": "https://glygen.org/publication/PubMed/15681610" }, { "database": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" }, { "database": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" } ], "site_lbl": "Ser11" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "O14757-1", "kinase_gene_name": "CHEK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "18243098", "url": "https://glygen.org/publication/PubMed/18243098" } ], "site_lbl": "Thr12" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC and CHEK1", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" }, { "database": "PubMed", "id": "18066052", "url": "https://glygen.org/publication/PubMed/18066052" }, { "database": "PubMed", "id": "18243098", "url": "https://glygen.org/publication/PubMed/18243098" }, { "database": "PubMed", "id": "22901803", "url": "https://glygen.org/publication/PubMed/22901803" } ], "site_lbl": "Thr12" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "O75582-1", "kinase_gene_name": "RPS6KA5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "20129940", "url": "https://glygen.org/publication/PubMed/20129940" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "11278789", "url": "https://glygen.org/publication/PubMed/11278789" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "11278789", "url": "https://glygen.org/publication/PubMed/11278789" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P31751-1", "kinase_gene_name": "AKT2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "22158034", "url": "https://glygen.org/publication/PubMed/22158034" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "11278789", "url": "https://glygen.org/publication/PubMed/11278789" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "11278789", "url": "https://glygen.org/publication/PubMed/11278789" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "Q16539-1", "kinase_gene_name": "MAPK14", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "11278789", "url": "https://glygen.org/publication/PubMed/11278789" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "11856369", "url": "https://glygen.org/publication/PubMed/11856369" }, { "database": "PubMed", "id": "21282660", "url": "https://glygen.org/publication/PubMed/21282660" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "PubMed", "id": "11856369", "url": "https://glygen.org/publication/PubMed/11856369" }, { "database": "PubMed", "id": "21282660", "url": "https://glygen.org/publication/PubMed/21282660" }, { "database": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" }, { "database": "PubMed", "id": "15681610", "url": "https://glygen.org/publication/PubMed/15681610" }, { "database": "PubMed", "id": "15684425", "url": "https://glygen.org/publication/PubMed/15684425" }, { "database": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" }, { "database": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" } ], "site_lbl": "Ser29" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "19783980", "url": "https://glygen.org/publication/PubMed/19783980" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "site_lbl": "Tyr42" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "P31751-1", "kinase_gene_name": "AKT2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "22158034", "url": "https://glygen.org/publication/PubMed/22158034" } ], "site_lbl": "Thr46" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "Q05655-1", "kinase_gene_name": "PRKCD", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "19363025", "url": "https://glygen.org/publication/PubMed/19363025" } ], "site_lbl": "Thr46" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "19363025", "url": "https://glygen.org/publication/PubMed/19363025" } ], "site_lbl": "Thr46" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HASPIN and VRK1", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "15681610", "url": "https://glygen.org/publication/PubMed/15681610" }, { "database": "PubMed", "id": "19622635", "url": "https://glygen.org/publication/PubMed/19622635" }, { "database": "PubMed", "id": "20705812", "url": "https://glygen.org/publication/PubMed/20705812" }, { "database": "PubMed", "id": "20929775", "url": "https://glygen.org/publication/PubMed/20929775" }, { "database": "PubMed", "id": "20953165", "url": "https://glygen.org/publication/PubMed/20953165" }, { "database": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" } ], "site_lbl": "Thr4" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "20850016", "url": "https://glygen.org/publication/PubMed/20850016" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "site_lbl": "Ser58" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "20228790", "url": "https://glygen.org/publication/PubMed/20228790" } ], "site_lbl": "Thr7" }, { "start_pos": 81, "end_pos": 81, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "20850016", "url": "https://glygen.org/publication/PubMed/20850016" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "site_lbl": "Thr81" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "hMSH5: a human MutS homologue that forms a novel heterodimer with hMSH4 and is expressed during spermatogenesis.", "journal": "Cancer research", "date": "1999", "authors": "Bocker T, Barusevicius A, Snowden T, Rasio D, Guerrette S, Robbins D, Schmidt C, Burczak J, Croce CM, Copeland T, Kovatich AJ, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10029069", "url": "https://glygen.org/publication/PubMed/10029069" } ] }, { "title": "Identification of Tcf4 residues involved in high-affinity beta-catenin binding.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Omer CA, Miller PJ, Diehl RE, Kral AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10080941", "url": "https://glygen.org/publication/PubMed/10080941" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "CHD1 interacts with SSRP1 and depends on both its chromodomain and its ATPase/helicase-like domain for proper association with chromatin.", "journal": "Chromosoma", "date": "1999-04", "authors": "Kelley D E, Stokes D G, Perry R P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "10199952", "url": "https://glygen.org/publication/PubMed/10199952" } ] }, { "title": "The South Amerindian allotype HLA-B*3909 has the largest known similarity in peptide specificity and common natural ligands with HLA-B27.", "journal": "Tissue antigens", "date": "1999-03", "authors": "Yag\u00fce J, Ramos M, V\u00e1zquez J, Marina A, Albar J P, L\u00f3pez de Castro J A", "evidence": [ { "database": "IEDB", "id": "221761", "url": "https://www.iedb.org/epitope/221761" } ], "reference": [ { "type": "PubMed", "id": "10203015", "url": "https://glygen.org/publication/PubMed/10203015" } ] }, { "title": "Ikaros DNA-binding proteins direct formation of chromatin remodeling complexes in lymphocytes.", "journal": "Immunity", "date": "1999-03", "authors": "Kim J, Sif S, Jones B, Jackson A, Koipally J, Heller E, Winandy S, Viel A, Sawyer A, Ikeda T, Kingston R, Georgopoulos K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "10204490", "url": "https://glygen.org/publication/PubMed/10204490" } ] }, { "title": "C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.", "journal": "Blood", "date": "1999", "authors": "Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10233885", "url": "https://glygen.org/publication/PubMed/10233885" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "KAP-1 corepressor protein interacts and colocalizes with heterochromatic and euchromatic HP1 proteins: a potential role for Kruppel-associated box-zinc finger proteins in heterochromatin-mediated gene silencing.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Ryan RF, Schultz DC, Ayyanathan K, Singh PB, Friedman JR, Fredericks WJ, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "10330177", "url": "https://glygen.org/publication/PubMed/10330177" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is a potential retinoid target gene in acute promyelocytic leukemia treatment.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Park DJ, Chumakov AM, Vuong PT, Chih DY, Gombart AF, Miller WH Jr, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10330422", "url": "https://glygen.org/publication/PubMed/10330422" } ] }, { "title": "Oligomerization is required for p53 to be efficiently ubiquitinated by MDM2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10347217", "url": "https://glygen.org/publication/PubMed/10347217" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "PPARgamma activation induces the expression of the adipocyte fatty acid binding protein gene in human monocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Pelton PD, Zhou L, Demarest KT, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "10425206", "url": "https://glygen.org/publication/PubMed/10425206" } ] }, { "title": "Serotonin-inducible transcription of interleukin-1alpha in uterine smooth muscle cells requires an AP-1 site: cloning and partial characterization of the rat IL-1alpha promoter.", "journal": "Molecular and cellular endocrinology", "date": "1999", "authors": "Huang TT, Vinci JM, Lan L, Jeffrey JJ, Wilcox BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10432220", "url": "https://glygen.org/publication/PubMed/10432220" } ] }, { "title": "Requirement of Rsk-2 for epidermal growth factor-activated phosphorylation of histone H3.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Sassone-Corsi P, Mizzen CA, Cheung P, Crosio C, Monaco L, Jacquot S, Hanauer A, Allis CD", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "10436156", "url": "https://glygen.org/publication/PubMed/10436156" } ] }, { "title": "Heteroduplex formation by human Rad51 protein: effects of DNA end-structure, hRP-A and hRad52.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Baumann P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10438626", "url": "https://glygen.org/publication/PubMed/10438626" } ] }, { "title": "Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.", "journal": "Genes & development", "date": "1999", "authors": "Zhang Y, Ng HH, Erdjument-Bromage H, Tempst P, Bird A, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10444591", "url": "https://glygen.org/publication/PubMed/10444591" } ] }, { "title": "CoREST: a functional corepressor required for regulation of neural-specific gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Andres ME, Burger C, Peral-Rubio MJ, Battaglioli E, Anderson ME, Grimes J, Dallman J, Ballas N, Mandel G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10449787", "url": "https://glygen.org/publication/PubMed/10449787" } ] }, { "title": "Identification of a novel phosphorylation site on histone H3 coupled with mitotic chromosome condensation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Goto H, Tomono Y, Ajiro K, Kosako H, Fujita M, Sakurai M, Okawa K, Iwamatsu A, Okigaki T, Takahashi T, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" } ] }, { "title": "MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex.", "journal": "Nature genetics", "date": "1999", "authors": "Ng HH, Zhang Y, Hendrich B, Johnson CA, Turner BM, Erdjument-Bromage H, Tempst P, Reinberg D, Bird A", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "10471499", "url": "https://glygen.org/publication/PubMed/10471499" } ] }, { "title": "A functional interaction between the histone deacetylase Rpd3 and the corepressor groucho in Drosophila development.", "journal": "Genes & development", "date": "1999", "authors": "Chen G, Fernandez J, Mische S, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10485845", "url": "https://glygen.org/publication/PubMed/10485845" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.", "journal": "Nature", "date": "1999", "authors": "Lukas C, Sorensen CS, Kramer E, Santoni-Rugiu E, Lindeneg C, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10548110", "url": "https://glygen.org/publication/PubMed/10548110" } ] }, { "title": "Recombinant human DNA (cytosine-5) methyltransferase. I. Expression, purification, and comparison of de novo and maintenance methylation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Pradhan S, Bacolla A, Wells RD, Roberts RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "10551868", "url": "https://glygen.org/publication/PubMed/10551868" } ] }, { "title": "Activation of PPARgamma coactivator-1 through transcription factor docking.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Puigserver P, Adelmant G, Wu Z, Fan M, Xu J, O'Malley B, Spiegelman BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "10558993", "url": "https://glygen.org/publication/PubMed/10558993" } ] }, { "title": "The meiosis-specific recombinase hDmc1 forms ring structures and interacts with hRad51.", "journal": "The EMBO journal", "date": "1999", "authors": "Masson JY, Davies AA, Hajibagheri N, Van Dyck E, Benson FE, Stasiak AZ, Stasiak A, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10562567", "url": "https://glygen.org/publication/PubMed/10562567" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "A mechanism of repression by acute myeloid leukemia-1, the target of multiple chromosomal translocations in acute leukemia.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lutterbach B, Westendorf JJ, Linggi B, Isaac S, Seto E, Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "10617663", "url": "https://glygen.org/publication/PubMed/10617663" } ] }, { "title": "The transcription factor snail is a repressor of E-cadherin gene expression in epithelial tumour cells.", "journal": "Nature cell biology", "date": "2000", "authors": "Batlle E, Sancho E, Franci C, Dominguez D, Monfar M, Baulida J, Garcia De Herreros A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "10655587", "url": "https://glygen.org/publication/PubMed/10655587" } ] }, { "title": "Mechanisms for the involvement of high molecular weight kininogen in surface-dependent reactions of Hageman factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Griffin JH, Cochrane CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "1066663", "url": "https://glygen.org/publication/PubMed/1066663" } ] }, { "title": "Mdm2 is a RING finger-dependent ubiquitin protein ligase for itself and p53.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Fang S, Jensen JP, Ludwig RL, Vousden KH, Weissman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10722742", "url": "https://glygen.org/publication/PubMed/10722742" } ] }, { "title": "Association of the Bloom syndrome protein with topoisomerase IIIalpha in somatic and meiotic cells.", "journal": "Cancer research", "date": "2000", "authors": "Johnson FB, Lombard DB, Neff NF, Mastrangelo MA, Dewolf W, Ellis NA, Marciniak RA, Yin Y, Jaenisch R, Guarente L", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10728666", "url": "https://glygen.org/publication/PubMed/10728666" } ] }, { "title": "The Bloom's syndrome gene product interacts with topoisomerase III.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Wu L, Davies SL, North PS, Goulaouic H, Riou JF, Turley H, Gatter KC, Hickson ID", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10734115", "url": "https://glygen.org/publication/PubMed/10734115" } ] }, { "title": "Cloning and characterization of a novel human class I histone deacetylase that functions as a transcription repressor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hu E, Chen Z, Fredrickson T, Zhu Y, Kirkpatrick R, Zhang GF, Johanson K, Sung CM, Liu R, Winkler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10748112", "url": "https://glygen.org/publication/PubMed/10748112" } ] }, { "title": "The transcriptional coactivator CBP interacts with beta-catenin to activate gene expression.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Takemaru KI, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10769018", "url": "https://glygen.org/publication/PubMed/10769018" } ] }, { "title": "Immunolocalization of human p14(ARF) to the granular component of the interphase nucleolus.", "journal": "Experimental cell research", "date": "2000", "authors": "Lindstrom MS, Klangby U, Inoue R, Pisa P, Wiman KG, Asker CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10772813", "url": "https://glygen.org/publication/PubMed/10772813" } ] }, { "title": "The p300/CBP acetyltransferases function as transcriptional coactivators of beta-catenin in vertebrates.", "journal": "The EMBO journal", "date": "2000", "authors": "Hecht A, Vleminckx K, Stemmler MP, van Roy F, Kemler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10775268", "url": "https://glygen.org/publication/PubMed/10775268" } ] }, { "title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "10777502", "url": "https://glygen.org/publication/PubMed/10777502" } ] }, { "title": "A new human member of the MYST family of histone acetyl transferases with high sequence similarity to Drosophila MOF.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Neal KC, Pannuti A, Smith ER, Lucchesi JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "10786633", "url": "https://glygen.org/publication/PubMed/10786633" } ] }, { "title": "ATF-2 has intrinsic histone acetyltransferase activity which is modulated by phosphorylation.", "journal": "Nature", "date": "2000", "authors": "Kawasaki H, Schiltz L, Chiu R, Itakura K, Taira K, Nakatani Y, Yokoyama KK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "10821277", "url": "https://glygen.org/publication/PubMed/10821277" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Groucho/TLE family proteins and transcriptional repression.", "journal": "Gene", "date": "2000", "authors": "Chen G, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "10831834", "url": "https://glygen.org/publication/PubMed/10831834" } ] }, { "title": "Crystal structure of the human RXRalpha ligand-binding domain bound to its natural ligand: 9-cis retinoic acid.", "journal": "The EMBO journal", "date": "2000-06-01", "authors": "Egea P F, Mitschler A, Rochel N, Ruff M, Chambon P, Moras D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "10835357", "url": "https://glygen.org/publication/PubMed/10835357" } ] }, { "title": "c-Jun inhibits transforming growth factor beta-mediated transcription by repressing Smad3 transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Dennler S, Prunier C, Ferrand N, Gauthier JM, Atfi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "10871633", "url": "https://glygen.org/publication/PubMed/10871633" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "Asymmetry in the PPARgamma/RXRalpha crystal structure reveals the molecular basis of heterodimerization among nuclear receptors.", "journal": "Molecular cell", "date": "2000-03", "authors": "Gampe R T, Montana V G, Lambert M H, Miller A B, Bledsoe R K, Milburn M V, Kliewer S A, Willson T M, Xu H E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "10882139", "url": "https://glygen.org/publication/PubMed/10882139" } ] }, { "title": "NuRD and SIN3 histone deacetylase complexes in development.", "journal": "Trends in genetics : TIG", "date": "2000", "authors": "Ahringer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10904264", "url": "https://glygen.org/publication/PubMed/10904264" } ] }, { "title": "A novel beta-catenin-binding protein inhibits beta-catenin-dependent Tcf activation and axis formation.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Sakamoto I, Kishida S, Fukui A, Kishida M, Yamamoto H, Hino S, Michiue T, Takada S, Asashima M, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "10921920", "url": "https://glygen.org/publication/PubMed/10921920" } ] }, { "title": "Histone deacetylase inhibitors: inducers of differentiation or apoptosis of transformed cells.", "journal": "Journal of the National Cancer Institute", "date": "2000", "authors": "Marks PA, Richon VM, Rifkind RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10922406", "url": "https://glygen.org/publication/PubMed/10922406" } ] }, { "title": "Cloning and characterization of a novel human histone deacetylase, HDAC8.", "journal": "The Biochemical journal", "date": "2000", "authors": "Buggy JJ, Sideris ML, Mak P, Lorimer DD, McIntosh B, Clark JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "10926844", "url": "https://glygen.org/publication/PubMed/10926844" } ] }, { "title": "MSH4 acts in conjunction with MLH1 during mammalian meiosis.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2000", "authors": "Santucci-Darmanin S, Walpita D, Lespinasse F, Desnuelle C, Ashley T, Paquis-Flucklinger V", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "10928988", "url": "https://glygen.org/publication/PubMed/10928988" } ] }, { "title": "Regulation of chromatin structure by site-specific histone H3 methyltransferases.", "journal": "Nature", "date": "2000", "authors": "Rea S, Eisenhaber F, O'Carroll D, Strahl BD, Sun ZW, Schmid M, Opravil S, Mechtler K, Ponting CP, Allis CD, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "10949293", "url": "https://glygen.org/publication/PubMed/10949293" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "Targeting of Ikaros to pericentromeric heterochromatin by direct DNA binding.", "journal": "Genes & development", "date": "2000", "authors": "Cobb BS, Morales-Alcelay S, Kleiger G, Brown KE, Fisher AG, Smale ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "10970879", "url": "https://glygen.org/publication/PubMed/10970879" } ] }, { "title": "Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.", "journal": "The Journal of biological chemistry", "date": "2000-12-08", "authors": "Perdomo J, Holmes M, Chong B, Crossley M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "10978333", "url": "https://glygen.org/publication/PubMed/10978333" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "Discrete roles for peroxisome proliferator-activated receptor gamma and retinoid X receptor in recruiting nuclear receptor coactivators.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yang W, Rachez C, Freedman LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "11027271", "url": "https://glygen.org/publication/PubMed/11027271" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Multitasking in signal transduction by a promiscuous human Ins(3,4,5,6)P(4) 1-kinase/Ins(1,3,4)P(3) 5/6-kinase.", "journal": "The Biochemical journal", "date": "2000", "authors": "Yang X, Shears SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11042108", "url": "https://glygen.org/publication/PubMed/11042108" } ] }, { "title": "Regulation of beta -catenin transformation by the p300 transcriptional coactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Sun Y, Kolligs FT, Hottiger MO, Mosavin R, Fearon ER, Nabel GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11050151", "url": "https://glygen.org/publication/PubMed/11050151" } ] }, { "title": "Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Nielsen E, Christoforidis S, Uttenweiler-Joseph S, Miaczynska M, Dewitte F, Wilm M, Hoflack B, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11062261", "url": "https://glygen.org/publication/PubMed/11062261" } ] }, { "title": "Human peptidylarginine deiminase type III: molecular cloning and nucleotide sequence of the cDNA, properties of the recombinant enzyme, and immunohistochemical localization in human skin.", "journal": "The Journal of investigative dermatology", "date": "2000", "authors": "Kanno T, Kawada A, Yamanouchi J, Yosida-Noro C, Yoshiki A, Shiraiwa M, Kusakabe M, Manabe M, Tezuka T, Takahara H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "11069618", "url": "https://glygen.org/publication/PubMed/11069618" } ] }, { "title": "Pontin52 and reptin52 function as antagonistic regulators of beta-catenin signalling activity.", "journal": "The EMBO journal", "date": "2000", "authors": "Bauer A, Chauvet S, Huber O, Usseglio F, Rothbacher U, Aragnol D, Kemler R, Pradel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11080158", "url": "https://glygen.org/publication/PubMed/11080158" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Interleukin-6-induced tethering of STAT3 to the LAP/C/EBPbeta promoter suggests a new mechanism of transcriptional regulation by STAT3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Niehof M, Streetz K, Rakemann T, Bischoff SC, Manns MP, Horn F, Trautwein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11114305", "url": "https://glygen.org/publication/PubMed/11114305" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Crystal structure of a beta-catenin/Tcf complex.", "journal": "Cell", "date": "2000", "authors": "Graham TA, Weaver C, Mao F, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11136974", "url": "https://glygen.org/publication/PubMed/11136974" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Factor XII-dependent contact activation on endothelial cells and binding proteins gC1qR and cytokeratin 1.", "journal": "Thrombosis and haemostasis", "date": "2001", "authors": "Joseph K, Shibayama Y, Ghebrehiwet B, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "11204562", "url": "https://glygen.org/publication/PubMed/11204562" } ] }, { "title": "Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.", "journal": "Nature", "date": "2001", "authors": "Lachner M, O'Carroll D, Rea S, Mechtler K, Jenuwein T", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" } ] }, { "title": "Dominant-negative mutations of CEBPA, encoding CCAAT/enhancer binding protein-alpha (C/EBPalpha), in acute myeloid leukemia.", "journal": "Nature genetics", "date": "2001", "authors": "Pabst T, Mueller BU, Zhang P, Radomska HS, Narravula S, Schnittger S, Behre G, Hiddemann W, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11242107", "url": "https://glygen.org/publication/PubMed/11242107" } ] }, { "title": "Cell autonomous regulation of multiple Dishevelled-dependent pathways by mammalian Nkd.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Yan D, Wallingford JB, Sun TQ, Nelson AM, Sakanaka C, Reinhard C, Harland RM, Fantl WJ, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "11274398", "url": "https://glygen.org/publication/PubMed/11274398" } ] }, { "title": "MAP kinases mediate UVB-induced phosphorylation of histone H3 at serine 28.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zhong S, Zhang Y, Jansen C, Goto H, Inagaki M, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "11278789", "url": "https://glygen.org/publication/PubMed/11278789" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "The interacting domains of three MutL heterodimers in man: hMLH1 interacts with 36 homologous amino acid residues within hMLH3, hPMS1 and hPMS2.", "journal": "Nucleic acids research", "date": "2001", "authors": "Kondo E, Horii A, Fukushige S", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "11292842", "url": "https://glygen.org/publication/PubMed/11292842" } ] }, { "title": "A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Sorensen CS, Lukas C, Kramer ER, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11340163", "url": "https://glygen.org/publication/PubMed/11340163" } ] }, { "title": "c-Myc is a critical target for c/EBPalpha in granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Johansen LM, Iwama A, Lodie TA, Sasaki K, Felsher DW, Golub TR, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11340171", "url": "https://glygen.org/publication/PubMed/11340171" } ] }, { "title": "Methylation of histone H3 by coactivator-associated arginine methyltransferase 1.", "journal": "Biochemistry", "date": "2001", "authors": "Schurter BT, Koh SS, Chen D, Bunick GJ, Harp JM, Hanson BL, Henschen-Edman A, Mackay DR, Stallcup MR, Aswad DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11341840", "url": "https://glygen.org/publication/PubMed/11341840" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "Vertebrate proteins related to Drosophila Naked Cuticle bind Dishevelled and antagonize Wnt signaling.", "journal": "Developmental biology", "date": "2001", "authors": "Wharton KA Jr, Zimmermann G, Rousset R, Scott MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "11356022", "url": "https://glygen.org/publication/PubMed/11356022" } ] }, { "title": "CCAAT/enhancer-binding protein-alpha cooperates with p21 to inhibit cyclin-dependent kinase-2 activity and induces growth arrest independent of DNA binding.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harris TE, Albrecht JH, Nakanishi M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11369759", "url": "https://glygen.org/publication/PubMed/11369759" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Human thymic stromal lymphopoietin preferentially stimulates myeloid cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Reche PA, Soumelis V, Gorman DM, Clifford T, Liu Mr, Travis M, Zurawski SM, Johnston J, Liu YJ, Spits H, de Waal Malefyt R, Kastelein RA, Bazan JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11418668", "url": "https://glygen.org/publication/PubMed/11418668" } ] }, { "title": "Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1.", "journal": "Current biology : CB", "date": "2001", "authors": "Strahl BD, Briggs SD, Brame CJ, Caldwell JA, Koh SS, Ma H, Cook RG, Shabanowitz J, Hunt DF, Stallcup MR, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11448779", "url": "https://glygen.org/publication/PubMed/11448779" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Differences in the expression of human class I MHC alleles and their associated peptides in the presence of proteasome inhibitors.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001-08-01", "authors": "Luckey C J, Marto J A, Partridge M, Hall E, White F M, Lippolis J D, Shabanowitz J, Hunt D F, Engelhard V H", "evidence": [ { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "236258", "url": "https://www.iedb.org/epitope/236258" } ], "reference": [ { "type": "PubMed", "id": "11466336", "url": "https://glygen.org/publication/PubMed/11466336" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "PA subunit from influenza virus polymerase complex interacts with a cellular protein with homology to a family of transcriptional activators.", "journal": "Journal of virology", "date": "2001", "authors": "Huarte M, Sanz-Ezquerro JJ, Roncal F, Ortin J, Nieto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "11507205", "url": "https://glygen.org/publication/PubMed/11507205" } ] }, { "title": "The SMRT and N-CoR corepressors are activating cofactors for histone deacetylase 3.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Guenther MG, Barak O, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11509652", "url": "https://glygen.org/publication/PubMed/11509652" } ] }, { "title": "The chromatin remodelling factor Brg-1 interacts with beta-catenin to promote target gene activation.", "journal": "The EMBO journal", "date": "2001", "authors": "Barker N, Hurlstone A, Musisi H, Miles A, Bienz M, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11532957", "url": "https://glygen.org/publication/PubMed/11532957" } ] }, { "title": "Cutting edge: Identification of a hybrid cytokine consisting of IL-7 and the beta-chain of the hepatocyte growth factor/scatter factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Lai L, Goldschneider I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11564764", "url": "https://glygen.org/publication/PubMed/11564764" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.", "journal": "Molecular cell", "date": "2001", "authors": "Wang H, Iakova P, Wilde M, Welm A, Goode T, Roesler WJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11684017", "url": "https://glygen.org/publication/PubMed/11684017" } ] }, { "title": "Structure of a human Tcf4-beta-catenin complex.", "journal": "Nature structural biology", "date": "2001", "authors": "Poy F, Lepourcelet M, Shivdasani RA, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11713476", "url": "https://glygen.org/publication/PubMed/11713476" } ] }, { "title": "The IL-7 receptor controls the accessibility of the TCRgamma locus by Stat5 and histone acetylation.", "journal": "Immunity", "date": "2001", "authors": "Ye SK, Agata Y, Lee HC, Kurooka H, Kitamura T, Shimizu A, Honjo T, Ikuta K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11728342", "url": "https://glygen.org/publication/PubMed/11728342" } ] }, { "title": "Isolation and characterization of a novel class II histone deacetylase, HDAC10.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fischer DD, Cai R, Bhatia U, Asselbergs FA, Song C, Terry R, Trogani N, Widmer R, Atadja P, Cohen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11739383", "url": "https://glygen.org/publication/PubMed/11739383" } ] }, { "title": "An immediate response of ribosomal transcription to growth factor stimulation in mammals is mediated by ERK phosphorylation of UBF.", "journal": "Molecular cell", "date": "2001", "authors": "Stefanovsky VY, Pelletier G, Hannan R, Gagnon-Kugler T, Rothblum LI, Moss T", "evidence": [ { "database": "Reactome", "id": "R-HSA-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728" } ], "reference": [ { "type": "PubMed", "id": "11741541", "url": "https://glygen.org/publication/PubMed/11741541" } ] }, { "title": "Valproic acid defines a novel class of HDAC inhibitors inducing differentiation of transformed cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Gottlicher M, Minucci S, Zhu P, Kramer OH, Schimpf A, Giavara S, Sleeman JP, Lo Coco F, Nervi C, Pelicci PG, Heinzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11742974", "url": "https://glygen.org/publication/PubMed/11742974" } ] }, { "title": "RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11744692", "url": "https://glygen.org/publication/PubMed/11744692" } ] }, { "title": "Nuclear localization of Duplin, a beta-catenin-binding protein, is essential for its inhibitory activity on the Wnt signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2002-02-22", "authors": "Kobayashi Masashi, Kishida Shosei, Fukui Akimasa, Michiue Tatsuo, Miyamoto Yoichi, Okamoto Tetsuji, Yoneda Yoshihiro, Asashima Makoto, Kikuchi Akira", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "11744694", "url": "https://glygen.org/publication/PubMed/11744694" } ] }, { "title": "The heterogeneous nuclear ribonucleoprotein K (hnRNP K) interacts with dengue virus core protein.", "journal": "DNA and cell biology", "date": "2001", "authors": "Chang CJ, Luh HW, Wang SH, Lin HJ, Lee SC, Hu ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "11747608", "url": "https://glygen.org/publication/PubMed/11747608" } ] }, { "title": "Hormone-dependent, CARM1-directed, arginine-specific methylation of histone H3 on a steroid-regulated promoter.", "journal": "Current biology : CB", "date": "2001", "authors": "Ma H, Baumann CT, Li H, Strahl BD, Rice R, Jelinek MA, Aswad DW, Allis CD, Hager GL, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11747826", "url": "https://glygen.org/publication/PubMed/11747826" } ] }, { "title": "Methylation at arginine 17 of histone H3 is linked to gene activation.", "journal": "EMBO reports", "date": "2002", "authors": "Bauer UM, Daujat S, Nielsen SJ, Nightingale K, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11751582", "url": "https://glygen.org/publication/PubMed/11751582" } ] }, { "title": "Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.", "journal": "Genes & development", "date": "2001", "authors": "Sigurdsson S, Van Komen S, Bussen W, Schild D, Albala JS, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11751636", "url": "https://glygen.org/publication/PubMed/11751636" } ] }, { "title": "A novel WD repeat protein component of the methylosome binds Sm proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Friesen WJ, Wyce A, Paushkin S, Abel L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11756452", "url": "https://glygen.org/publication/PubMed/11756452" } ] }, { "title": "Identification and characterization of prolylcarboxypeptidase as an endothelial cell prekallikrein activator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "11830581", "url": "https://glygen.org/publication/PubMed/11830581" } ] }, { "title": "Nuclear import and export signals in control of the p53-related protein p73.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Inoue T, Stuart J, Leno R, Maki CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "11847229", "url": "https://glygen.org/publication/PubMed/11847229" } ] }, { "title": "Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2002", "authors": "Goto H, Yasui Y, Nigg EA, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "11856369", "url": "https://glygen.org/publication/PubMed/11856369" } ] }, { "title": "C/EBPalpha triggers proteasome-dependent degradation of cdk4 during growth arrest.", "journal": "The EMBO journal", "date": "2002", "authors": "Wang H, Goode T, Iakova P, Albrecht JH, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11867521", "url": "https://glygen.org/publication/PubMed/11867521" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "The human beta-globin locus control region.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Levings PP, Bungert J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11895428", "url": "https://glygen.org/publication/PubMed/11895428" } ] }, { "title": "Identification of mammalian Sds3 as an integral component of the Sin3/histone deacetylase corepressor complex.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Alland L, David G, Shen-Li H, Potes J, Muhle R, Lee HC, Hou H Jr, Chen K, DePinho RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "11909966", "url": "https://glygen.org/publication/PubMed/11909966" } ] }, { "title": "The SLUG zinc-finger protein represses E-cadherin in breast cancer.", "journal": "Cancer research", "date": "2002", "authors": "Hajra KM, Chen DY, Fearon ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "11912130", "url": "https://glygen.org/publication/PubMed/11912130" } ] }, { "title": "TCF: Lady Justice casting the final verdict on the outcome of Wnt signalling.", "journal": "Biological chemistry", "date": "2002", "authors": "Brantjes H, Barker N, van Es J, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11934263", "url": "https://glygen.org/publication/PubMed/11934263" } ] }, { "title": "Membrane topology and mitochondrial targeting of mitofusins, ubiquitous mammalian homologs of the transmembrane GTPase Fzo.", "journal": "Journal of cell science", "date": "2002", "authors": "Rojo M, Legros F, Chateau D, Lombes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "11950885", "url": "https://glygen.org/publication/PubMed/11950885" } ] }, { "title": "Wnt/wingless signaling requires BCL9/legless-mediated recruitment of pygopus to the nuclear beta-catenin-TCF complex.", "journal": "Cell", "date": "2002", "authors": "Kramps T, Peter O, Brunner E, Nellen D, Froesch B, Chatterjee S, Murone M, Zullig S, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11955446", "url": "https://glygen.org/publication/PubMed/11955446" } ] }, { "title": "SETDB1: a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.", "journal": "Genes & development", "date": "2002", "authors": "Schultz DC, Ayyanathan K, Negorev D, Maul GG, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "11959841", "url": "https://glygen.org/publication/PubMed/11959841" } ] }, { "title": "Acetylation of beta-catenin by CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wolf D, Rodova M, Miska EA, Calvet JP, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11973335", "url": "https://glygen.org/publication/PubMed/11973335" } ] }, { "title": "Factor XII interacts with the multiprotein assembly of urokinase plasminogen activator receptor, gC1qR, and cytokeratin 1 on endothelial cell membranes.", "journal": "Blood", "date": "2002", "authors": "Mahdi F, Madar ZS, Figueroa CD, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "11986212", "url": "https://glygen.org/publication/PubMed/11986212" } ] }, { "title": "A new nuclear component of the Wnt signalling pathway.", "journal": "Nature cell biology", "date": "2002", "authors": "Thompson B, Townsley F, Rosin-Arbesfeld R, Musisi H, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "11988739", "url": "https://glygen.org/publication/PubMed/11988739" } ] }, { "title": "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hakimi MA, Bochar DA, Chenoweth J, Lane WS, Mandel G, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12032298", "url": "https://glygen.org/publication/PubMed/12032298" } ] }, { "title": "PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.", "journal": "Molecular cell", "date": "2002", "authors": "Nishioka K, Rice JC, Sarma K, Erdjument-Bromage H, Werner J, Wang Y, Chuikov S, Valenzuela P, Tempst P, Steward R, Lis JT, Allis CD, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "12086618", "url": "https://glygen.org/publication/PubMed/12086618" } ] }, { "title": "Methylation of H3-lysine 79 is mediated by a new family of HMTases without a SET domain.", "journal": "Current biology : CB", "date": "2002", "authors": "Feng Q, Wang H, Ng HH, Erdjument-Bromage H, Tempst P, Struhl K, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12123582", "url": "https://glygen.org/publication/PubMed/12123582" } ] }, { "title": "G9a histone methyltransferase plays a dominant role in euchromatic histone H3 lysine 9 methylation and is essential for early embryogenesis.", "journal": "Genes & development", "date": "2002", "authors": "Tachibana M, Sugimoto K, Nozaki M, Ueda J, Ohta T, Ohki M, Fukuda M, Takeda N, Niida H, Kato H, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12130538", "url": "https://glygen.org/publication/PubMed/12130538" } ] }, { "title": "Molecular interpretation of ERK signal duration by immediate early gene products.", "journal": "Nature cell biology", "date": "2002", "authors": "Murphy LO, Smith S, Chen RH, Fingar DC, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12134156", "url": "https://glygen.org/publication/PubMed/12134156" } ] }, { "title": "Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.", "journal": "Nature cell biology", "date": "2002", "authors": "Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12134158", "url": "https://glygen.org/publication/PubMed/12134158" } ] }, { "title": "p21-activated kinase 1 interacts with and phosphorylates histone H3 in breast cancer cells.", "journal": "EMBO reports", "date": "2002", "authors": "Li F, Adam L, Vadlamudi RK, Zhou H, Sen S, Chernoff J, Mandal M, Kumar R", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "12151336", "url": "https://glygen.org/publication/PubMed/12151336" } ] }, { "title": "pygopus Encodes a nuclear protein essential for wingless/Wnt signaling.", "journal": "Development (Cambridge, England)", "date": "2002", "authors": "Belenkaya TY, Han C, Standley HJ, Lin X, Houston DW, Heasman J, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "12163411", "url": "https://glygen.org/publication/PubMed/12163411" } ] }, { "title": "Two highly related p66 proteins comprise a new family of potent transcriptional repressors interacting with MBD2 and MBD3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Brackertz M, Boeke J, Zhang R, Renkawitz R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "12183469", "url": "https://glygen.org/publication/PubMed/12183469" } ] }, { "title": "Pre-pro-B cell growth-stimulating factor (PPBSF) upregulates IL-7Ralpha chain expression and enables pro-B cells to respond to monomeric IL-7.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2002", "authors": "Wei C, Lai L, Goldschneider I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "12184921", "url": "https://glygen.org/publication/PubMed/12184921" } ] }, { "title": "Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuura H, Nishitoh H, Takeda K, Matsuzawa A, Amagasa T, Ito M, Yoshioka K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12189133", "url": "https://glygen.org/publication/PubMed/12189133" } ] }, { "title": "Evidence of functional modulation of the MEKK/JNK/cJun signaling cascade by the low density lipoprotein receptor-related protein (LRP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lutz C, Nimpf J, Jenny M, Boecklinger K, Enzinger C, Utermann G, Baier-Bitterlich G, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12193592", "url": "https://glygen.org/publication/PubMed/12193592" } ] }, { "title": "Mitotic-specific methylation of histone H4 Lys 20 follows increased PR-Set7 expression and its localization to mitotic chromosomes.", "journal": "Genes & development", "date": "2002", "authors": "Rice JC, Nishioka K, Sarma K, Steward R, Reinberg D, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "12208845", "url": "https://glygen.org/publication/PubMed/12208845" } ] }, { "title": "Calreticulin interacts with C/EBPalpha and C/EBPbeta mRNAs and represses translation of C/EBP proteins.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Timchenko LT, Iakova P, Welm AL, Cai ZJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12242300", "url": "https://glygen.org/publication/PubMed/12242300" } ] }, { "title": "Role of histone H3 lysine 27 methylation in Polycomb-group silencing.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Cao R, Wang L, Wang H, Xia L, Erdjument-Bromage H, Tempst P, Jones RS, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "12351676", "url": "https://glygen.org/publication/PubMed/12351676" } ] }, { "title": "Human peptidylarginine deiminase type II: molecular cloning, gene organization, and expression in human skin.", "journal": "Archives of biochemistry and biophysics", "date": "2002", "authors": "Ishigami A, Ohsawa T, Asaga H, Akiyama K, Kuramoto M, Maruyama N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "12392711", "url": "https://glygen.org/publication/PubMed/12392711" } ] }, { "title": "The human and mouse replication-dependent histone genes.", "journal": "Genomics", "date": "2002", "authors": "Marzluff WF, Gongidi P, Woods KR, Jin J, Maltais LJ", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "12408966", "url": "https://glygen.org/publication/PubMed/12408966" } ] }, { "title": "cDNA cloning, gene organization and expression analysis of human peptidylarginine deiminase type I.", "journal": "The Biochemical journal", "date": "2003", "authors": "Guerrin M, Ishigami A, Mechin MC, Nachat R, Valmary S, Sebbag M, Simon M, Senshu T, Serre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "12416996", "url": "https://glygen.org/publication/PubMed/12416996" } ] }, { "title": "CSB is a component of RNA pol I transcription.", "journal": "Molecular cell", "date": "2002", "authors": "Bradsher J, Auriol J, Proietti de Santis L, Iben S, Vonesch JL, Grummt I, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "12419226", "url": "https://glygen.org/publication/PubMed/12419226" } ] }, { "title": "Acetylation of p53 inhibits its ubiquitination by Mdm2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li M, Luo J, Brooks CL, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12421820", "url": "https://glygen.org/publication/PubMed/12421820" } ] }, { "title": "Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lio YC, Mazin AV, Kowalczykowski SC, Chen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "12427746", "url": "https://glygen.org/publication/PubMed/12427746" } ] }, { "title": "Histone methyltransferase activity associated with a human multiprotein complex containing the Enhancer of Zeste protein.", "journal": "Genes & development", "date": "2002", "authors": "Kuzmichev A, Nishioka K, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12435631", "url": "https://glygen.org/publication/PubMed/12435631" } ] }, { "title": "MLL targets SET domain methyltransferase activity to Hox gene promoters.", "journal": "Molecular cell", "date": "2002", "authors": "Milne TA, Briggs SD, Brock HW, Martin ME, Gibbs D, Allis CD, Hess JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12453418", "url": "https://glygen.org/publication/PubMed/12453418" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "The DNA methyltransferase-like protein DNMT3L stimulates de novo methylation by Dnmt3a.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Chedin F, Lieber MR, Hsieh CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "12481029", "url": "https://glygen.org/publication/PubMed/12481029" } ] }, { "title": "Molecular cloning and characterization of the GATA1 cofactor human FOG1 and assessment of its binding to GATA1 proteins carrying D218 substitutions.", "journal": "Human genetics", "date": "2003", "authors": "Freson K, Thys C, Wittewrongel C, Vermylen J, Hoylaerts MF, Van Geet C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12483298", "url": "https://glygen.org/publication/PubMed/12483298" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "MBD3L1 and MBD3L2, two new proteins homologous to the methyl-CpG-binding proteins MBD2 and MBD3: characterization of MBD3L1 as a testis-specific transcriptional repressor.", "journal": "Genomics", "date": "2002-12", "authors": "Jiang Chun Ling, Jin Seung Gi, Lee Dong Hyun, Lan Zi Jian, Xu Xueping, O'Connor Timothy R, Szab\u00f3 Piroska E, Mann Jeffrey R, Cooney Austin J, Pfeifer Gerd P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "12504854", "url": "https://glygen.org/publication/PubMed/12504854" } ] }, { "title": "A novel inducible transactivation domain in the androgen receptor: implications for PRK in prostate cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Metzger E, Muller JM, Ferrari S, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "12514133", "url": "https://glygen.org/publication/PubMed/12514133" } ] }, { "title": "Structure and catalytic mechanism of the human histone methyltransferase SET7/9.", "journal": "Nature", "date": "2003", "authors": "Xiao B, Jing C, Wilson JR, Walker PA, Vasisht N, Kelly G, Howell S, Taylor IA, Blackburn GM, Gamblin SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12540855", "url": "https://glygen.org/publication/PubMed/12540855" } ] }, { "title": "Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.", "journal": "Nucleic acids research", "date": "2003", "authors": "Preuss U, Landsberg G, Scheidtmann KH", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" } ] }, { "title": "RUNX1 and GATA-1 coexpression and cooperation in megakaryocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Elagib KE, Racke FK, Mogass M, Khetawat R, Delehanty LL, Goldfarb AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12576332", "url": "https://glygen.org/publication/PubMed/12576332" } ] }, { "title": "Cascade of distinct histone modifications during collagenase gene activation.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Martens JH, Verlaan M, Kalkhoven E, Zantema A", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "12588998", "url": "https://glygen.org/publication/PubMed/12588998" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Rrn3 becomes inactivated in the process of ribosomal DNA transcription.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hirschler-Laszkiewicz I, Cavanaugh AH, Mirza A, Lun M, Hu Q, Smink T, Rothblum LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772" } ], "reference": [ { "type": "PubMed", "id": "12646563", "url": "https://glygen.org/publication/PubMed/12646563" } ] }, { "title": "Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.", "journal": "Genes & development", "date": "2003", "authors": "Wysocka J, Myers MP, Laherty CD, Eisenman RN, Herr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "12670868", "url": "https://glygen.org/publication/PubMed/12670868" } ] }, { "title": "Ectopic localization of phosphorylated histone H3 in Alzheimer's disease: a mitotic catastrophe?", "journal": "Acta neuropathologica", "date": "2003", "authors": "Ogawa O, Zhu X, Lee HG, Raina A, Obrenovich ME, Bowser R, Ghanbari HA, Castellani RJ, Perry G, Smith MA", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "12677454", "url": "https://glygen.org/publication/PubMed/12677454" } ] }, { "title": "Chromatin remodeling protein Chd1 interacts with transcription elongation factors and localizes to transcribed genes.", "journal": "The EMBO journal", "date": "2003-04-15", "authors": "Simic Rajna, Lindstrom Derek L, Tran Hien G, Roinick Kelli L, Costa Patrick J, Johnson Alexander D, Hartzog Grant A, Arndt Karen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "12682017", "url": "https://glygen.org/publication/PubMed/12682017" } ] }, { "title": "Coordinated histone modifications mediated by a CtBP co-repressor complex.", "journal": "Nature", "date": "2003", "authors": "Shi Y, Sawada J, Sui G, Affar el B, Whetstine JR, Lan F, Ogawa H, Luke MP, Nakatani Y, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "12700765", "url": "https://glygen.org/publication/PubMed/12700765" } ] }, { "title": "Transcription activation function of C/EBPalpha is required for induction of granulocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Keeshan K, Santilli G, Corradini F, Perrotti D, Calabretta B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12702500", "url": "https://glygen.org/publication/PubMed/12702500" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "Identification and characterization of three new components of the mSin3A corepressor complex.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Fleischer TC, Yun UJ, Ayer DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "12724404", "url": "https://glygen.org/publication/PubMed/12724404" } ] }, { "title": "Regulation of PRAK subcellular location by p38 MAP kinases.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "New L, Jiang Y, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "12808055", "url": "https://glygen.org/publication/PubMed/12808055" } ] }, { "title": "Induction of adiponectin, a fat-derived antidiabetic and antiatherogenic factor, by nuclear receptors.", "journal": "Diabetes", "date": "2003", "authors": "Iwaki M, Matsuda M, Maeda N, Funahashi T, Matsuzawa Y, Makishima M, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "12829629", "url": "https://glygen.org/publication/PubMed/12829629" } ] }, { "title": "Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Roux PP, Richards SA, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "12832467", "url": "https://glygen.org/publication/PubMed/12832467" } ] }, { "title": "Microtubule network facilitates nuclear targeting of human cytomegalovirus capsid.", "journal": "Journal of virology", "date": "2003", "authors": "Ogawa-Goto K, Tanaka K, Gibson W, Moriishi E, Miura Y, Kurata T, Irie S, Sata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "12857923", "url": "https://glygen.org/publication/PubMed/12857923" } ] }, { "title": "The amino terminal and E2F interaction domains are critical for C/EBP alpha-mediated induction of granulopoietic development of hematopoietic cells.", "journal": "Blood", "date": "2003", "authors": "D'Alo' F, Johansen LM, Nelson EA, Radomska HS, Evans EK, Zhang P, Nerlov C, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12869508", "url": "https://glygen.org/publication/PubMed/12869508" } ] }, { "title": "Regulated recruitment of HP1 to a euchromatic gene induces mitotically heritable, epigenetic gene silencing: a mammalian cell culture model of gene variegation.", "journal": "Genes & development", "date": "2003-08-01", "authors": "Ayyanathan Kasirajan, Lechner Mark S, Bell Peter, Maul Gerd G, Schultz David C, Yamada Yoshihiko, Tanaka Kazuhiro, Torigoe Kiyoyuki, Rauscher Frank J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "12869583", "url": "https://glygen.org/publication/PubMed/12869583" } ] }, { "title": "Expression of the Wdr9 gene and protein products during mouse development.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2003", "authors": "Huang H, Rambaldi I, Daniels E, Featherstone M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "12889071", "url": "https://glygen.org/publication/PubMed/12889071" } ] }, { "title": "The ORC1 cycle in human cells: II. Dynamic changes in the human ORC complex during the cell cycle.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ohta S, Tatsumi Y, Fujita M, Tsurimoto T, Obuse C", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "12909626", "url": "https://glygen.org/publication/PubMed/12909626" } ] }, { "title": "The relative priority of prekallikrein and factors XI/XIa assembly on cultured endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Mahdi F, Shariat-Madar Z, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "12944405", "url": "https://glygen.org/publication/PubMed/12944405" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "9-cis retinoic acid is a high affinity ligand for the retinoid X receptor.", "journal": "Cell", "date": "1992-01-24", "authors": "Heyman R A, Mangelsdorf D J, Dyck J A, Stein R B, Eichele G, Evans R M, Thaller C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "1310260", "url": "https://glygen.org/publication/PubMed/1310260" } ] }, { "title": "The GW182 protein colocalizes with mRNA degradation associated proteins hDcp1 and hLSm4 in cytoplasmic GW bodies.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Eystathioy T, Jakymiw A, Chan EK, Seraphin B, Cougot N, Fritzler MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "13130130", "url": "https://glygen.org/publication/PubMed/13130130" } ] }, { "title": "Expression of the MAPK kinases MKK-4 and MKK-7 in rheumatoid arthritis and their role as key regulators of JNK.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Sundarrajan M, Boyle DL, Chabaud-Riou M, Hammaker D, Firestein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "13130464", "url": "https://glygen.org/publication/PubMed/13130464" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "HdmX stimulates Hdm2-mediated ubiquitination and degradation of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Linares LK, Hengstermann A, Ciechanover A, Muller S, Scheffner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14507994", "url": "https://glygen.org/publication/PubMed/14507994" } ] }, { "title": "Restoration of C/EBPalpha expression in a BCR-ABL+ cell line induces terminal granulocytic differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tavor S, Park DJ, Gery S, Vuong PT, Gombart AF, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "14517214", "url": "https://glygen.org/publication/PubMed/14517214" } ] }, { "title": "Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Martin-Serrano J, Yarovoy A, Perez-Caballero D, Bieniasz PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "14519844", "url": "https://glygen.org/publication/PubMed/14519844" } ] }, { "title": "EZH2 is downstream of the pRB-E2F pathway, essential for proliferation and amplified in cancer.", "journal": "The EMBO journal", "date": "2003", "authors": "Bracken AP, Pasini D, Capra M, Prosperini E, Colli E, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "14532106", "url": "https://glygen.org/publication/PubMed/14532106" } ] }, { "title": "mAM facilitates conversion by ESET of dimethyl to trimethyl lysine 9 of histone H3 to cause transcriptional repression.", "journal": "Molecular cell", "date": "2003", "authors": "Wang H, An W, Cao R, Xia L, Erdjument-Bromage H, Chatton B, Tempst P, Roeder RG, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "14536086", "url": "https://glygen.org/publication/PubMed/14536086" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "Loss of p53 has site-specific effects on histone H3 modification, including serine 10 phosphorylation important for maintenance of ploidy.", "journal": "Cancer research", "date": "2003", "authors": "Allison SJ, Milner J", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "14583461", "url": "https://glygen.org/publication/PubMed/14583461" } ] }, { "title": "Prevention of organ allograft rejection by a specific Janus kinase 3 inhibitor.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Changelian PS, Flanagan ME, Ball DJ, Kent CR, Magnuson KS, Martin WH, Rizzuti BJ, Sawyer PS, Perry BD, Brissette WH, McCurdy SP, Kudlacz EM, Conklyn MJ, Elliott EA, Koslov ER, Fisher MB, Strelevitz TJ, Yoon K, Whipple DA, Sun J, Munchhof MJ, Doty JL, Casavant JM, Blumenkopf TA, Hines M, Brown MF, Lillie BM, Subramanyam C, Shang-Poa C, Milici AJ, Beckius GE, Moyer JD, Su C, Woodworth TG, Gaweco AS, Beals CR, Littman BH, Fisher DA, Smith JF, Zagouras P, Magna HA, Saltarelli MJ, Johnson KS, Nelms LF, Des Etages SG, Hayes LS, Kawabata TT, Finco-Kent D, Baker DL, Larson M, Si MS, Paniagua R, Higgins J, Holm B, Reitz B, Zhou YJ, Morris RE, O'Shea JJ, Borie DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "14593182", "url": "https://glygen.org/publication/PubMed/14593182" } ] }, { "title": "Role of human ribosomal RNA (rRNA) promoter methylation and of methyl-CpG-binding protein MBD2 in the suppression of rRNA gene expression.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ghoshal K, Majumder S, Datta J, Motiwala T, Bai S, Sharma SM, Frankel W, Jacob ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "14610093", "url": "https://glygen.org/publication/PubMed/14610093" } ] }, { "title": "Chromatin remodeling and neuronal response: multiple signaling pathways induce specific histone H3 modifications and early gene expression in hippocampal neurons.", "journal": "Journal of cell science", "date": "2003", "authors": "Crosio C, Heitz E, Allis CD, Borrelli E, Sassone-Corsi P", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "14625384", "url": "https://glygen.org/publication/PubMed/14625384" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Identification of an autoregulatory feedback pathway involving interleukin-1alpha in induction of constitutive NF-kappaB activation in pancreatic cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Niu J, Li Z, Peng B, Chiao PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "14679213", "url": "https://glygen.org/publication/PubMed/14679213" } ] }, { "title": "Histone methyltransferases direct different degrees of methylation to define distinct chromatin domains.", "journal": "Molecular cell", "date": "2003", "authors": "Rice JC, Briggs SD, Ueberheide B, Barber CM, Shabanowitz J, Hunt DF, Shinkai Y, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "14690610", "url": "https://glygen.org/publication/PubMed/14690610" } ] }, { "title": "The physiologic basis of assembly and activation of the plasma kallikrein/kinin system.", "journal": "Thrombosis and haemostasis", "date": "2004", "authors": "Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "14691562", "url": "https://glygen.org/publication/PubMed/14691562" } ] }, { "title": "TIP49 regulates beta-catenin-mediated neoplastic transformation and T-cell factor target gene induction via effects on chromatin remodeling.", "journal": "Cancer research", "date": "2003", "authors": "Feng Y, Lee N, Fearon ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "14695187", "url": "https://glygen.org/publication/PubMed/14695187" } ] }, { "title": "Specific in vivo phosphorylation sites determine the assembly dynamics of vimentin intermediate filaments.", "journal": "Journal of cell science", "date": "2004", "authors": "Eriksson JE, He T, Trejo-Skalli AV, Harmala-Brasken AS, Hellman J, Chou YH, Goldman RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "14762106", "url": "https://glygen.org/publication/PubMed/14762106" } ] }, { "title": "Mechanism of RNA polymerase I transcription.", "journal": "Advances in protein chemistry", "date": "2004", "authors": "Comai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772" } ], "reference": [ { "type": "PubMed", "id": "14969726", "url": "https://glygen.org/publication/PubMed/14969726" } ] }, { "title": "p53 regulates thymic Notch1 activation.", "journal": "European journal of immunology", "date": "2004", "authors": "Laws AM, Osborne BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "14991602", "url": "https://glygen.org/publication/PubMed/14991602" } ] }, { "title": "Menin associates with a trithorax family histone methyltransferase complex and with the hoxc8 locus.", "journal": "Molecular cell", "date": "2004", "authors": "Hughes CM, Rozenblatt-Rosen O, Milne TA, Copeland TD, Levine SS, Lee JC, Hayes DN, Shanmugam KS, Bhattacharjee A, Biondi CA, Kay GF, Hayward NK, Hess JL, Meyerson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "14992727", "url": "https://glygen.org/publication/PubMed/14992727" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Naslavsky N, Boehm M, Backlund PS Jr, Caplan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15020713", "url": "https://glygen.org/publication/PubMed/15020713" } ] }, { "title": "Acetylation of beta-catenin by p300 regulates beta-catenin-Tcf4 interaction.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Levy L, Wei Y, Labalette C, Wu Y, Renard CA, Buendia MA, Neuveut C", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15060161", "url": "https://glygen.org/publication/PubMed/15060161" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "The non-structural 3 (NS3) protein of dengue virus type 2 interacts with human nuclear receptor binding protein and is associated with alterations in membrane structure.", "journal": "Virus research", "date": "2004", "authors": "Chua JJ, Ng MM, Chow VT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "15084397", "url": "https://glygen.org/publication/PubMed/15084397" } ] }, { "title": "Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6.", "journal": "Gene", "date": "2004", "authors": "Chavanas S, Mechin MC, Takahara H, Kawada A, Nachat R, Serre G, Simon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "15087120", "url": "https://glygen.org/publication/PubMed/15087120" } ] }, { "title": "Different EZH2-containing complexes target methylation of histone H1 or nucleosomal histone H3.", "journal": "Molecular cell", "date": "2004", "authors": "Kuzmichev A, Jenuwein T, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "15099518", "url": "https://glygen.org/publication/PubMed/15099518" } ] }, { "title": "DNMT3L stimulates the DNA methylation activity of Dnmt3a and Dnmt3b through a direct interaction.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Suetake I, Shinozaki F, Miyagawa J, Takeshima H, Tajima S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "15105426", "url": "https://glygen.org/publication/PubMed/15105426" } ] }, { "title": "Groucho oligomerization is required for repression in vivo.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Song H, Hasson P, Paroush Z, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15121853", "url": "https://glygen.org/publication/PubMed/15121853" } ] }, { "title": "A silencing pathway to induce H3-K9 and H4-K20 trimethylation at constitutive heterochromatin.", "journal": "Genes & development", "date": "2004", "authors": "Schotta G, Lachner M, Sarma K, Ebert A, Sengupta R, Reuter G, Reinberg D, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "15145825", "url": "https://glygen.org/publication/PubMed/15145825" } ] }, { "title": "Human meiotic recombinase Dmc1 promotes ATP-dependent homologous DNA strand exchange.", "journal": "Nature", "date": "2004", "authors": "Sehorn MG, Sigurdsson S, Bussen W, Unger VM, Sung P", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "15164066", "url": "https://glygen.org/publication/PubMed/15164066" } ] }, { "title": "SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells.", "journal": "Nature cell biology", "date": "2004", "authors": "Hamamoto R, Furukawa Y, Morita M, Iimura Y, Silva FP, Li M, Yagyu R, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "15235609", "url": "https://glygen.org/publication/PubMed/15235609" } ] }, { "title": "The novel Cdc42 guanine nucleotide exchange factor, zizimin1, dimerizes via the Cdc42-binding CZH2 domain.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Meller N, Irani-Tehrani M, Ratnikov BI, Paschal BM, Schwartz MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15247287", "url": "https://glygen.org/publication/PubMed/15247287" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Catalysis and function of the p38 alpha.MK2a signaling complex.", "journal": "Biochemistry", "date": "2004", "authors": "Lukas SM, Kroe RR, Wildeson J, Peet GW, Frego L, Davidson W, Ingraham RH, Pargellis CA, Labadia ME, Werneburg BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15287722", "url": "https://glygen.org/publication/PubMed/15287722" } ] }, { "title": "Identification and in vivo role of the Armadillo-Legless interaction.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Hoffmans R, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15294866", "url": "https://glygen.org/publication/PubMed/15294866" } ] }, { "title": "hMSH4-hMSH5 recognizes Holliday Junctions and forms a meiosis-specific sliding clamp that embraces homologous chromosomes.", "journal": "Molecular cell", "date": "2004", "authors": "Snowden T, Acharya S, Butz C, Berardini M, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "15304223", "url": "https://glygen.org/publication/PubMed/15304223" } ] }, { "title": "Gene expression signatures identify rhabdomyosarcoma subtypes and detect a novel t(2;2)(q35;p23) translocation fusing PAX3 to NCOA1.", "journal": "Cancer research", "date": "2004", "authors": "Wachtel M, Dettling M, Koscielniak E, Stegmaier S, Treuner J, Simon-Klingenstein K, Buhlmann P, Niggli FK, Schafer BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "15313887", "url": "https://glygen.org/publication/PubMed/15313887" } ] }, { "title": "Histone deimination antagonizes arginine methylation.", "journal": "Cell", "date": "2004", "authors": "Cuthbert GL, Daujat S, Snowden AW, Erdjument-Bromage H, Hagiwara T, Yamada M, Schneider R, Gregory PD, Tempst P, Bannister AJ, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "15339660", "url": "https://glygen.org/publication/PubMed/15339660" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Human PAD4 regulates histone arginine methylation levels via demethylimination.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Wang Y, Wysocka J, Sayegh J, Lee YH, Perlin JR, Leonelli L, Sonbuchner LS, McDonald CH, Cook RG, Dou Y, Roeder RG, Clarke S, Stallcup MR, Allis CD, Coonrod SA", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "15345777", "url": "https://glygen.org/publication/PubMed/15345777" } ] }, { "title": "Activation of PI3K is indispensable for interleukin 7-mediated viability, proliferation, glucose use, and growth of T cell acute lymphoblastic leukemia cells.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Barata JT, Silva A, Brandao JG, Nadler LM, Cardoso AA, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "15353558", "url": "https://glygen.org/publication/PubMed/15353558" } ] }, { "title": "MBD3L1 is a transcriptional repressor that interacts with methyl-CpG-binding protein 2 (MBD2) and components of the NuRD complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Jiang CL, Jin SG, Pfeifer GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "15456747", "url": "https://glygen.org/publication/PubMed/15456747" } ] }, { "title": "Human SirT1 interacts with histone H1 and promotes formation of facultative heterochromatin.", "journal": "Molecular cell", "date": "2004", "authors": "Vaquero A, Scher M, Lee D, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359" } ], "reference": [ { "type": "PubMed", "id": "15469825", "url": "https://glygen.org/publication/PubMed/15469825" } ] }, { "title": "Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ananthanarayanan M, Li S, Balasubramaniyan N, Suchy FJ, Walsh MJ", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "15471871", "url": "https://glygen.org/publication/PubMed/15471871" } ] }, { "title": "Activating mutations of NOTCH1 in human T cell acute lymphoblastic leukemia.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Weng AP, Ferrando AA, Lee W, Morris JP 4th, Silverman LB, Sanchez-Irizarry C, Blacklow SC, Look AT, Aster JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15472075", "url": "https://glygen.org/publication/PubMed/15472075" } ] }, { "title": "Human SWI/SNF-associated PRMT5 methylates histone H3 arginine 8 and negatively regulates expression of ST7 and NM23 tumor suppressor genes.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Pal S, Vishwanath SN, Erdjument-Bromage H, Tempst P, Sif S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "15485929", "url": "https://glygen.org/publication/PubMed/15485929" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "The Drosophila methyl-DNA binding protein MBD2/3 interacts with the NuRD complex via p55 and MI-2.", "journal": "BMC molecular biology", "date": "2004-10-29", "authors": "Marhold Joachim, Brehm Alexander, Kramer Katja", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "15516265", "url": "https://glygen.org/publication/PubMed/15516265" } ] }, { "title": "Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks.", "journal": "Nature", "date": "2004", "authors": "Huyen Y, Zgheib O, Ditullio RA Jr, Gorgoulis VG, Zacharatos P, Petty TJ, Sheston EA, Mellert HS, Stavridi ES, Halazonetis TD", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "15525939", "url": "https://glygen.org/publication/PubMed/15525939" } ] }, { "title": "Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Alpatov R, Munguba GC, Caton P, Joo JH, Shi Y, Shi Y, Hunt ME, Sugrue SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "15542832", "url": "https://glygen.org/publication/PubMed/15542832" } ] }, { "title": "Nuclear actin and myosin I are required for RNA polymerase I transcription.", "journal": "Nature cell biology", "date": "2004", "authors": "Philimonenko VV, Zhao J, Iben S, Dingova H, Kysela K, Kahle M, Zentgraf H, Hofmann WA, de Lanerolle P, Hozak P, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "15558034", "url": "https://glygen.org/publication/PubMed/15558034" } ] }, { "title": "MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Voncken JW, Niessen H, Neufeld B, Rennefahrt U, Dahlmans V, Kubben N, Holzer B, Ludwig S, Rapp UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15563468", "url": "https://glygen.org/publication/PubMed/15563468" } ] }, { "title": "Histone demethylation mediated by the nuclear amine oxidase homolog LSD1.", "journal": "Cell", "date": "2004", "authors": "Shi Y, Lan F, Matson C, Mulligan P, Whetstine JR, Cole PA, Casero RA, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "15620353", "url": "https://glygen.org/publication/PubMed/15620353" } ] }, { "title": "Comparison of enzymatic properties between hPADI2 and hPADI4.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Nakayama-Hamada M, Suzuki A, Kubota K, Takazawa T, Ohsaka M, Kawaida R, Ono M, Kasuya A, Furukawa H, Yamada R, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "15629448", "url": "https://glygen.org/publication/PubMed/15629448" } ] }, { "title": "Specific and potent RNAi in the nucleus of human cells.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Robb GB, Brown KM, Khurana J, Rana TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "15643423", "url": "https://glygen.org/publication/PubMed/15643423" } ] }, { "title": "Distinct activities of CHD1 and ACF in ATP-dependent chromatin assembly.", "journal": "Nature structural & molecular biology", "date": "2005-02", "authors": "Lusser Alexandra, Urwin Debra L, Kadonaga James T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "15643425", "url": "https://glygen.org/publication/PubMed/15643425" } ] }, { "title": "Chd1 chromodomain links histone H3 methylation with SAGA- and SLIK-dependent acetylation.", "journal": "Nature", "date": "2005-01-27", "authors": "Pray-Grant Marilyn G, Daniel Jeremy A, Schieltz David, Yates John R, Grant Patrick A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "15647753", "url": "https://glygen.org/publication/PubMed/15647753" } ] }, { "title": "The ubiquitin-protein ligase Itch regulates p73 stability.", "journal": "The EMBO journal", "date": "2005", "authors": "Rossi M, De Laurenzi V, Munarriz E, Green DR, Liu YC, Vousden KH, Cesareni G, Melino G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "15678106", "url": "https://glygen.org/publication/PubMed/15678106" } ] }, { "title": "The kinase haspin is required for mitotic histone H3 Thr 3 phosphorylation and normal metaphase chromosome alignment.", "journal": "Genes & development", "date": "2005", "authors": "Dai J, Sultan S, Taylor SS, Higgins JM", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "15681610", "url": "https://glygen.org/publication/PubMed/15681610" } ] }, { "title": "Molecular determinants of NOTCH4 transcription in vascular endothelium.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Wu J, Iwata F, Grass JA, Osborne CS, Elnitski L, Fraser P, Ohneda O, Yamamoto M, Bresnick EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "15684396", "url": "https://glygen.org/publication/PubMed/15684396" } ] }, { "title": "Phosphorylation of Ser28 in histone H3 mediated by mixed lineage kinase-like mitogen-activated protein triple kinase alpha.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Choi HS, Choi BY, Cho YY, Zhu F, Bode AM, Dong Z", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "15684425", "url": "https://glygen.org/publication/PubMed/15684425" } ] }, { "title": "MBD3L2 interacts with MBD3 and components of the NuRD complex and can oppose MBD2-MeCP1-mediated methylation silencing.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Jin SG, Jiang CL, Rauch T, Li H, Pfeifer GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "15701600", "url": "https://glygen.org/publication/PubMed/15701600" } ] }, { "title": "Zizimin2: a novel, DOCK180-related Cdc42 guanine nucleotide exchange factor expressed predominantly in lymphocytes.", "journal": "FEBS letters", "date": "2005", "authors": "Nishikimi A, Meller N, Uekawa N, Isobe K, Schwartz MA, Maruyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "15710388", "url": "https://glygen.org/publication/PubMed/15710388" } ] }, { "title": "Stat5 mediates the IL-7-induced accessibility of a representative D-Distal VH gene.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Stanton ML, Brodeur PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "15749844", "url": "https://glygen.org/publication/PubMed/15749844" } ] }, { "title": "Role of the RB1 family in stabilizing histone methylation at constitutive heterochromatin.", "journal": "Nature cell biology", "date": "2005", "authors": "Gonzalo S, Garcia-Cao M, Fraga MF, Schotta G, Peters AH, Cotter SE, Eguia R, Dean DC, Esteller M, Jenuwein T, Blasco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "15750587", "url": "https://glygen.org/publication/PubMed/15750587" } ] }, { "title": "Beta-catenin directly displaces Groucho/TLE repressors from Tcf/Lef in Wnt-mediated transcription activation.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Daniels DL, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15768032", "url": "https://glygen.org/publication/PubMed/15768032" } ] }, { "title": "Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.", "journal": "Genes & development", "date": "2005", "authors": "Tachibana M, Ueda J, Fukuda M, Takeda N, Ohta T, Iwanari H, Sakihama T, Kodama T, Hamakubo T, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "15774718", "url": "https://glygen.org/publication/PubMed/15774718" } ] }, { "title": "Transcriptional regulation of a metastasis suppressor gene by Tip60 and beta-catenin complexes.", "journal": "Nature", "date": "2005", "authors": "Kim JH, Kim B, Cai L, Choi HJ, Ohgi KA, Tran C, Chen C, Chung CH, Huber O, Rose DW, Sawyers CL, Rosenfeld MG, Baek SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "15829968", "url": "https://glygen.org/publication/PubMed/15829968" } ] }, { "title": "Physical and functional interactions between the human DNMT3L protein and members of the de novo methyltransferase family.", "journal": "Journal of cellular biochemistry", "date": "2005", "authors": "Chen ZX, Mann JR, Hsieh CL, Riggs AD, Chedin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "15861382", "url": "https://glygen.org/publication/PubMed/15861382" } ] }, { "title": "Conserved docking site is essential for activation of mammalian MAP kinase kinases by specific MAP kinase kinase kinases.", "journal": "Molecular cell", "date": "2005", "authors": "Takekawa M, Tatebayashi K, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "15866172", "url": "https://glygen.org/publication/PubMed/15866172" } ] }, { "title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2005", "authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "15867264", "url": "https://glygen.org/publication/PubMed/15867264" } ] }, { "title": "The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain.", "journal": "Biochemical and biophysical research communications", "date": "2005-06-17", "authors": "Lechner Mark S, Schultz David C, Negorev Dmitri, Maul Gerd G, Rauscher Frank J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "15882967", "url": "https://glygen.org/publication/PubMed/15882967" } ] }, { "title": "Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle.", "journal": "Nucleic Acids Res.", "date": "2005", "authors": "Tsunaka Yasuo, Kajimura Naoko, Tate Shin-ichi, Morikawa Kosuke", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "15951514", "url": "https://glygen.org/publication/PubMed/15951514" } ] }, { "title": "Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.", "journal": "Cell", "date": "2005", "authors": "Dou Y, Milne TA, Tackett AJ, Smith ER, Fukuda A, Wysocka J, Allis CD, Chait BT, Hess JL, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "15960975", "url": "https://glygen.org/publication/PubMed/15960975" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "SET8 recognizes the sequence RHRK20VLRDN within the N terminus of histone H4 and mono-methylates lysine 20.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Yin Y, Liu C, Tsai SN, Zhou B, Ngai SM, Zhu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "15964846", "url": "https://glygen.org/publication/PubMed/15964846" } ] }, { "title": "Protein identification using sequential ion/ion reactions and tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Coon JJ, Ueberheide B, Syka JE, Dryhurst DD, Ausio J, Shabanowitz J, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "15983376", "url": "https://glygen.org/publication/PubMed/15983376" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Phosphorylation of histone H3 at serine 10 is indispensable for neoplastic cell transformation.", "journal": "Cancer research", "date": "2005", "authors": "Choi HS, Choi BY, Cho YY, Mizuno H, Kang BS, Bode AM, Dong Z", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "15994958", "url": "https://glygen.org/publication/PubMed/15994958" } ] }, { "title": "Pygopus and legless provide essential transcriptional coactivator functions to armadillo/beta-catenin.", "journal": "Current biology : CB", "date": "2005", "authors": "Hoffmans R, Stadeli R, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16005293", "url": "https://glygen.org/publication/PubMed/16005293" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "Mammalian CARMIL inhibits actin filament capping by capping protein.", "journal": "Developmental cell", "date": "2005", "authors": "Yang C, Pring M, Wear MA, Huang M, Cooper JA, Svitkina TM, Zigmond SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "16054028", "url": "https://glygen.org/publication/PubMed/16054028" } ] }, { "title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.", "journal": "Human molecular genetics", "date": "2005", "authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16079151", "url": "https://glygen.org/publication/PubMed/16079151" } ] }, { "title": "LSD1 demethylates repressive histone marks to promote androgen-receptor-dependent transcription.", "journal": "Nature", "date": "2005", "authors": "Metzger E, Wissmann M, Yin N, Muller JM, Schneider R, Peters AH, Gunther T, Buettner R, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" } ], "reference": [ { "type": "PubMed", "id": "16079795", "url": "https://glygen.org/publication/PubMed/16079795" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "Characterization and functional analysis of CReMM, a novel chromodomain helicase DNA-binding protein.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Shur I, Benayahu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "16095617", "url": "https://glygen.org/publication/PubMed/16095617" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Identification and characterization of a novel human histone H3 lysine 36-specific methyltransferase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Sun XJ, Wei J, Wu XY, Hu M, Wang L, Wang HH, Zhang QH, Chen SJ, Huang QH, Chen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16118227", "url": "https://glygen.org/publication/PubMed/16118227" } ] }, { "title": "Temporal progression of recombination in human males.", "journal": "Molecular human reproduction", "date": "2005", "authors": "Oliver-Bonet M, Turek PJ, Sun F, Ko E, Martin RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "16123081", "url": "https://glygen.org/publication/PubMed/16123081" } ] }, { "title": "Deletion of gpUL132, a structural component of human cytomegalovirus, results in impaired virus replication in fibroblasts.", "journal": "Journal of virology", "date": "2005", "authors": "Spaderna S, Kropff B, Kodel Y, Shen S, Coley S, Lu S, Britt W, Mach M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "16140760", "url": "https://glygen.org/publication/PubMed/16140760" } ] }, { "title": "Dissecting nuclear Wingless signalling: recruitment of the transcriptional co-activator Pygopus by a chain of adaptor proteins.", "journal": "Mechanisms of development", "date": "2005", "authors": "Stadeli R, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16169192", "url": "https://glygen.org/publication/PubMed/16169192" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "Modifications of human histone H3 variants during mitosis.", "journal": "Biochemistry", "date": "2005", "authors": "Garcia BA, Barber CM, Hake SB, Ptak C, Turner FB, Busby SA, Shabanowitz J, Moran RG, Allis CD, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" } ] }, { "title": "Microspherule protein 1, Mi-2beta, and RET finger protein associate in the nucleolus and up-regulate ribosomal gene transcription.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shimono K, Shimono Y, Shimokata K, Ishiguro N, Takahashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "16186106", "url": "https://glygen.org/publication/PubMed/16186106" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "MLL associates specifically with a subset of transcriptionally active target genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Milne TA, Dou Y, Martin ME, Brock HW, Roeder RG, Hess JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16199523", "url": "https://glygen.org/publication/PubMed/16199523" } ] }, { "title": "Molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3.", "journal": "Mol. Cell", "date": "2005", "authors": "Macdonald Neil, Welburn Julie P I, Noble Martin E M, Nguyen Anhco, Yaffe Michael B, Clynes David, Moggs Jonathan G, Orphanides George, Thomson Stuart, Edmunds John W, Clayton Alison L, Endicott Jane A, Mahadevan Louis C", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "16246723", "url": "https://glygen.org/publication/PubMed/16246723" } ] }, { "title": "Human but not yeast CHD1 binds directly and selectively to histone H3 methylated at lysine 4 via its tandem chromodomains.", "journal": "The Journal of biological chemistry", "date": "2005-12-23", "authors": "Sims Robert J, Chen Chi-Fu, Santos-Rosa Helena, Kouzarides Tony, Patel Smita S, Reinberg Danny", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "16263726", "url": "https://glygen.org/publication/PubMed/16263726" } ] }, { "title": "Expression patterns and post-translational modifications associated with mammalian histone H3 variants.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hake SB, Garcia BA, Duncan EM, Kauer M, Dellaire G, Shabanowitz J, Bazett-Jones DP, Allis CD, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "16267050", "url": "https://glygen.org/publication/PubMed/16267050" } ] }, { "title": "A histone H3 methyltransferase controls epigenetic events required for meiotic prophase.", "journal": "Nature", "date": "2005", "authors": "Hayashi K, Yoshida K, Matsui Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "16292313", "url": "https://glygen.org/publication/PubMed/16292313" } ] }, { "title": "Inducible processing of interferon regulatory factor-2.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Palombella VJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "1630448", "url": "https://glygen.org/publication/PubMed/1630448" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "Expression of the MutL homologue hMLH3 in human cells and its role in DNA mismatch repair.", "journal": "Cancer research", "date": "2005", "authors": "Cannavo E, Marra G, Sabates-Bellver J, Menigatti M, Lipkin SM, Fischer F, Cejka P, Jiricny J", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "16322221", "url": "https://glygen.org/publication/PubMed/16322221" } ] }, { "title": "Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells.", "journal": "Molecular cell", "date": "2005", "authors": "Nicke B, Bastien J, Khanna SJ, Warne PH, Cowling V, Cook SJ, Peters G, Delpuech O, Schulze A, Berns K, Mullenders J, Beijersbergen RL, Bernards R, Ganesan TS, Downward J, Hancock DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16337592", "url": "https://glygen.org/publication/PubMed/16337592" } ] }, { "title": "The Polycomb group protein EZH2 directly controls DNA methylation.", "journal": "Nature", "date": "2006", "authors": "Vire E, Brenner C, Deplus R, Blanchon L, Fraga M, Didelot C, Morey L, Van Eynde A, Bernard D, Vanderwinden JM, Bollen M, Esteller M, Di Croce L, de Launoit Y, Fuks F", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "16357870", "url": "https://glygen.org/publication/PubMed/16357870" } ] }, { "title": "Histone demethylation by a family of JmjC domain-containing proteins.", "journal": "Nature", "date": "2006", "authors": "Tsukada Y, Fang J, Erdjument-Bromage H, Warren ME, Borchers CH, Tempst P, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "16362057", "url": "https://glygen.org/publication/PubMed/16362057" } ] }, { "title": "Double chromodomains cooperate to recognize the methylated histone H3 tail.", "journal": "Nature", "date": "2005", "authors": "Flanagan John F, Mi Li-Zhi, Chruszcz Maksymilian, Cymborowski Marcin, Clines Katrina L, Kim Youngchang, Minor Wladek, Rastinejad Fraydoon, Khorasanizadeh Sepideh", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "16372014", "url": "https://glygen.org/publication/PubMed/16372014" } ] }, { "title": "The antisense strand of small interfering RNAs directs histone methylation and transcriptional gene silencing in human cells.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Weinberg MS, Villeneuve LM, Ehsani A, Amarzguioui M, Aagaard L, Chen ZX, Riggs AD, Rossi JJ, Morris KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16373483", "url": "https://glygen.org/publication/PubMed/16373483" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.", "journal": "Molecular cell", "date": "2006", "authors": "Doyon Y, Cayrou C, Ullah M, Landry AJ, Cote V, Selleck W, Lane WS, Tan S, Yang XJ, Cote J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "16387653", "url": "https://glygen.org/publication/PubMed/16387653" } ] }, { "title": "Phosphorylation of histones by tissue transglutaminase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Mishra S, Saleh A, Espino PS, Davie JR, Murphy LJ", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "16407273", "url": "https://glygen.org/publication/PubMed/16407273" } ] }, { "title": "p66alpha and p66beta of the Mi-2/NuRD complex mediate MBD2 and histone interaction.", "journal": "Nucleic acids research", "date": "2006", "authors": "Brackertz M, Gong Z, Leers J, Renkawitz R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "16415179", "url": "https://glygen.org/publication/PubMed/16415179" } ] }, { "title": "MBD2/NuRD and MBD3/NuRD, two distinct complexes with different biochemical and functional properties.", "journal": "Molecular and cellular biology", "date": "2006-02", "authors": "Le Guezennec Xavier, Vermeulen Michiel, Brinkman Arie B, Hoeijmakers Wieteke A M, Cohen Adrian, Lasonder Edwin, Stunnenberg Hendrik G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "16428440", "url": "https://glygen.org/publication/PubMed/16428440" } ] }, { "title": "Substrate preferences of the EZH2 histone methyltransferase complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Martin C, Cao R, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "16431907", "url": "https://glygen.org/publication/PubMed/16431907" } ] }, { "title": "DNA damage signaling and p53-dependent senescence after prolonged beta-interferon stimulation.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Moiseeva O, Mallette FA, Mukhopadhyay UK, Moores A, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16436515", "url": "https://glygen.org/publication/PubMed/16436515" } ] }, { "title": "Mass spectrometric characterization of human histone H3: a bird's eye view.", "journal": "Journal of proteome research", "date": "2006", "authors": "Thomas CE, Kelleher NL, Mizzen CA", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" } ] }, { "title": "Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Miao F, Li S, Chavez V, Lanting L, Natarajan R", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "16497732", "url": "https://glygen.org/publication/PubMed/16497732" } ] }, { "title": "The APC tumor suppressor counteracts beta-catenin activation and H3K4 methylation at Wnt target genes.", "journal": "Genes & development", "date": "2006", "authors": "Sierra J, Yoshida T, Joazeiro CA, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16510874", "url": "https://glygen.org/publication/PubMed/16510874" } ] }, { "title": "The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.", "journal": "EMBO reports", "date": "2006", "authors": "Percipalle P, Fomproix N, Cavellan E, Voit R, Reimer G, Kruger T, Thyberg J, Scheer U, Grummt I, Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "16514417", "url": "https://glygen.org/publication/PubMed/16514417" } ] }, { "title": "Catalytic properties and kinetic mechanism of human recombinant Lys-9 histone H3 methyltransferase SUV39H1: participation of the chromodomain in enzymatic catalysis.", "journal": "Biochemistry", "date": "2006", "authors": "Chin HG, Patnaik D, Esteve PO, Jacobsen SE, Pradhan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16519522", "url": "https://glygen.org/publication/PubMed/16519522" } ] }, { "title": "MicroRNA fingerprints during human megakaryocytopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16549775", "url": "https://glygen.org/publication/PubMed/16549775" } ] }, { "title": "A structural role for ATP in the formation and stability of the human origin recognition complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Ranjan A, Gossen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "16549788", "url": "https://glygen.org/publication/PubMed/16549788" } ] }, { "title": "NXP-2 association with SUMO-2 depends on lysines required for transcriptional repression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Rosendorff A, Sakakibara S, Lu S, Kieff E, Xuan Y, DiBacco A, Shi Y, Shi Y, Gill G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "16567619", "url": "https://glygen.org/publication/PubMed/16567619" } ] }, { "title": "Structural basis for histone N-terminal recognition by human peptidylarginine deiminase 4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Arita K, Shimizu T, Hashimoto H, Hidaka Y, Yamada M, Sato M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "16567635", "url": "https://glygen.org/publication/PubMed/16567635" } ] }, { "title": "JHDM2A, a JmjC-containing H3K9 demethylase, facilitates transcription activation by androgen receptor.", "journal": "Cell", "date": "2006", "authors": "Yamane K, Toumazou C, Tsukada Y, Erdjument-Bromage H, Tempst P, Wong J, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "16603237", "url": "https://glygen.org/publication/PubMed/16603237" } ] }, { "title": "Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.", "journal": "Cell", "date": "2006", "authors": "Whetstine JR, Nottke A, Lan F, Huarte M, Smolikov S, Chen Z, Spooner E, Li E, Zhang G, Colaiacovo M, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "16603238", "url": "https://glygen.org/publication/PubMed/16603238" } ] }, { "title": "The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cavellan E, Asp P, Percipalle P, Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "16603771", "url": "https://glygen.org/publication/PubMed/16603771" } ] }, { "title": "Notch 1 activation in the molecular pathogenesis of T-cell acute lymphoblastic leukaemia.", "journal": "Nature reviews. Cancer", "date": "2006", "authors": "Grabher C, von Boehmer H, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "16612405", "url": "https://glygen.org/publication/PubMed/16612405" } ] }, { "title": "The MAP kinase ERK5 binds to and phosphorylates p90 RSK.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Ranganathan A, Pearson GW, Chrestensen CA, Sturgill TW, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "16626623", "url": "https://glygen.org/publication/PubMed/16626623" } ] }, { "title": "Quantitative proteomic analysis of post-translational modifications of human histones.", "journal": "Molecular & cellular proteomics : MCP", "date": "2006", "authors": "Beck HC, Nielsen EC, Matthiesen R, Jensen LH, Sehested M, Finn P, Grauslund M, Hansen AM, Jensen ON", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "16627869", "url": "https://glygen.org/publication/PubMed/16627869" } ] }, { "title": "Physical association of the patient-specific GATA1 mutants with RUNX1 in acute megakaryoblastic leukemia accompanying Down syndrome.", "journal": "Leukemia", "date": "2006", "authors": "Xu G, Kanezaki R, Toki T, Watanabe S, Takahashi Y, Terui K, Kitabayashi I, Ito E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "16628190", "url": "https://glygen.org/publication/PubMed/16628190" } ] }, { "title": "Parafibromin/Hyrax activates Wnt/Wg target gene transcription by direct association with beta-catenin/Armadillo.", "journal": "Cell", "date": "2006", "authors": "Mosimann C, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16630820", "url": "https://glygen.org/publication/PubMed/16630820" } ] }, { "title": "Chromatin modification of the trefoil factor 1 gene in human breast cancer cells by the Ras/mitogen-activated protein kinase pathway.", "journal": "Cancer research", "date": "2006", "authors": "Espino PS, Li L, He S, Yu J, Davie JR", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "16651411", "url": "https://glygen.org/publication/PubMed/16651411" } ] }, { "title": "Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.", "journal": "Molecular cell", "date": "2006", "authors": "Wang H, Zhai L, Xu J, Joo HY, Jackson S, Erdjument-Bromage H, Tempst P, Xiong Y, Zhang Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "16678110", "url": "https://glygen.org/publication/PubMed/16678110" } ] }, { "title": "Characterization of a novel WHSC1-associated SET domain protein with H3K4 and H3K27 methyltransferase activity.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Kim SM, Kee HJ, Eom GH, Choe NW, Kim JY, Kim YS, Kim SK, Kook H, Kook H, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16682010", "url": "https://glygen.org/publication/PubMed/16682010" } ] }, { "title": "A conserved 12-amino acid motif in Sall1 recruits the nucleosome remodeling and deacetylase corepressor complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lauberth SM, Rauchman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "16707490", "url": "https://glygen.org/publication/PubMed/16707490" } ] }, { "title": "The transcriptional repressor JHDM3A demethylates trimethyl histone H3 lysine 9 and lysine 36.", "journal": "Nature", "date": "2006", "authors": "Klose RJ, Yamane K, Bae Y, Zhang D, Erdjument-Bromage H, Tempst P, Wong J, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "16732292", "url": "https://glygen.org/publication/PubMed/16732292" } ] }, { "title": "The putative oncogene GASC1 demethylates tri- and dimethylated lysine 9 on histone H3.", "journal": "Nature", "date": "2006", "authors": "Cloos PA, Christensen J, Agger K, Maiolica A, Rappsilber J, Antal T, Hansen KH, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "16732293", "url": "https://glygen.org/publication/PubMed/16732293" } ] }, { "title": "Jmjd2b antagonizes H3K9 trimethylation at pericentric heterochromatin in mammalian cells.", "journal": "Genes & development", "date": "2006", "authors": "Fodor BD, Kubicek S, Yonezawa M, O'Sullivan RJ, Sengupta R, Perez-Burgos L, Opravil S, Mechtler K, Schotta G, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "16738407", "url": "https://glygen.org/publication/PubMed/16738407" } ] }, { "title": "C/EBPbeta is required for 'emergency' granulopoiesis.", "journal": "Nature immunology", "date": "2006", "authors": "Hirai H, Zhang P, Dayaram T, Hetherington CJ, Mizuno S, Imanishi J, Akashi K, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "16751774", "url": "https://glygen.org/publication/PubMed/16751774" } ] }, { "title": "Chromatin modifications by methylation and ubiquitination: implications in the regulation of gene expression.", "journal": "Annual review of biochemistry", "date": "2006", "authors": "Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "16756492", "url": "https://glygen.org/publication/PubMed/16756492" } ] }, { "title": "Genetic analysis of human Orc2 reveals specific domains that are required in vivo for assembly and nuclear localization of the origin recognition complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Radichev I, Kwon SW, Zhao Y, DePamphilis ML, Vassilev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "16762929", "url": "https://glygen.org/publication/PubMed/16762929" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "Identification and characterization of Smyd2: a split SET/MYND domain-containing histone H3 lysine 36-specific methyltransferase that interacts with the Sin3 histone deacetylase complex.", "journal": "Molecular cancer", "date": "2006", "authors": "Brown MA, Sims RJ 3rd, Gottlieb PD, Tucker PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "16805913", "url": "https://glygen.org/publication/PubMed/16805913" } ] }, { "title": "Coupling mitochondrial respiratory chain to cell death: an essential role of mitochondrial complex I in the interferon-beta and retinoic acid-induced cancer cell death.", "journal": "Cell death and differentiation", "date": "2007", "authors": "Huang G, Chen Y, Lu H, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "16826196", "url": "https://glygen.org/publication/PubMed/16826196" } ] }, { "title": "Reconstitution and mechanism of the stimulation of de novo methylation by human DNMT3L.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kareta MS, Botello ZM, Ennis JJ, Chou C, Chedin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "16829525", "url": "https://glygen.org/publication/PubMed/16829525" } ] }, { "title": "Regulation of MLL1 H3K4 methyltransferase activity by its core components.", "journal": "Nature structural & molecular biology", "date": "2006-08", "authors": "Dou Yali, Milne Thomas A, Ruthenburg Alexander J, Lee Seunghee, Lee Jae Woon, Verdine Gregory L, Allis C David, Roeder Robert G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "16878130", "url": "https://glygen.org/publication/PubMed/16878130" } ] }, { "title": "Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kim DH, Villeneuve LM, Morris KV, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16936726", "url": "https://glygen.org/publication/PubMed/16936726" } ] }, { "title": "CTCF-dependent chromatin insulator is linked to epigenetic remodeling.", "journal": "Molecular cell", "date": "2006", "authors": "Ishihara K, Oshimura M, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "16949368", "url": "https://glygen.org/publication/PubMed/16949368" } ] }, { "title": "The KAP1 corepressor functions to coordinate the assembly of de novo HP1-demarcated microenvironments of heterochromatin required for KRAB zinc finger protein-mediated transcriptional repression.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Sripathy SP, Stevens J, Schultz DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "16954381", "url": "https://glygen.org/publication/PubMed/16954381" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "PDZ-binding kinase/T-LAK cell-originated protein kinase, a putative cancer/testis antigen with an oncogenic activity in breast cancer.", "journal": "Cancer research", "date": "2006", "authors": "Park JH, Lin ML, Nishidate T, Nakamura Y, Katagiri T", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "16982762", "url": "https://glygen.org/publication/PubMed/16982762" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Coactivator as a target gene specificity determinant for histone H3 lysine 4 methyltransferases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Lee S, Lee DK, Dou Y, Lee J, Lee B, Kwak E, Kong YY, Lee SK, Roeder RG, Lee JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17021013", "url": "https://glygen.org/publication/PubMed/17021013" } ] }, { "title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.", "journal": "Experimental cell research", "date": "2006", "authors": "Hiramoto K, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17027967", "url": "https://glygen.org/publication/PubMed/17027967" } ] }, { "title": "CHD6 is a DNA-dependent ATPase and localizes at nuclear sites of mRNA synthesis.", "journal": "FEBS letters", "date": "2006", "authors": "Lutz T, Stoger R, Nieto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "17027977", "url": "https://glygen.org/publication/PubMed/17027977" } ] }, { "title": "Crystal structure of a beta-catenin/BCL9/Tcf4 complex.", "journal": "Molecular cell", "date": "2006", "authors": "Sampietro J, Dahlberg CL, Cho US, Hinds TR, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17052462", "url": "https://glygen.org/publication/PubMed/17052462" } ] }, { "title": "LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.", "journal": "Nature medicine", "date": "2006", "authors": "Skokowa J, Cario G, Uenalan M, Schambach A, Germeshausen M, Battmer K, Zeidler C, Lehmann U, Eder M, Baum C, Grosschedl R, Stanulla M, Scherr M, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17063141", "url": "https://glygen.org/publication/PubMed/17063141" } ] }, { "title": "Small dsRNAs induce transcriptional activation in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Li LC, Okino ST, Zhao H, Pookot D, Place RF, Urakami S, Enokida H, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "17085592", "url": "https://glygen.org/publication/PubMed/17085592" } ] }, { "title": "Biochemical characterization of the zinc-finger protein 217 transcriptional repressor complex: identification of a ZNF217 consensus recognition sequence.", "journal": "Oncogene", "date": "2007", "authors": "Cowger JJ, Zhao Q, Isovic M, Torchia J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "17130829", "url": "https://glygen.org/publication/PubMed/17130829" } ] }, { "title": "Function and biological roles of the Dickkopf family of Wnt modulators.", "journal": "Oncogene", "date": "2006", "authors": "Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "17143291", "url": "https://glygen.org/publication/PubMed/17143291" } ] }, { "title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17185360", "url": "https://glygen.org/publication/PubMed/17185360" } ] }, { "title": "Identification of histone H3 lysine 36 acetylation as a highly conserved histone modification.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Morris SA, Rao B, Garcia BA, Hake SB, Diaz RL, Shabanowitz J, Hunt DF, Allis CD, Lieb JD, Strahl BD", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "17189264", "url": "https://glygen.org/publication/PubMed/17189264" } ] }, { "title": "Organismal differences in post-translational modifications in histones H3 and H4.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Garcia BA, Hake SB, Diaz RL, Kauer M, Morris SA, Recht J, Shabanowitz J, Mishra N, Strahl BD, Allis CD, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "17194708", "url": "https://glygen.org/publication/PubMed/17194708" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "pRB family proteins are required for H3K27 trimethylation and Polycomb repression complexes binding to and silencing p16INK4alpha tumor suppressor gene.", "journal": "Genes & development", "date": "2007", "authors": "Kotake Y, Cao R, Viatour P, Sage J, Zhang Y, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17210787", "url": "https://glygen.org/publication/PubMed/17210787" } ] }, { "title": "Dimethyl sulfoxide to vorinostat: development of this histone deacetylase inhibitor as an anticancer drug.", "journal": "Nature biotechnology", "date": "2007", "authors": "Marks PA, Breslow R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "17211407", "url": "https://glygen.org/publication/PubMed/17211407" } ] }, { "title": "Histone arginine methylation regulates pluripotency in the early mouse embryo.", "journal": "Nature", "date": "2007", "authors": "Torres-Padilla ME, Parfitt DE, Kouzarides T, Zernicka-Goetz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17215844", "url": "https://glygen.org/publication/PubMed/17215844" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "Crystal structure of the p38 alpha-MAPKAP kinase 2 heterodimer.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "ter Haar E, Prabhakar P, Liu X, Lepre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17255097", "url": "https://glygen.org/publication/PubMed/17255097" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "Methylation of arginine residues interferes with citrullination by peptidylarginine deiminases in vitro.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Raijmakers R, Zendman AJ, Egberts WV, Vossenaar ER, Raats J, Soede-Huijbregts C, Rutjes FP, van Veelen PA, Drijfhout JW, Pruijn GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3247509", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509" } ], "reference": [ { "type": "PubMed", "id": "17303166", "url": "https://glygen.org/publication/PubMed/17303166" } ] }, { "title": "Demethylation of trimethylated histone H3 Lys4 in vivo by JARID1 JmjC proteins.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Seward DJ, Cubberley G, Kim S, Schonewald M, Zhang L, Tripet B, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "17310255", "url": "https://glygen.org/publication/PubMed/17310255" } ] }, { "title": "The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases.", "journal": "Cell", "date": "2007", "authors": "Iwase S, Lan F, Bayliss P, de la Torre-Ubieta L, Huarte M, Qi HH, Whetstine JR, Bonni A, Roberts TM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320160", "url": "https://glygen.org/publication/PubMed/17320160" } ] }, { "title": "RBP2 belongs to a family of demethylases, specific for tri-and dimethylated lysine 4 on histone 3.", "journal": "Cell", "date": "2007-03-23", "authors": "Christensen Jesper, Agger Karl, Cloos Paul A C, Pasini Diego, Rose Simon, Sennels Lau, Rappsilber Juri, Hansen Klaus H, Salcini Anna Elisabetta, Helin Kristian", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320161", "url": "https://glygen.org/publication/PubMed/17320161" } ] }, { "title": "The retinoblastoma binding protein RBP2 is an H3K4 demethylase.", "journal": "Cell", "date": "2007", "authors": "Klose RJ, Yan Q, Tothova Z, Yamane K, Erdjument-Bromage H, Tempst P, Gilliland DG, Zhang Y, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "17320163", "url": "https://glygen.org/publication/PubMed/17320163" } ] }, { "title": "Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.", "journal": "The EMBO journal", "date": "2007", "authors": "Dietrich N, Bracken AP, Trinh E, Schjerling CK, Koseki H, Rappsilber J, Helin K, Hansen KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17332741", "url": "https://glygen.org/publication/PubMed/17332741" } ] }, { "title": "The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.", "journal": "Genes & development", "date": "2007", "authors": "Bracken AP, Kleine-Kohlbrecher D, Dietrich N, Pasini D, Gargiulo G, Beekman C, Theilgaard-Monch K, Minucci S, Porse BT, Marine JC, Hansen KH, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17344414", "url": "https://glygen.org/publication/PubMed/17344414" } ] }, { "title": "Notch1 is a p53 target gene involved in human keratinocyte tumor suppression through negative regulation of ROCK1/2 and MRCKalpha kinases.", "journal": "Genes & development", "date": "2007", "authors": "Lefort K, Mandinova A, Ostano P, Kolev V, Calpini V, Kolfschoten I, Devgan V, Lieb J, Raffoul W, Hohl D, Neel V, Garlick J, Chiorino G, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17344417", "url": "https://glygen.org/publication/PubMed/17344417" } ] }, { "title": "The Chd family of chromatin remodelers.", "journal": "Mutation research", "date": "2007", "authors": "Marfella CG, Imbalzano AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "17350655", "url": "https://glygen.org/publication/PubMed/17350655" } ] }, { "title": "The trithorax-group protein Lid is a histone H3 trimethyl-Lys4 demethylase.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Lee N, Zhang J, Klose RJ, Erdjument-Bromage H, Tempst P, Jones RS, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "17351631", "url": "https://glygen.org/publication/PubMed/17351631" } ] }, { "title": "Epigenetic disruption of ribosomal RNA genes and nucleolar architecture in DNA methyltransferase 1 (Dnmt1) deficient cells.", "journal": "Nucleic acids research", "date": "2007", "authors": "Espada J, Ballestar E, Santoro R, Fraga MF, Villar-Garea A, Nemeth A, Lopez-Serra L, Ropero S, Aranda A, Orozco H, Moreno V, Juarranz A, Stockert JC, Langst G, Grummt I, Bickmore W, Esteller M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "17355984", "url": "https://glygen.org/publication/PubMed/17355984" } ] }, { "title": "PLU-1 is an H3K4 demethylase involved in transcriptional repression and breast cancer cell proliferation.", "journal": "Molecular cell", "date": "2007", "authors": "Yamane K, Tateishi K, Klose RJ, Fang J, Fabrizio LA, Erdjument-Bromage H, Taylor-Papadimitriou J, Tempst P, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17363312", "url": "https://glygen.org/publication/PubMed/17363312" } ] }, { "title": "Molecular basis of MAPK-activated protein kinase 2:p38 assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "White A, Pargellis CA, Studts JM, Werneburg BG, Farmer BT 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17395714", "url": "https://glygen.org/publication/PubMed/17395714" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "Pygo1 and Pygo2 roles in Wnt signaling in mammalian kidney development.", "journal": "BMC biology", "date": "2007", "authors": "Schwab KR, Patterson LT, Hartman HA, Song N, Lang RA, Lin X, Potter SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17425782", "url": "https://glygen.org/publication/PubMed/17425782" } ] }, { "title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17428788", "url": "https://glygen.org/publication/PubMed/17428788" } ] }, { "title": "pygopus 2 has a crucial, Wnt pathway-independent function in lens induction.", "journal": "Development (Cambridge, England)", "date": "2007", "authors": "Song N, Schwab KR, Patterson LT, Yamaguchi T, Lin X, Potter SS, Lang RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17428831", "url": "https://glygen.org/publication/PubMed/17428831" } ] }, { "title": "Molecular implications of evolutionary differences in CHD double chromodomains.", "journal": "Journal of molecular biology", "date": "2007-06-01", "authors": "Flanagan John F, Blus Bartlomiej J, Kim Daesung, Clines Katrina L, Rastinejad Fraydoon, Khorasanizadeh Sepideh", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "17433364", "url": "https://glygen.org/publication/PubMed/17433364" } ] }, { "title": "Developmental phenotypes and reduced Wnt signaling in mice deficient for pygopus 2.", "journal": "Genesis (New York, N.Y. : 2000)", "date": "2007", "authors": "Li B, Rheaume C, Teng A, Bilanchone V, Munguia JE, Hu M, Jessen S, Piccolo S, Waterman ML, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "17458864", "url": "https://glygen.org/publication/PubMed/17458864" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Cho YW, Hong T, Hong S, Guo H, Yu H, Kim D, Guszczynski T, Dressler GR, Copeland TD, Kalkum M, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17500065", "url": "https://glygen.org/publication/PubMed/17500065" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "Transcriptional activation of miR-34a contributes to p53-mediated apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Raver-Shapira N, Marciano E, Meiri E, Spector Y, Rosenfeld N, Moskovits N, Bentwich Z, Oren M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540598", "url": "https://glygen.org/publication/PubMed/17540598" } ] }, { "title": "Transactivation of miR-34a by p53 broadly influences gene expression and promotes apoptosis.", "journal": "Molecular cell", "date": "2007", "authors": "Chang TC, Wentzel EA, Kent OA, Ramachandran K, Mullendore M, Lee KH, Feldmann G, Yamakuchi M, Ferlito M, Lowenstein CJ, Arking DE, Beer MA, Maitra A, Mendell JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17540599", "url": "https://glygen.org/publication/PubMed/17540599" } ] }, { "title": "Interactions between human BRCA2 protein and the meiosis-specific recombinase DMC1.", "journal": "The EMBO journal", "date": "2007", "authors": "Thorslund T, Esashi F, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17541404", "url": "https://glygen.org/publication/PubMed/17541404" } ] }, { "title": "Trithorax-group protein ASH1 methylates histone H3 lysine 36.", "journal": "Gene", "date": "2007", "authors": "Tanaka Y, Katagiri Z, Kawahashi K, Kioussis D, Kitajima S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17544230", "url": "https://glygen.org/publication/PubMed/17544230" } ] }, { "title": "A microRNA component of the p53 tumour suppressor network.", "journal": "Nature", "date": "2007", "authors": "He L, He X, Lim LP, de Stanchina E, Xuan Z, Liang Y, Xue W, Zender L, Magnus J, Ridzon D, Jackson AL, Linsley PS, Chen C, Lowe SW, Cleary MA, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17554337", "url": "https://glygen.org/publication/PubMed/17554337" } ] }, { "title": "PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Yoshida H, Ichikawa H, Tagata Y, Katsumoto T, Ohnishi K, Akao Y, Naoe T, Pandolfi PP, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17562868", "url": "https://glygen.org/publication/PubMed/17562868" } ] }, { "title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.", "journal": "The EMBO journal", "date": "1991", "authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1756725", "url": "https://glygen.org/publication/PubMed/1756725" } ] }, { "title": "Solution structure of the BRK domains from CHD7.", "journal": "Journal of molecular biology", "date": "2007-08-31", "authors": "Allen Mark D, Religa Tomasz L, Freund Stefan M V, Bycroft Mark", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "17603073", "url": "https://glygen.org/publication/PubMed/17603073" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "PIM1-dependent phosphorylation of histone H3 at serine 10 is required for MYC-dependent transcriptional activation and oncogenic transformation.", "journal": "Nature cell biology", "date": "2007", "authors": "Zippo A, De Robertis A, Serafini R, Oliviero S", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "17643117", "url": "https://glygen.org/publication/PubMed/17643117" } ] }, { "title": "Combinatorial effects of splice variants modulate function of Aiolos.", "journal": "Journal of cell science", "date": "2007", "authors": "Caballero R, Setien F, Lopez-Serra L, Boix-Chornet M, Fraga MF, Ropero S, Megias D, Alaminos M, Sanchez-Tapia EM, Montoya MC, Esteller M, Gonzalez-Sarmiento R, Ballestar E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "17646674", "url": "https://glygen.org/publication/PubMed/17646674" } ] }, { "title": "DNA methylation regulates MicroRNA expression.", "journal": "Cancer biology & therapy", "date": "2007", "authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17660710", "url": "https://glygen.org/publication/PubMed/17660710" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "UHRF1 plays a role in maintaining DNA methylation in mammalian cells.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Bostick M, Kim JK, Esteve PO, Clark A, Pradhan S, Jacobsen SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "17673620", "url": "https://glygen.org/publication/PubMed/17673620" } ] }, { "title": "Interactions and subcellular distribution of DNA replication initiation proteins in eukaryotic cells.", "journal": "Molecular genetics and genomics : MGG", "date": "2007", "authors": "Brand N, Faul T, Grummt F", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "17680271", "url": "https://glygen.org/publication/PubMed/17680271" } ] }, { "title": "Monitoring Notch1 activity in development: evidence for a feedback regulatory loop.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2007", "authors": "Del Monte G, Grego-Bessa J, Gonzalez-Rajal A, Bolos V, De La Pompa JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17685488", "url": "https://glygen.org/publication/PubMed/17685488" } ] }, { "title": "DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.", "journal": "Nature", "date": "2007", "authors": "Ooi SK, Qiu C, Bernstein E, Li K, Jia D, Yang Z, Erdjument-Bromage H, Tempst P, Lin SP, Allis CD, Cheng X, Bestor TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "17687327", "url": "https://glygen.org/publication/PubMed/17687327" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "Activator-mediated recruitment of the MLL2 methyltransferase complex to the beta-globin locus.", "journal": "Molecular cell", "date": "2007", "authors": "Demers C, Chaturvedi CP, Ranish JA, Juban G, Lai P, Morle F, Aebersold R, Dilworth FJ, Groudine M, Brand M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "17707229", "url": "https://glygen.org/publication/PubMed/17707229" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "ATP-dependent assembly of the human origin recognition complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Siddiqui K, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "17716973", "url": "https://glygen.org/publication/PubMed/17716973" } ] }, { "title": "CHD1 motor protein is required for deposition of histone variant H3.3 into chromatin in vivo.", "journal": "Science (New York, N.Y.)", "date": "2007-08-24", "authors": "Konev Alexander Y, Tribus Martin, Park Sung Yeon, Podhraski Valerie, Lim Chin Yan, Emelyanov Alexander V, Vershilova Elena, Pirrotta Vincenzo, Kadonaga James T, Lusser Alexandra, Fyodorov Dmitry V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "17717186", "url": "https://glygen.org/publication/PubMed/17717186" } ] }, { "title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17761849", "url": "https://glygen.org/publication/PubMed/17761849" } ] }, { "title": "Orphan receptor TR3 attenuates the p300-induced acetylation of retinoid X receptor-alpha.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Zhao WX, Tian M, Zhao BX, Li GD, Liu B, Zhan YY, Chen HZ, Wu Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "17761950", "url": "https://glygen.org/publication/PubMed/17761950" } ] }, { "title": "Pro-inflammatory cytokines increase reactive oxygen species through mitochondria and NADPH oxidase in cultured RPE cells.", "journal": "Experimental eye research", "date": "2007", "authors": "Yang D, Elner SG, Bian ZM, Till GO, Petty HR, Elner VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17765224", "url": "https://glygen.org/publication/PubMed/17765224" } ] }, { "title": "MicroRNA-34b and MicroRNA-34c are targets of p53 and cooperate in control of cell proliferation and adhesion-independent growth.", "journal": "Cancer research", "date": "2007", "authors": "Corney DC, Flesken-Nikitin A, Godwin AK, Wang W, Nikitin AY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "17823410", "url": "https://glygen.org/publication/PubMed/17823410" } ] }, { "title": "The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing.", "journal": "Cell", "date": "2007", "authors": "De Santa F, Totaro MG, Prosperini E, Notarbartolo S, Testa G, Natoli G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17825402", "url": "https://glygen.org/publication/PubMed/17825402" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Targeted deletion of the mitogen-activated protein kinase kinase 4 gene in the nervous system causes severe brain developmental defects and premature death.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Wang X, Nadarajah B, Robinson AC, McColl BW, Jin JW, Dajas-Bailador F, Boot-Handford RP, Tournier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "17875933", "url": "https://glygen.org/publication/PubMed/17875933" } ] }, { "title": "Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.", "journal": "Nature", "date": "2007", "authors": "Guccione E, Bassi C, Casadio F, Martinato F, Cesaroni M, Schuchlautz H, Luscher B, Amati B", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17898714", "url": "https://glygen.org/publication/PubMed/17898714" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Mitotic histone H3 phosphorylation by vaccinia-related kinase 1 in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Kang TH, Park DY, Choi YH, Kim KJ, Yoon HS, Kim KT", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "17938195", "url": "https://glygen.org/publication/PubMed/17938195" } ] }, { "title": "JMJD6 is a histone arginine demethylase.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Chang B, Chen Y, Zhao Y, Bruick RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "17947579", "url": "https://glygen.org/publication/PubMed/17947579" } ] }, { "title": "Human CtIP promotes DNA end resection.", "journal": "Nature", "date": "2007", "authors": "Sartori AA, Lukas C, Coates J, Mistrik M, Fu S, Bartek J, Baer R, Lukas J, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17965729", "url": "https://glygen.org/publication/PubMed/17965729" } ] }, { "title": "hMSH4-hMSH5 adenosine nucleotide processing and interactions with homologous recombination machinery.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Snowden T, Shim KS, Schmutte C, Acharya S, Fishel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17977839", "url": "https://glygen.org/publication/PubMed/17977839" } ] }, { "title": "Analysis of replication protein A (RPA) in human spermatogenesis.", "journal": "Molecular human reproduction", "date": "2007", "authors": "Oliver-Bonet M, Campillo M, Turek PJ, Ko E, Martin RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "17981954", "url": "https://glygen.org/publication/PubMed/17981954" } ] }, { "title": "Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Hong S, Cho YW, Yu LR, Yu H, Veenstra TD, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "18003914", "url": "https://glygen.org/publication/PubMed/18003914" } ] }, { "title": "Recognition of trimethylated histone H3 lysine 4 facilitates the recruitment of transcription postinitiation factors and pre-mRNA splicing.", "journal": "Molecular cell", "date": "2007", "authors": "Sims RJ 3rd, Millhouse S, Chen CF, Lewis BA, Erdjument-Bromage H, Tempst P, Manley JL, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "18042460", "url": "https://glygen.org/publication/PubMed/18042460" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.", "journal": "Nature cell biology", "date": "2008", "authors": "Metzger E, Yin N, Wissmann M, Kunowska N, Fischer K, Friedrichs N, Patnaik D, Higgins JM, Potier N, Scheidtmann KH, Buettner R, Schule R", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "Reactome", "id": "R-HSA-5625886", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "18066052", "url": "https://glygen.org/publication/PubMed/18066052" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "Arginine methylation of the histone H3 tail impedes effector binding.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Iberg AN, Espejo A, Cheng D, Kim D, Michaud-Levesque J, Richard S, Bedford MT", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "18077460", "url": "https://glygen.org/publication/PubMed/18077460" } ] }, { "title": "PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.", "journal": "Genes & development", "date": "2007", "authors": "Hyllus D, Stein C, Schnabel K, Schiltz E, Imhof A, Dou Y, Hsieh J, Bauer UM", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18079182", "url": "https://glygen.org/publication/PubMed/18079182" } ] }, { "title": "PHD domain-mediated E3 ligase activity directs intramolecular sumoylation of an adjacent bromodomain required for gene silencing.", "journal": "Molecular cell", "date": "2007", "authors": "Ivanov AV, Peng H, Yurchenko V, Yap KL, Negorev DG, Schultz DC, Psulkowski E, Fredericks WJ, White DE, Maul GG, Sadofsky MJ, Zhou MM, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "18082607", "url": "https://glygen.org/publication/PubMed/18082607" } ] }, { "title": "Wingless signaling induces widespread chromatin remodeling of target loci.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Parker DS, Ni YY, Chang JL, Li J, Cadigan KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18160704", "url": "https://glygen.org/publication/PubMed/18160704" } ] }, { "title": "Multiple-myeloma-related WHSC1/MMSET isoform RE-IIBP is a histone methyltransferase with transcriptional repression activity.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Kim JY, Kee HJ, Choe NW, Kim SM, Eom GH, Baek HJ, Kook H, Kook H, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "18172012", "url": "https://glygen.org/publication/PubMed/18172012" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Entry route of HCMV into endothelial cells.", "journal": "Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology", "date": "2008", "authors": "Sinzger C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18203656", "url": "https://glygen.org/publication/PubMed/18203656" } ] }, { "title": "Loss of RB1 induces non-proliferative retinoma: increasing genomic instability correlates with progression to retinoblastoma.", "journal": "Human molecular genetics", "date": "2008", "authors": "Dimaras H, Khetan V, Halliday W, Orlic M, Prigoda NL, Piovesan B, Marrano P, Corson TW, Eagle RC Jr, Squire JA, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18211953", "url": "https://glygen.org/publication/PubMed/18211953" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Aberrant promoter methylation and tumor suppressive activity of the DFNA5 gene in colorectal carcinoma.", "journal": "Oncogene", "date": "2008", "authors": "Kim MS, Chang X, Yamashita K, Nagpal JK, Baek JH, Wu G, Trink B, Ratovitski EA, Mori M, Sidransky D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "18223688", "url": "https://glygen.org/publication/PubMed/18223688" } ] }, { "title": "Chk1 is a histone H3 threonine 11 kinase that regulates DNA damage-induced transcriptional repression.", "journal": "Cell", "date": "2008", "authors": "Shimada M, Niida H, Zineldeen DH, Tagami H, Tanaka M, Saito H, Nakanishi M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "18243098", "url": "https://glygen.org/publication/PubMed/18243098" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Basal c-Jun N-terminal kinases promote mitotic progression through histone H3 phosphorylation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Lee K, Song K", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "18256527", "url": "https://glygen.org/publication/PubMed/18256527" } ] }, { "title": "Formation and branch migration of Holliday junctions mediated by eukaryotic recombinases.", "journal": "Nature", "date": "2008", "authors": "Murayama Y, Kurokawa Y, Mayanagi K, Iwasaki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "18256600", "url": "https://glygen.org/publication/PubMed/18256600" } ] }, { "title": "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.", "journal": "Cell", "date": "2008", "authors": "Wajapeyee N, Serra RW, Zhu X, Mahalingam M, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18267069", "url": "https://glygen.org/publication/PubMed/18267069" } ] }, { "title": "Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage.", "journal": "Molecular cell", "date": "2008", "authors": "Levy D, Adamovich Y, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "18280240", "url": "https://glygen.org/publication/PubMed/18280240" } ] }, { "title": "Cytosine methylation: remaining faithful.", "journal": "Current biology : CB", "date": "2008", "authors": "Ooi SK, Bestor TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "18302924", "url": "https://glygen.org/publication/PubMed/18302924" } ] }, { "title": "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity.", "journal": "Genes & development", "date": "2008", "authors": "Zhao X, Jankovic V, Gural A, Huang G, Pardanani A, Menendez S, Zhang J, Dunne R, Xiao A, Erdjument-Bromage H, Allis CD, Tempst P, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "18316480", "url": "https://glygen.org/publication/PubMed/18316480" } ] }, { "title": "TAN-1, the human homolog of the Drosophila notch gene, is broken by chromosomal translocations in T lymphoblastic neoplasms.", "journal": "Cell", "date": "1991", "authors": "Ellisen LW, Bird J, West DC, Soreng AL, Reynolds TC, Smith SD, Sklar J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "1831692", "url": "https://glygen.org/publication/PubMed/1831692" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "Methylation of the DFNA5 increases risk of lymph node metastasis in human breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Kim MS, Lebron C, Nagpal JK, Chae YK, Chang X, Huang Y, Chuang T, Yamashita K, Trink B, Ratovitski EA, Califano JA, Sidransky D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "18346456", "url": "https://glygen.org/publication/PubMed/18346456" } ] }, { "title": "Cell-type-specific function of BCL9 involves a transcriptional activation domain that synergizes with beta-catenin.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Sustmann C, Flach H, Ebert H, Eastman Q, Grosschedl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18347063", "url": "https://glygen.org/publication/PubMed/18347063" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "p16(INK4a) translation suppressed by miR-24.", "journal": "PloS one", "date": "2008", "authors": "Lal A, Kim HH, Abdelmohsen K, Kuwano Y, Pullmann R Jr, Srikantan S, Subrahmanyam R, Martindale JL, Yang X, Ahmed F, Navarro F, Dykxhoorn D, Lieberman J, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18365017", "url": "https://glygen.org/publication/PubMed/18365017" } ] }, { "title": "RBF1 promotes chromatin condensation through a conserved interaction with the Condensin II protein dCAP-D3.", "journal": "Genes & development", "date": "2008", "authors": "Longworth MS, Herr A, Ji JY, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18367646", "url": "https://glygen.org/publication/PubMed/18367646" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "CHD8 is an ATP-dependent chromatin remodeling factor that regulates beta-catenin target genes.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Thompson BA, Tremblay V, Lin G, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "18378692", "url": "https://glygen.org/publication/PubMed/18378692" } ] }, { "title": "Molecular basis of histone H3K4me3 recognition by ING4.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Palacios A, Munoz IG, Pantoja-Uceda D, Marcaida MJ, Torres D, Martin-Garcia JM, Luque I, Montoya G, Blanco FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "18381289", "url": "https://glygen.org/publication/PubMed/18381289" } ] }, { "title": "The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.", "journal": "EMBO reports", "date": "2008", "authors": "Lacroix M, El Messaoudi S, Rodier G, Le Cam A, Sardet C, Fabbrizio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18404153", "url": "https://glygen.org/publication/PubMed/18404153" } ] }, { "title": "Pygopus and the Wnt signaling pathway: a diverse set of connections.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2008", "authors": "Jessen S, Gu B, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18404694", "url": "https://glygen.org/publication/PubMed/18404694" } ] }, { "title": "Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartupee J, Li X, Hamilton T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18411265", "url": "https://glygen.org/publication/PubMed/18411265" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Epigenetic control of rDNA loci in response to intracellular energy status.", "journal": "Cell", "date": "2008", "authors": "Murayama A, Ohmori K, Fujimura A, Minami H, Yasuzawa-Tanaka K, Kuroda T, Oie S, Daitoku H, Okuwaki M, Nagata K, Fukamizu A, Kimura K, Shimizu T, Yanagisawa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359" } ], "reference": [ { "type": "PubMed", "id": "18485871", "url": "https://glygen.org/publication/PubMed/18485871" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Decoding of methylated histone H3 tail by the Pygo-BCL9 Wnt signaling complex.", "journal": "Molecular cell", "date": "2008", "authors": "Fiedler M, Sanchez-Barrena MJ, Nekrasov M, Mieszczanek J, Rybin V, Muller J, Evans P, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "18498752", "url": "https://glygen.org/publication/PubMed/18498752" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "A comparative analysis of Dmc1 and Rad51 nucleoprotein filaments.", "journal": "Nucleic acids research", "date": "2008", "authors": "Sheridan SD, Yu X, Roth R, Heuser JE, Sehorn MG, Sung P, Egelman EH, Bishop DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "18535008", "url": "https://glygen.org/publication/PubMed/18535008" } ] }, { "title": "Tegument proteins of human cytomegalovirus.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2008", "authors": "Kalejta RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18535146", "url": "https://glygen.org/publication/PubMed/18535146" } ] }, { "title": "Chemokine signaling via the CXCR2 receptor reinforces senescence.", "journal": "Cell", "date": "2008", "authors": "Acosta JC, O'Loghlen A, Banito A, Guijarro MV, Augert A, Raguz S, Fumagalli M, Da Costa M, Brown C, Popov N, Takatsu Y, Melamed J, d'Adda di Fagagna F, Bernard D, Hernando E, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555777", "url": "https://glygen.org/publication/PubMed/18555777" } ] }, { "title": "Oncogene-induced senescence relayed by an interleukin-dependent inflammatory network.", "journal": "Cell", "date": "2008", "authors": "Kuilman T, Michaloglou C, Vredeveld LC, Douma S, van Doorn R, Desmet CJ, Aarden LA, Mooi WJ, Peeper DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555778", "url": "https://glygen.org/publication/PubMed/18555778" } ] }, { "title": "Structural basis for the recognition of histone H4 by the histone-chaperone RbAp46.", "journal": "Structure (London, England : 1993)", "date": "2008-07", "authors": "Murzina Natalia V, Pei Xue-Yuan, Zhang Wei, Sparkes Mike, Vicente-Garcia Jose, Pratap J Venkatesh, McLaughlin Stephen H, Ben-Shahar Tom Rolef, Verreault Alain, Luisi Ben F, Laue Ernest D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "18571423", "url": "https://glygen.org/publication/PubMed/18571423" } ] }, { "title": "The crystal structure of the ING5 PHD finger in complex with an H3K4me3 histone peptide.", "journal": "Proteins", "date": "2008", "authors": "Champagne KS, Saksouk N, Pena PV, Johnson K, Ullah M, Yang XJ, Cote J, Kutateladze TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "18623064", "url": "https://glygen.org/publication/PubMed/18623064" } ] }, { "title": "Truncated Cockayne syndrome B protein represses elongation by RNA polymerase I.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Lebedev A, Scharffetter-Kochanek K, Iben S", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "18656484", "url": "https://glygen.org/publication/PubMed/18656484" } ] }, { "title": "A regulatory circuit controlling Itch-mediated p73 degradation by Runx.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Levy D, Reuven N, Shaul Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "18701449", "url": "https://glygen.org/publication/PubMed/18701449" } ] }, { "title": "Microcephalin/MCPH1 associates with the Condensin II complex to function in homologous recombination repair.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wood JL, Liang Y, Li K, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "18718915", "url": "https://glygen.org/publication/PubMed/18718915" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Structural basis for recognition of hemi-methylated DNA by the SRA domain of human UHRF1.", "journal": "Nature", "date": "2008", "authors": "Avvakumov GV, Walker JR, Xue S, Li Y, Duan S, Bronner C, Arrowsmith CH, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "18772889", "url": "https://glygen.org/publication/PubMed/18772889" } ] }, { "title": "C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.", "journal": "Oncogene", "date": "2008", "authors": "Matsushita H, Nakajima H, Nakamura Y, Tsukamoto H, Tanaka Y, Jin G, Yabe M, Asai S, Ono R, Nosaka T, Sugita K, Morimoto A, Hayashi Y, Hotta T, Ando K, Miyachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "18776924", "url": "https://glygen.org/publication/PubMed/18776924" } ] }, { "title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Yekta S, Tabin CJ, Bartel DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "18781158", "url": "https://glygen.org/publication/PubMed/18781158" } ] }, { "title": "c-Jun expression, activation and function in neural cell death, inflammation and repair.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Raivich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "18793328", "url": "https://glygen.org/publication/PubMed/18793328" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Fluorescence correlation spectroscopy and fluorescence cross-correlation spectroscopy reveal the cytoplasmic origination of loaded nuclear RISC in vivo in human cells.", "journal": "Nucleic acids research", "date": "2008", "authors": "Ohrt T, Mutze J, Staroske W, Weinmann L, Hock J, Crell K, Meister G, Schwille P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18842624", "url": "https://glygen.org/publication/PubMed/18842624" } ] }, { "title": "MicroRNA-directed transcriptional gene silencing in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Kim DH, Saetrom P, Snove O Jr, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18852463", "url": "https://glygen.org/publication/PubMed/18852463" } ] }, { "title": "Structure and hemimethylated CpG binding of the SRA domain from human UHRF1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Qian C, Li S, Jakoncic J, Zeng L, Walsh MJ, Zhou MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "18945682", "url": "https://glygen.org/publication/PubMed/18945682" } ] }, { "title": "Polycomb proteins targeted by a short repeat RNA to the mouse X chromosome.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Zhao J, Sun BK, Erwin JA, Song JJ, Lee JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "18974356", "url": "https://glygen.org/publication/PubMed/18974356" } ] }, { "title": "Molecular characterization of human Argonaute-containing ribonucleoprotein complexes and their bound target mRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2008", "authors": "Landthaler M, Gaidatzis D, Rothballer A, Chen PY, Soll SJ, Dinic L, Ojo T, Hafner M, Zavolan M, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18978028", "url": "https://glygen.org/publication/PubMed/18978028" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms.", "journal": "Molecular cell", "date": "2008", "authors": "Margueron R, Li G, Sarma K, Blais A, Zavadil J, Woodcock CL, Dynlacht BD, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "19026781", "url": "https://glygen.org/publication/PubMed/19026781" } ] }, { "title": "Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.", "journal": "Nature", "date": "2008", "authors": "Chandra V, Huang P, Hamuro Y, Raghuram S, Wang Y, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "19043829", "url": "https://glygen.org/publication/PubMed/19043829" } ] }, { "title": "Oncogenic kinase NPM/ALK induces through STAT3 expression of immunosuppressive protein CD274 (PD-L1, B7-H1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Marzec M, Zhang Q, Goradia A, Raghunath PN, Liu X, Paessler M, Wang HY, Wysocka M, Cheng M, Ruggeri BA, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9909649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9909649" } ], "reference": [ { "type": "PubMed", "id": "19088198", "url": "https://glygen.org/publication/PubMed/19088198" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "A regulatory interplay between miR-27a and Runx1 during megakaryopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ben-Ami O, Pencovich N, Lotem J, Levanon D, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19114653", "url": "https://glygen.org/publication/PubMed/19114653" } ] }, { "title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.", "journal": "Journal of cellular biochemistry", "date": "2009", "authors": "Fernandez CC, Gudas LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19115252", "url": "https://glygen.org/publication/PubMed/19115252" } ] }, { "title": "Loss of expression for the Wnt pathway components adenomatous polyposis coli and glycogen synthase kinase 3-beta in parathyroid carcinomas.", "journal": "International journal of oncology", "date": "2009", "authors": "Juhlin CC, Haglund F, Villablanca A, Forsberg L, Sandelin K, Branstrom R, Larsson C, Hoog A", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19148484", "url": "https://glygen.org/publication/PubMed/19148484" } ] }, { "title": "NOTCH3 expression is induced in mural cells through an autoregulatory loop that requires endothelial-expressed JAGGED1.", "journal": "Circulation research", "date": "2009", "authors": "Liu H, Kennard S, Lilly B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19150886", "url": "https://glygen.org/publication/PubMed/19150886" } ] }, { "title": "Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.", "journal": "Cell", "date": "2009", "authors": "Weinmann L, Hock J, Ivacevic T, Ohrt T, Mutze J, Schwille P, Kremmer E, Benes V, Urlaub H, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19167051", "url": "https://glygen.org/publication/PubMed/19167051" } ] }, { "title": "Isolation and characterization of two human H1 histone genes within clusters of core histone genes.", "journal": "Genomics", "date": "1991", "authors": "Albig W, Kardalinou E, Drabent B, Zimmer A, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "1916825", "url": "https://glygen.org/publication/PubMed/1916825" } ] }, { "title": "Structural basis for the activation of PPARgamma by oxidized fatty acids.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Itoh T, Fairall L, Amin K, Inaba Y, Szanto A, Balint BL, Nagy L, Yamamoto K, Schwabe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "19172745", "url": "https://glygen.org/publication/PubMed/19172745" } ] }, { "title": "ING4 mediates crosstalk between histone H3 K4 trimethylation and H3 acetylation to attenuate cellular transformation.", "journal": "Molecular cell", "date": "2009", "authors": "Hung T, Binda O, Champagne KS, Kuo AJ, Johnson K, Chang HY, Simon MD, Kutateladze TG, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "19187765", "url": "https://glygen.org/publication/PubMed/19187765" } ] }, { "title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.", "journal": "BMC molecular biology", "date": "2009", "authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19232136", "url": "https://glygen.org/publication/PubMed/19232136" } ] }, { "title": "PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Zhao Q, Rank G, Tan YT, Li H, Moritz RL, Simpson RJ, Cerruti L, Curtis DJ, Patel DJ, Allis CD, Cunningham JM, Jane SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "19234465", "url": "https://glygen.org/publication/PubMed/19234465" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Lnk inhibits myeloproliferative disorder-associated JAK2 mutant, JAK2V617F.", "journal": "Journal of leukocyte biology", "date": "2009", "authors": "Gery S, Cao Q, Gueller S, Xing H, Tefferi A, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "19293402", "url": "https://glygen.org/publication/PubMed/19293402" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "Phosphorylation of histone H3 Thr-45 is linked to apoptosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Hurd PJ, Bannister AJ, Halls K, Dawson MA, Vermeulen M, Olsen JV, Ismail H, Somers J, Mann M, Owen-Hughes T, Gout I, Kouzarides T", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "19363025", "url": "https://glygen.org/publication/PubMed/19363025" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Lazzaretti D, Tournier I, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383768", "url": "https://glygen.org/publication/PubMed/19383768" } ] }, { "title": "A C-terminal silencing domain in GW182 is essential for miRNA function.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Eulalio A, Helms S, Fritzsch C, Fauser M, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383769", "url": "https://glygen.org/publication/PubMed/19383769" } ] }, { "title": "Mammalian GW182 contains multiple Argonaute-binding sites and functions in microRNA-mediated translational repression.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Takimoto K, Wakiyama M, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19398495", "url": "https://glygen.org/publication/PubMed/19398495" } ] }, { "title": "The H3K27me3 demethylase JMJD3 contributes to the activation of the INK4A-ARF locus in response to oncogene- and stress-induced senescence.", "journal": "Genes & development", "date": "2009", "authors": "Agger K, Cloos PA, Rudkjaer L, Williams K, Andersen G, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451217", "url": "https://glygen.org/publication/PubMed/19451217" } ] }, { "title": "Histone demethylase JMJD3 contributes to epigenetic control of INK4a/ARF by oncogenic RAS.", "journal": "Genes & development", "date": "2009", "authors": "Barradas M, Anderton E, Acosta JC, Li S, Banito A, Rodriguez-Niedenfuhr M, Maertens G, Banck M, Zhou MM, Walsh MJ, Peters G, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19451218", "url": "https://glygen.org/publication/PubMed/19451218" } ] }, { "title": "Groucho binds two conserved regions of LEF-1 for HDAC-dependent repression.", "journal": "BMC cancer", "date": "2009", "authors": "Arce L, Pate KT, Waterman ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19460168", "url": "https://glygen.org/publication/PubMed/19460168" } ] }, { "title": "Polycomb mediated epigenetic silencing and replication timing at the INK4a/ARF locus during senescence.", "journal": "PloS one", "date": "2009", "authors": "Agherbi H, Gaussmann-Wenger A, Verthuy C, Chasson L, Serrano M, Djabali M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19462008", "url": "https://glygen.org/publication/PubMed/19462008" } ] }, { "title": "Pygo2 expands mammary progenitor cells by facilitating histone H3 K4 methylation.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Gu B, Sun P, Yuan Y, Moraes RC, Li A, Teng A, Agrawal A, Rheaume C, Bilanchone V, Veltmaat JM, Takemaru K, Millar S, Lee EY, Lewis MT, Li B, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19487454", "url": "https://glygen.org/publication/PubMed/19487454" } ] }, { "title": "The PHD domain is required to link Drosophila Pygopus to Legless/beta-catenin and not to histone H3.", "journal": "Mechanisms of development", "date": "2009", "authors": "Kessler R, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19493659", "url": "https://glygen.org/publication/PubMed/19493659" } ] }, { "title": "Lung cancer-associated JmjC domain protein mdig suppresses formation of tri-methyl lysine 9 of histone H3.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Lu Y, Chang Q, Zhang Y, Beezhold K, Rojanasakul Y, Zhao H, Castranova V, Shi X, Chen F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "19502796", "url": "https://glygen.org/publication/PubMed/19502796" } ] }, { "title": "Thrombospondin-1 is a transcriptional repression target of PRMT6.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Michaud-Levesque J, Richard S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19509293", "url": "https://glygen.org/publication/PubMed/19509293" } ] }, { "title": "Acetylation of histone H3 at the nucleosome dyad alters DNA-histone binding.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Manohar M, Mooney AM, North JA, Nakkula RJ, Picking JW, Edon A, Fishel R, Poirier MG, Ottesen JJ", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "19520870", "url": "https://glygen.org/publication/PubMed/19520870" } ] }, { "title": "Mitochondrial dysfunction contributes to oncogene-induced senescence.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Moiseeva O, Bourdeau V, Roux A, Deschenes-Simard X, Ferbeyre G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "19528227", "url": "https://glygen.org/publication/PubMed/19528227" } ] }, { "title": "Many human large intergenic noncoding RNAs associate with chromatin-modifying complexes and affect gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Khalil AM, Guttman M, Huarte M, Garber M, Raj A, Rivea Morales D, Thomas K, Presser A, Bernstein BE, van Oudenaarden A, Regev A, Lander ES, Rinn JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "19571010", "url": "https://glygen.org/publication/PubMed/19571010" } ] }, { "title": "Telomerase modulates Wnt signalling by association with target gene chromatin.", "journal": "Nature", "date": "2009", "authors": "Park JI, Venteicher AS, Hong JY, Choi J, Jun S, Shkreli M, Chang W, Meng Z, Cheung P, Ji H, McLaughlin M, Veenstra TD, Nusse R, McCrea PD, Artandi SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "19571879", "url": "https://glygen.org/publication/PubMed/19571879" } ] }, { "title": "Phosphorylation of histone H3 at Thr3 is part of a combinatorial pattern that marks and configures mitotic chromatin.", "journal": "Journal of cell science", "date": "2009", "authors": "Markaki Y, Christogianni A, Politou AS, Georgatos SD", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "19622635", "url": "https://glygen.org/publication/PubMed/19622635" } ] }, { "title": "Human cytomegalovirus exploits ESCRT machinery in the process of virion maturation.", "journal": "Journal of virology", "date": "2009", "authors": "Tandon R, AuCoin DP, Mocarski ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-9610379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379" } ], "reference": [ { "type": "PubMed", "id": "19640981", "url": "https://glygen.org/publication/PubMed/19640981" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "Chromatin structure regulates human cytomegalovirus gene expression during latency, reactivation and lytic infection.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "19682613", "url": "https://glygen.org/publication/PubMed/19682613" } ] }, { "title": "MicroRNA miR-34 inhibits human pancreatic cancer tumor-initiating cells.", "journal": "PloS one", "date": "2009", "authors": "Ji Q, Hao X, Zhang M, Tang W, Yang M, Li L, Xiang D, Desano JT, Bommer GT, Fan D, Fearon ER, Lawrence TS, Xu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19714243", "url": "https://glygen.org/publication/PubMed/19714243" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "MicroRNA-206 targets notch3, activates apoptosis, and inhibits tumor cell migration and focus formation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Song G, Zhang Y, Wang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19723635", "url": "https://glygen.org/publication/PubMed/19723635" } ] }, { "title": "KDM1B is a histone H3K4 demethylase required to establish maternal genomic imprints.", "journal": "Nature", "date": "2009", "authors": "Ciccone DN, Su H, Hevi S, Gay F, Lei H, Bajko J, Xu G, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "19727073", "url": "https://glygen.org/publication/PubMed/19727073" } ] }, { "title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.", "journal": "Gastroenterology", "date": "2009", "authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19747919", "url": "https://glygen.org/publication/PubMed/19747919" } ] }, { "title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.", "journal": "Nature", "date": "1990", "authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1975088", "url": "https://glygen.org/publication/PubMed/1975088" } ] }, { "title": "MicroRNA-34a inhibits glioblastoma growth by targeting multiple oncogenes.", "journal": "Cancer research", "date": "2009", "authors": "Li Y, Guessous F, Zhang Y, Dipierro C, Kefas B, Johnson E, Marcinkiewicz L, Jiang J, Yang Y, Schmittgen TD, Lopes B, Schiff D, Purow B, Abounader R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "19773441", "url": "https://glygen.org/publication/PubMed/19773441" } ] }, { "title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.", "journal": "Molecular cell", "date": "2009", "authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19782034", "url": "https://glygen.org/publication/PubMed/19782034" } ] }, { "title": "JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin.", "journal": "Nature", "date": "2009", "authors": "Dawson MA, Bannister AJ, Gottgens B, Foster SD, Bartke T, Green AR, Kouzarides T", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "19783980", "url": "https://glygen.org/publication/PubMed/19783980" } ] }, { "title": "Cell surface-bound IL-1alpha is an upstream regulator of the senescence-associated IL-6/IL-8 cytokine network.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Orjalo AV, Bhaumik D, Gengler BK, Scott GK, Campisi J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "19805069", "url": "https://glygen.org/publication/PubMed/19805069" } ] }, { "title": "The target of the NSD family of histone lysine methyltransferases depends on the nature of the substrate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Li Y, Trojer P, Xu CF, Cheung P, Kuo A, Drury WJ 3rd, Qiao Q, Neubert TA, Xu RM, Gozani O, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "19808676", "url": "https://glygen.org/publication/PubMed/19808676" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Structural basis for recognition of H3K4 methylation status by the DNA methyltransferase 3A ATRX-DNMT3-DNMT3L domain.", "journal": "EMBO reports", "date": "2009", "authors": "Otani J, Nankumo T, Arita K, Inamoto S, Ariyoshi M, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "19834512", "url": "https://glygen.org/publication/PubMed/19834512" } ] }, { "title": "An intergenic non-coding rRNA correlated with expression of the rRNA and frequency of an rRNA single nucleotide polymorphism in lung cancer cells.", "journal": "PloS one", "date": "2009", "authors": "Shiao YH, Lupascu ST, Gu YD, Kasprzak W, Hwang CJ, Fields JR, Leighty RM, Quinones O, Shapiro BA, Alvord WG, Anderson LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "19838300", "url": "https://glygen.org/publication/PubMed/19838300" } ] }, { "title": "PHF8, a gene associated with cleft lip/palate and mental retardation, encodes for an Nepsilon-dimethyl lysine demethylase.", "journal": "Human molecular genetics", "date": "2010", "authors": "Loenarz C, Ge W, Coleman ML, Rose NR, Cooper CD, Klose RJ, Ratcliffe PJ, Schofield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "19843542", "url": "https://glygen.org/publication/PubMed/19843542" } ] }, { "title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.", "journal": "Molecular cell", "date": "2009", "authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19854132", "url": "https://glygen.org/publication/PubMed/19854132" } ] }, { "title": "Dual mechanism of impairment of interleukin-7 (IL-7) responses in human immunodeficiency virus infection: decreased IL-7 binding and abnormal activation of the JAK/STAT5 pathway.", "journal": "Journal of virology", "date": "2010", "authors": "Juffroy O, Bugault F, Lambotte O, Landires I, Viard JP, Niel L, Fontanet A, Delfraissy JF, Theze J, Chakrabarti LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "19864382", "url": "https://glygen.org/publication/PubMed/19864382" } ] }, { "title": "Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW, Conaway RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "20018852", "url": "https://glygen.org/publication/PubMed/20018852" } ] }, { "title": "Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Horton JR, Upadhyay AK, Qi HH, Zhang X, Shi Y, Cheng X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20023638", "url": "https://glygen.org/publication/PubMed/20023638" } ] }, { "title": "PRDM9 is a major determinant of meiotic recombination hotspots in humans and mice.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Baudat F, Buard J, Grey C, Fledel-Alon A, Ober C, Przeworski M, Coop G, de Massy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20044539", "url": "https://glygen.org/publication/PubMed/20044539" } ] }, { "title": "Drive against hotspot motifs in primates implicates the PRDM9 gene in meiotic recombination.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Myers S, Bowden R, Tumian A, Bontrop RE, Freeman C, MacFie TS, McVean G, Donnelly P", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20044541", "url": "https://glygen.org/publication/PubMed/20044541" } ] }, { "title": "Structure of the hDmc1-ssDNA filament reveals the principles of its architecture.", "journal": "PloS one", "date": "2010", "authors": "Okorokov AL, Chaban YL, Bugreev DV, Hodgkinson J, Mazin AV, Orlova EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20062530", "url": "https://glygen.org/publication/PubMed/20062530" } ] }, { "title": "JARID2 regulates binding of the Polycomb repressive complex 2 to target genes in ES cells.", "journal": "Nature", "date": "2010", "authors": "Pasini D, Cloos PA, Walfridsson J, Olsson L, Bukowski JP, Johansen JV, Bak M, Tommerup N, Rappsilber J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20075857", "url": "https://glygen.org/publication/PubMed/20075857" } ] }, { "title": "Involvement of epigenetically silenced microRNA-181c in gastric carcinogenesis.", "journal": "Carcinogenesis", "date": "2010", "authors": "Hashimoto Y, Akiyama Y, Otsubo T, Shimada S, Yuasa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20080834", "url": "https://glygen.org/publication/PubMed/20080834" } ] }, { "title": "Dual-specificity histone demethylase KIAA1718 (KDM7A) regulates neural differentiation through FGF4.", "journal": "Cell research", "date": "2010", "authors": "Huang C, Xiang Y, Wang Y, Li X, Xu L, Zhu Z, Zhang T, Zhu Q, Zhang K, Jing N, Chen CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20084082", "url": "https://glygen.org/publication/PubMed/20084082" } ] }, { "title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.", "journal": "FEBS letters", "date": "2010", "authors": "Yates JA, Menon T, Thompson BA, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "20085832", "url": "https://glygen.org/publication/PubMed/20085832" } ] }, { "title": "Transcriptional role of cyclin D1 in development revealed by a genetic-proteomic screen.", "journal": "Nature", "date": "2010", "authors": "Bienvenu F, Jirawatnotai S, Elias JE, Meyer CA, Mizeracka K, Marson A, Frampton GM, Cole MF, Odom DT, Odajima J, Geng Y, Zagozdzon A, Jecrois M, Young RA, Liu XS, Cepko CL, Gygi SP, Sicinski P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20090754", "url": "https://glygen.org/publication/PubMed/20090754" } ] }, { "title": "The HLA-B*2705 peptidome.", "journal": "Arthritis and rheumatism", "date": "2010-02", "authors": "Ben Dror Lilach, Barnea Eilon, Beer Ilan, Mann Matthias, Admon Arie", "evidence": [ { "database": "IEDB", "id": "435299", "url": "https://www.iedb.org/epitope/435299" }, { "database": "IEDB", "id": "435791", "url": "https://www.iedb.org/epitope/435791" } ], "reference": [ { "type": "PubMed", "id": "20112406", "url": "https://glygen.org/publication/PubMed/20112406" } ] }, { "title": "Jarid2 and PRC2, partners in regulating gene expression.", "journal": "Genes & development", "date": "2010", "authors": "Li G, Margueron R, Ku M, Chambon P, Bernstein BE, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20123894", "url": "https://glygen.org/publication/PubMed/20123894" } ] }, { "title": "Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Wen H, Li J, Song T, Lu M, Kan PY, Lee MG, Sha B, Shi X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20129925", "url": "https://glygen.org/publication/PubMed/20129925" } ] }, { "title": "Promoter chromatin remodeling of immediate-early genes is mediated through H3 phosphorylation at either serine 28 or 10 by the MSK1 multi-protein complex.", "journal": "Nucleic acids research", "date": "2010", "authors": "Drobic B, Perez-Cadahia B, Yu J, Kung SK, Davie JR", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20129940", "url": "https://glygen.org/publication/PubMed/20129940" } ] }, { "title": "PHF8 activates transcription of rRNA genes through H3K4me3 binding and H3K9me1/2 demethylation.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Feng W, Yonezawa M, Ye J, Jenuwein T, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20208542", "url": "https://glygen.org/publication/PubMed/20208542" } ] }, { "title": "Distinct factors control histone variant H3.3 localization at specific genomic regions.", "journal": "Cell", "date": "2010", "authors": "Goldberg AD, Banaszynski LA, Noh KM, Lewis PW, Elsaesser SJ, Stadler S, Dewell S, Law M, Guo X, Li X, Wen D, Chapgier A, DeKelver RC, Miller JC, Lee YL, Boydston EA, Holmes MC, Gregory PD, Greally JM, Rafii S, Yang C, Scambler PJ, Garrick D, Gibbons RJ, Higgs DR, Cristea IM, Urnov FD, Zheng D, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "20211137", "url": "https://glygen.org/publication/PubMed/20211137" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.", "journal": "Nature", "date": "2010", "authors": "Metzger E, Imhof A, Patel D, Kahl P, Hoffmeyer K, Friedrichs N, Muller JM, Greschik H, Kirfel J, Ji S, Kunowska N, Beisenherz-Huss C, Gunther T, Buettner R, Schule R", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20228790", "url": "https://glygen.org/publication/PubMed/20228790" } ] }, { "title": "Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Pavletich NP, Pabo CO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "2028256", "url": "https://glygen.org/publication/PubMed/2028256" } ] }, { "title": "AML1 is overexpressed in patients with myeloproliferative neoplasms and mediates JAK2V617F-independent overexpression of NF-E2.", "journal": "Blood", "date": "2010", "authors": "Wang W, Schwemmers S, Hexner EO, Pahl HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20339092", "url": "https://glygen.org/publication/PubMed/20339092" } ] }, { "title": "MicroRNA-34a suppresses invasion through downregulation of Notch1 and Jagged1 in cervical carcinoma and choriocarcinoma cells.", "journal": "Carcinogenesis", "date": "2010", "authors": "Pang RT, Leung CO, Ye TM, Liu W, Chiu PC, Lam KK, Lee KF, Yeung WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20351093", "url": "https://glygen.org/publication/PubMed/20351093" } ] }, { "title": "RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Lee S, Shuman JD, Guszczynski T, Sakchaisri K, Sebastian T, Copeland TD, Miller M, Cohen MS, Taunton J, Smart RC, Xiao Z, Yu LR, Veenstra TD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20351173", "url": "https://glygen.org/publication/PubMed/20351173" } ] }, { "title": "ZEB1 represses E-cadherin and induces an EMT by recruiting the SWI/SNF chromatin-remodeling protein BRG1.", "journal": "Oncogene", "date": "2010-06-17", "authors": "S\u00e1nchez-Till\u00f3 E, L\u00e1zaro A, Torrent R, Cuatrecasas M, Vaquero E C, Castells A, Engel P, Postigo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "20418909", "url": "https://glygen.org/publication/PubMed/20418909" } ] }, { "title": "DeltaNp63alpha repression of the Notch1 gene supports the proliferative capacity of normal human keratinocytes and cervical cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Yugawa T, Narisawa-Saito M, Yoshimatsu Y, Haga K, Ohno S, Egawa N, Fujita M, Kiyono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442293", "url": "https://glygen.org/publication/PubMed/20442293" } ] }, { "title": "Differential control of Notch1 gene transcription by Klf4 and Sp3 transcription factors in normal versus cancer-derived keratinocytes.", "journal": "PloS one", "date": "2010", "authors": "Lambertini C, Pantano S, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20442780", "url": "https://glygen.org/publication/PubMed/20442780" } ] }, { "title": "CCAAT/Enhancer-binding protein beta DNA binding is auto-inhibited by multiple elements that also mediate association with p300/CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lee S, Miller M, Shuman JD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20452968", "url": "https://glygen.org/publication/PubMed/20452968" } ] }, { "title": "CHD8 interacts with CHD7, a protein which is mutated in CHARGE syndrome.", "journal": "Human molecular genetics", "date": "2010", "authors": "Batsukh T, Pieper L, Koszucka AM, von Velsen N, Hoyer-Fender S, Elbracht M, Bergman JE, Hoefsloot LH, Pauli S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "20453063", "url": "https://glygen.org/publication/PubMed/20453063" } ] }, { "title": "KDM8, a H3K36me2 histone demethylase that acts in the cyclin A1 coding region to regulate cancer cell proliferation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Hsia DA, Tepper CG, Pochampalli MR, Hsia EY, Izumiya C, Huerta SB, Wright ME, Chen HW, Kung HJ, Izumiya Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20457893", "url": "https://glygen.org/publication/PubMed/20457893" } ] }, { "title": "Epigenetically reprogramming metastatic tumor cells with an embryonic microenvironment.", "journal": "Epigenomics", "date": "2009", "authors": "Costa FF, Seftor EA, Bischof JM, Kirschmann DA, Strizzi L, Arndt K, Bonaldo Mde F, Soares MB, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20495621", "url": "https://glygen.org/publication/PubMed/20495621" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "CDK2AP1/DOC-1 is a bona fide subunit of the Mi-2/NuRD complex.", "journal": "Molecular bioSystems", "date": "2010", "authors": "Spruijt CG, Bartels SJ, Brinkman AB, Tjeertes JV, Poser I, Stunnenberg HG, Vermeulen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "20523938", "url": "https://glygen.org/publication/PubMed/20523938" } ] }, { "title": "Regulation of mouse steroidogenesis by WHISTLE and JMJD1C through histone methylation balance.", "journal": "Nucleic acids research", "date": "2010", "authors": "Kim SM, Kim JY, Choe NW, Cho IH, Kim JR, Kim DW, Seol JE, Lee SE, Kook H, Nam KI, Kook H, Bhak YY, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20530532", "url": "https://glygen.org/publication/PubMed/20530532" } ] }, { "title": "Loss of pRB causes centromere dysfunction and chromosomal instability.", "journal": "Genes & development", "date": "2010", "authors": "Manning AL, Longworth MS, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20551165", "url": "https://glygen.org/publication/PubMed/20551165" } ] }, { "title": "Mitotic chromosome condensation mediated by the retinoblastoma protein is tumor-suppressive.", "journal": "Genes & development", "date": "2010", "authors": "Coschi CH, Martens AL, Ritchie K, Francis SM, Chakrabarti S, Berube NG, Dick FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20551166", "url": "https://glygen.org/publication/PubMed/20551166" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "Histone H4K20/H3K9 demethylase PHF8 regulates zebrafish brain and craniofacial development.", "journal": "Nature", "date": "2010", "authors": "Qi HH, Sarkissian M, Hu GQ, Wang Z, Bhattacharjee A, Gordon DB, Gonzales M, Lan F, Ongusaha PP, Huarte M, Yaghi NK, Lim H, Garcia BA, Brizuela L, Zhao K, Roberts TM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20622853", "url": "https://glygen.org/publication/PubMed/20622853" } ] }, { "title": "PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.", "journal": "Nature", "date": "2010", "authors": "Liu W, Tanasa B, Tyurina OV, Zhou TY, Gassmann R, Liu WT, Ohgi KA, Benner C, Garcia-Bassets I, Aggarwal AK, Desai A, Dorrestein PC, Glass CK, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "20622854", "url": "https://glygen.org/publication/PubMed/20622854" } ] }, { "title": "Mechanisms and functions of p38 MAPK signalling.", "journal": "The Biochemical journal", "date": "2010", "authors": "Cuadrado A, Nebreda AR", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20626350", "url": "https://glygen.org/publication/PubMed/20626350" } ] }, { "title": "Regulation of immune cell homeostasis by type I interferons.", "journal": "Cytokine & growth factor reviews", "date": "2010", "authors": "Mattei F, Schiavoni G, Tough DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "20627800", "url": "https://glygen.org/publication/PubMed/20627800" } ] }, { "title": "The inherent processivity of the human de novo methyltransferase 3A (DNMT3A) is enhanced by DNMT3L.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Holz-Schietinger C, Reich NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "20630873", "url": "https://glygen.org/publication/PubMed/20630873" } ] }, { "title": "C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence.", "journal": "Molecular biology reports", "date": "2010", "authors": "Cai R, Cai X, Chen B, Xu W, Lu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "20661648", "url": "https://glygen.org/publication/PubMed/20661648" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "Histone H3 Thr-3 phosphorylation by Haspin positions Aurora B at centromeres in mitosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Wang F, Dai J, Daum JR, Niedzialkowska E, Banerjee B, Stukenberg PT, Gorbsky GJ, Higgins JM", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20705812", "url": "https://glygen.org/publication/PubMed/20705812" } ] }, { "title": "NOTCH1 and NOTCH3 coordinate esophageal squamous differentiation through a CSL-dependent transcriptional network.", "journal": "Gastroenterology", "date": "2010", "authors": "Ohashi S, Natsuizaka M, Yashiro-Ohtani Y, Kalman RA, Nakagawa M, Wu L, Klein-Szanto AJ, Herlyn M, Diehl JA, Katz JP, Pear WS, Seykora JT, Nakagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20801121", "url": "https://glygen.org/publication/PubMed/20801121" } ] }, { "title": "Epithelial to mesenchymal transition is mechanistically linked with stem cell signatures in prostate cancer cells.", "journal": "PloS one", "date": "2010", "authors": "Kong D, Banerjee S, Ahmad A, Li Y, Wang Z, Sethi S, Sarkar FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "20805998", "url": "https://glygen.org/publication/PubMed/20805998" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "PRDM9 variation strongly influences recombination hot-spot activity and meiotic instability in humans.", "journal": "Nature genetics", "date": "2010", "authors": "Berg IL, Neumann R, Lam KW, Sarbajna S, Odenthal-Hesse L, May CA, Jeffreys AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "20818382", "url": "https://glygen.org/publication/PubMed/20818382" } ] }, { "title": "DNMT3L modulates significant and distinct flanking sequence preference for DNA methylation by DNMT3A and DNMT3B in vivo.", "journal": "PLoS genetics", "date": "2010", "authors": "Wienholz BL, Kareta MS, Moarefi AH, Gordon CA, Ginno PA, Chedin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "20838592", "url": "https://glygen.org/publication/PubMed/20838592" } ] }, { "title": "Identification of preferential target sites for human DNA methyltransferases.", "journal": "Nucleic acids research", "date": "2011", "authors": "Choi SH, Heo K, Byun HM, An W, Lu W, Yang AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "20841325", "url": "https://glygen.org/publication/PubMed/20841325" } ] }, { "title": "Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.", "journal": "Cell", "date": "2010", "authors": "Vermeulen M, Eberl HC, Matarese F, Marks H, Denissov S, Butter F, Lee KK, Olsen JV, Hyman AA, Stunnenberg HG, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20850016", "url": "https://glygen.org/publication/PubMed/20850016" } ] }, { "title": "Methyl-H3K9-binding protein MPP8 mediates E-cadherin gene silencing and promotes tumour cell motility and invasion.", "journal": "The EMBO journal", "date": "2010", "authors": "Kokura K, Sun L, Bedford MT, Fang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "20871592", "url": "https://glygen.org/publication/PubMed/20871592" } ] }, { "title": "Regulation of platelet myosin light chain (MYL9) by RUNX1: implications for thrombocytopenia and platelet dysfunction in RUNX1 haplodeficiency.", "journal": "Blood", "date": "2010", "authors": "Jalagadugula G, Mao G, Kaur G, Goldfinger LE, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20876458", "url": "https://glygen.org/publication/PubMed/20876458" } ] }, { "title": "Combinatorial transcriptional control in blood stem/progenitor cells: genome-wide analysis of ten major transcriptional regulators.", "journal": "Cell stem cell", "date": "2010", "authors": "Wilson NK, Foster SD, Wang X, Knezevic K, Schutte J, Kaimakis P, Chilarska PM, Kinston S, Ouwehand WH, Dzierzak E, Pimanda JE, de Bruijn MF, Gottgens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "20887958", "url": "https://glygen.org/publication/PubMed/20887958" } ] }, { "title": "Two histone marks establish the inner centromere and chromosome bi-orientation.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Yamagishi Y, Honda T, Tanno Y, Watanabe Y", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20929775", "url": "https://glygen.org/publication/PubMed/20929775" } ] }, { "title": "A chromatin localization screen reveals poly (ADP ribose)-regulated recruitment of the repressive polycomb and NuRD complexes to sites of DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Chou DM, Adamson B, Dephoure NE, Tan X, Nottke AC, Hurov KE, Gygi SP, Colaiacovo MP, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20937877", "url": "https://glygen.org/publication/PubMed/20937877" } ] }, { "title": "Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.", "journal": "Cancer cell", "date": "2010", "authors": "Aggarwal P, Vaites LP, Kim JK, Mellert H, Gurung B, Nakagawa H, Herlyn M, Hua X, Rustgi AK, McMahon SB, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "20951943", "url": "https://glygen.org/publication/PubMed/20951943" } ] }, { "title": "A phospho/methyl switch at histone H3 regulates TFIID association with mitotic chromosomes.", "journal": "The EMBO journal", "date": "2010", "authors": "Varier RA, Outchkourov NS, de Graaf P, van Schaik FM, Ensing HJ, Wang F, Higgins JM, Kops GJ, Timmers HT", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "20953165", "url": "https://glygen.org/publication/PubMed/20953165" } ] }, { "title": "Dynamic regulation of the PR-Set7 histone methyltransferase is required for normal cell cycle progression.", "journal": "Genes & development", "date": "2010", "authors": "Wu S, Wang W, Kong X, Congdon LM, Yokomori K, Kirschner MW, Rice JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "20966048", "url": "https://glygen.org/publication/PubMed/20966048" } ] }, { "title": "Binding of different histone marks differentially regulates the activity and specificity of polycomb repressive complex 2 (PRC2).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Xu C, Bian C, Yang W, Galka M, Ouyang H, Chen C, Qiu W, Liu H, Jones AE, MacKenzie F, Pan P, Li SS, Wang H, Min J", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "20974918", "url": "https://glygen.org/publication/PubMed/20974918" } ] }, { "title": "Discovery of CP-690,550: a potent and selective Janus kinase (JAK) inhibitor for the treatment of autoimmune diseases and organ transplant rejection.", "journal": "Journal of medicinal chemistry", "date": "2010", "authors": "Flanagan ME, Blumenkopf TA, Brissette WH, Brown MF, Casavant JM, Shang-Poa C, Doty JL, Elliott EA, Fisher MB, Hines M, Kent C, Kudlacz EM, Lillie BM, Magnuson KS, McCurdy SP, Munchhof MJ, Perry BD, Sawyer PS, Strelevitz TJ, Subramanyam C, Sun J, Whipple DA, Changelian PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "21105711", "url": "https://glygen.org/publication/PubMed/21105711" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2011", "authors": "Aneja K, Jalagadugula G, Mao G, Singh A, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21129147", "url": "https://glygen.org/publication/PubMed/21129147" } ] }, { "title": "Lysine methylation of the NF-kappaB subunit RelA by SETD6 couples activity of the histone methyltransferase GLP at chromatin to tonic repression of NF-kappaB signaling.", "journal": "Nature immunology", "date": "2011", "authors": "Levy D, Kuo AJ, Chang Y, Schaefer U, Kitson C, Cheung P, Espejo A, Zee BM, Liu CL, Tangsombatvisit S, Tennen RI, Kuo AY, Tanjing S, Cheung R, Chua KF, Utz PJ, Shi X, Prinjha RK, Lee K, Garcia BA, Bedford MT, Tarakhovsky A, Cheng X, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21131967", "url": "https://glygen.org/publication/PubMed/21131967" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "Structure of DNMT1-DNA complex reveals a role for autoinhibition in maintenance DNA methylation.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Song J, Rechkoblit O, Bestor TH, Patel DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21163962", "url": "https://glygen.org/publication/PubMed/21163962" } ] }, { "title": "GC-rich sequence elements recruit PRC2 in mammalian ES cells.", "journal": "PLoS genetics", "date": "2010", "authors": "Mendenhall EM, Koche RP, Truong T, Zhou VW, Issac B, Chi AS, Ku M, Bernstein BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "21170310", "url": "https://glygen.org/publication/PubMed/21170310" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Qiao Q, Li Y, Chen Z, Wang M, Reinberg D, Xu RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21196496", "url": "https://glygen.org/publication/PubMed/21196496" } ] }, { "title": "Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2011", "authors": "Jalagadugula G, Mao G, Kaur G, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21252065", "url": "https://glygen.org/publication/PubMed/21252065" } ] }, { "title": "Kruppel-like family of transcription factor 9, a differentiation-associated transcription factor, suppresses Notch1 signaling and inhibits glioblastoma-initiating stem cells.", "journal": "Stem cells (Dayton, Ohio)", "date": "2011", "authors": "Ying M, Sang Y, Li Y, Guerrero-Cazares H, Quinones-Hinojosa A, Vescovi AL, Eberhart CG, Xia S, Laterra J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21280156", "url": "https://glygen.org/publication/PubMed/21280156" } ] }, { "title": "Histone code pathway involving H3 S28 phosphorylation and K27 acetylation activates transcription and antagonizes polycomb silencing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Lau PN, Cheung P", "evidence": [ { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "21282660", "url": "https://glygen.org/publication/PubMed/21282660" } ] }, { "title": "JAK2V617F-mediated phosphorylation of PRMT5 downregulates its methyltransferase activity and promotes myeloproliferation.", "journal": "Cancer cell", "date": "2011", "authors": "Liu F, Zhao X, Perna F, Wang L, Koppikar P, Abdel-Wahab O, Harr MW, Levine RL, Xu H, Tefferi A, Deblasio A, Hatlen M, Menendez S, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21316606", "url": "https://glygen.org/publication/PubMed/21316606" } ] }, { "title": "Modulation of Dnmt3b function in vitro by interactions with Dnmt3L, Dnmt3a and Dnmt3b splice variants.", "journal": "Nucleic acids research", "date": "2011", "authors": "Van Emburgh BO, Robertson KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21378119", "url": "https://glygen.org/publication/PubMed/21378119" } ] }, { "title": "Endothelial Jarid2/Jumonji is required for normal cardiac development and proper Notch1 expression.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mysliwiec MR, Bresnick EH, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21402699", "url": "https://glygen.org/publication/PubMed/21402699" } ] }, { "title": "Transcriptional gene silencing in mammalian cells by miRNA mimics that target gene promoters.", "journal": "Nucleic acids research", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21427083", "url": "https://glygen.org/publication/PubMed/21427083" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.", "journal": "Blood", "date": "2011", "authors": "Haefliger S, Klebig C, Schaubitzer K, Schardt J, Timchenko N, Mueller BU, Pabst T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21471526", "url": "https://glygen.org/publication/PubMed/21471526" } ] }, { "title": "Recognition of multivalent histone states associated with heterochromatin by UHRF1 protein.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Nady N, Lemak A, Walker JR, Avvakumov GV, Kareta MS, Achour M, Xue S, Duan S, Allali-Hassani A, Zuo X, Wang YX, Bronner C, Chedin F, Arrowsmith CH, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21489993", "url": "https://glygen.org/publication/PubMed/21489993" } ] }, { "title": "p66Alpha-MBD2 coiled-coil interaction and recruitment of Mi-2 are critical for globin gene silencing by the MBD2-NuRD complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-05-03", "authors": "Gnanapragasam Merlin Nithya, Scarsdale J Neel, Amaya Maria L, Webb Heather D, Desai Megha A, Walavalkar Ninad M, Wang Shou Zhen, Zu Zhu Sheng, Ginder Gordon D, Williams David C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "21490301", "url": "https://glygen.org/publication/PubMed/21490301" } ] }, { "title": "The initial phase of chromosome condensation requires Cdk1-mediated phosphorylation of the CAP-D3 subunit of condensin II.", "journal": "Genes & development", "date": "2011", "authors": "Abe S, Nagasaka K, Hirayama Y, Kozuka-Hata H, Oyama M, Aoyagi Y, Obuse C, Hirota T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21498573", "url": "https://glygen.org/publication/PubMed/21498573" } ] }, { "title": "SET nuclear oncogene associates with microcephalin/MCPH1 and regulates chromosome condensation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Leung JW, Leitch A, Wood JL, Shaw-Smith C, Metcalfe K, Bicknell LS, Jackson AP, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21515671", "url": "https://glygen.org/publication/PubMed/21515671" } ] }, { "title": "PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B.", "journal": "Nature cell biology", "date": "2011", "authors": "Baba A, Ohtake F, Okuno Y, Yokota K, Okada M, Imai Y, Ni M, Meyer CA, Igarashi K, Kanno J, Brown M, Kato S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "21532585", "url": "https://glygen.org/publication/PubMed/21532585" } ] }, { "title": "Interaction of high-molecular-weight kininogen with endothelial cell binding proteins suPAR, gC1qR and cytokeratin 1 determined by surface plasmon resonance (BiaCore).", "journal": "Thrombosis and haemostasis", "date": "2011-06", "authors": "Pixley R A, Espinola R G, Ghebrehiwet B, Joseph K, Kao A, Bdeir K, Cines D B, Colman R W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "21544310", "url": "https://glygen.org/publication/PubMed/21544310" } ] }, { "title": "Modulation of microRNA expression in human T-cell development: targeting of NOTCH3 by miR-150.", "journal": "Blood", "date": "2011", "authors": "Ghisi M, Corradin A, Basso K, Frasson C, Serafin V, Mukherjee S, Mussolin L, Ruggero K, Bonanno L, Guffanti A, De Bellis G, Gerosa G, Stellin G, D'Agostino DM, Basso G, Bronte V, Indraccolo S, Amadori A, Zanovello P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21551231", "url": "https://glygen.org/publication/PubMed/21551231" } ] }, { "title": "Assembly of the human origin recognition complex occurs through independent nuclear localization of its components.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ghosh S, Vassilev AP, Zhang J, Zhao Y, DePamphilis ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "21555516", "url": "https://glygen.org/publication/PubMed/21555516" } ] }, { "title": "The chromatin remodelling complex B-WICH changes the chromatin structure and recruits histone acetyl-transferases to active rRNA genes.", "journal": "PloS one", "date": "2011", "authors": "Vintermist A, Bohm S, Sadeghifar F, Louvet E, Mansen A, Percipalle P, Ostlund Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "21559432", "url": "https://glygen.org/publication/PubMed/21559432" } ] }, { "title": "Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.", "journal": "Developmental cell", "date": "2011", "authors": "Tijssen MR, Cvejic A, Joshi A, Hannah RL, Ferreira R, Forrai A, Bellissimo DC, Oram SH, Smethurst PA, Wilson NK, Wang X, Ottersbach K, Stemple DL, Green AR, Ouwehand WH, Gottgens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "21571218", "url": "https://glygen.org/publication/PubMed/21571218" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Romidepsin (Istodax, NSC 630176, FR901228, FK228, depsipeptide): a natural product recently approved for cutaneous T-cell lymphoma.", "journal": "The Journal of antibiotics", "date": "2011", "authors": "VanderMolen KM, McCulloch W, Pearce CJ, Oberlies NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "21587264", "url": "https://glygen.org/publication/PubMed/21587264" } ] }, { "title": "Transcriptional regulation by miRNA mimics that target sequences downstream of gene termini.", "journal": "Molecular bioSystems", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21589992", "url": "https://glygen.org/publication/PubMed/21589992" } ] }, { "title": "Control of vertebrate multiciliogenesis by miR-449 through direct repression of the Delta/Notch pathway.", "journal": "Nature cell biology", "date": "2011", "authors": "Marcet B, Chevalier B, Luxardi G, Coraux C, Zaragosi LE, Cibois M, Robbe-Sermesant K, Jolly T, Cardinaud B, Moreilhon C, Giovannini-Chami L, Nawrocki-Raby B, Birembaut P, Waldmann R, Kodjabachian L, Barbry P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21602795", "url": "https://glygen.org/publication/PubMed/21602795" } ] }, { "title": "SWI/SNF nucleosome remodellers and cancer.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Wilson BG, Roberts CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "21654818", "url": "https://glygen.org/publication/PubMed/21654818" } ] }, { "title": "Heparan sulfate proteoglycans.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Sarrazin S, Lamanna WC, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "21690215", "url": "https://glygen.org/publication/PubMed/21690215" } ] }, { "title": "Dynamic CpG island methylation landscape in oocytes and preimplantation embryos.", "journal": "Nature genetics", "date": "2011", "authors": "Smallwood SA, Tomizawa S, Krueger F, Ruf N, Carli N, Segonds-Pichon A, Sato S, Hata K, Andrews SR, Kelsey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21706000", "url": "https://glygen.org/publication/PubMed/21706000" } ] }, { "title": "Down-regulation of the RUNX1-target gene NR4A3 contributes to hematopoiesis deregulation in familial platelet disorder/acute myelogenous leukemia.", "journal": "Blood", "date": "2011", "authors": "Bluteau D, Gilles L, Hilpert M, Antony-Debre I, James C, Debili N, Camara-Clayette V, Wagner-Ballon O, Cordette-Lagarde V, Robert T, Ripoche H, Gonin P, Swierczek S, Prchal J, Vainchenker W, Favier R, Raslova H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21725049", "url": "https://glygen.org/publication/PubMed/21725049" } ] }, { "title": "SHP2 tyrosine phosphatase converts parafibromin/Cdc73 from a tumor suppressor to an oncogenic driver.", "journal": "Molecular cell", "date": "2011", "authors": "Takahashi A, Tsutsumi R, Kikuchi I, Obuse C, Saito Y, Seidi A, Karisch R, Fernandez M, Cho T, Ohnishi N, Rozenblatt-Rosen O, Meyerson M, Neel BG, Hatakeyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "21726809", "url": "https://glygen.org/publication/PubMed/21726809" } ] }, { "title": "Methylation of H2AR29 is a novel repressive PRMT6 target.", "journal": "Epigenetics & chromatin", "date": "2011", "authors": "Waldmann T, Izzo A, Kamieniarz K, Richter F, Vogler C, Sarg B, Lindner H, Young NL, Mittler G, Garcia BA, Schneider R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21774791", "url": "https://glygen.org/publication/PubMed/21774791" } ] }, { "title": "PHD finger recognition of unmodified histone H3R2 links UHRF1 to regulation of euchromatic gene expression.", "journal": "Molecular cell", "date": "2011", "authors": "Rajakumara E, Wang Z, Ma H, Hu L, Chen H, Lin Y, Guo R, Wu F, Li H, Lan F, Shi YG, Xu Y, Patel DJ, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21777816", "url": "https://glygen.org/publication/PubMed/21777816" } ] }, { "title": "Structural and functional profiling of the human histone methyltransferase SMYD3.", "journal": "PloS one", "date": "2011", "authors": "Foreman KW, Brown M, Park F, Emtage S, Harriss J, Das C, Zhu L, Crew A, Arnold L, Shaaban S, Tucker P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21779408", "url": "https://glygen.org/publication/PubMed/21779408" } ] }, { "title": "Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.", "journal": "Cell research", "date": "2011", "authors": "Wang C, Shen J, Yang Z, Chen P, Zhao B, Hu W, Lan W, Tong X, Wu H, Li G, Cao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21808299", "url": "https://glygen.org/publication/PubMed/21808299" } ] }, { "title": "Crystal structure of PHD domain of UHRF1 and insights into recognition of unmodified histone H3 arginine residue 2.", "journal": "Cell research", "date": "2011", "authors": "Hu L, Li Z, Wang P, Lin Y, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21808300", "url": "https://glygen.org/publication/PubMed/21808300" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Activation of interleukin-6 gene expression through the NF-kappa B transcription factor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Libermann TA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2183031", "url": "https://glygen.org/publication/PubMed/2183031" } ] }, { "title": "Histone methyltransferase SETD3 regulates muscle differentiation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Eom GH, Kim KB, Kim JH, Kim JY, Kim JR, Kee HJ, Kim DW, Choe N, Park HJ, Son HJ, Choi SY, Kook H, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "21832073", "url": "https://glygen.org/publication/PubMed/21832073" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Notch signaling inhibits hepatocellular carcinoma following inactivation of the RB pathway.", "journal": "The Journal of experimental medicine", "date": "2011", "authors": "Viatour P, Ehmer U, Saddic LA, Dorrell C, Andersen JB, Lin C, Zmoos AF, Mazur PK, Schaffer BE, Ostermeier A, Vogel H, Sylvester KG, Thorgeirsson SS, Grompe M, Sage J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "21875955", "url": "https://glygen.org/publication/PubMed/21875955" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "Mitochondrial GTP-AMP phosphotransferase. 2. Kinetic and equilibrium dialysis studies.", "journal": "European journal of biochemistry", "date": "1979", "authors": "Tomasselli AG, Noda LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "218813", "url": "https://glygen.org/publication/PubMed/218813" } ] }, { "title": "Modification of histones by sugar beta-N-acetylglucosamine (GlcNAc) occurs on multiple residues, including histone H3 serine 10, and is cell cycle-regulated.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhang S, Roche K, Nasheuer HP, Lowndes NF", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" }, { "database": "O-GlcNAc Atlas", "id": "P68431", "url": "https://oglcnac.org/atlas/detail/P68431" }, { "database": "GlyConnect", "id": "2886", "url": "https://glyconnect.expasy.org/browser/proteins/2886" } ], "reference": [ { "type": "PubMed", "id": "21896475", "url": "https://glygen.org/publication/PubMed/21896475" } ] }, { "title": "CHD6 chromatin remodeler is a negative modulator of influenza virus replication that relocates to inactive chromatin upon infection.", "journal": "Cellular microbiology", "date": "2011", "authors": "Alfonso R, Lutz T, Rodriguez A, Chavez JP, Rodriguez P, Gutierrez S, Nieto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "21899694", "url": "https://glygen.org/publication/PubMed/21899694" } ] }, { "title": "MCPH1 regulates chromosome condensation and shaping as a composite modulator of condensin II.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Yamashita D, Shintomi K, Ono T, Gavvovidis I, Schindler D, Neitzel H, Trimborn M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "21911480", "url": "https://glygen.org/publication/PubMed/21911480" } ] }, { "title": "A physical interaction network of dengue virus and human proteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Khadka S, Vangeloff AD, Zhang C, Siddavatam P, Heaton NS, Wang L, Sengupta R, Sahasrabudhe S, Randall G, Gribskov M, Kuhn RJ, Perera R, LaCount DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "21911577", "url": "https://glygen.org/publication/PubMed/21911577" } ] }, { "title": "Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.", "journal": "Cell", "date": "2011", "authors": "Tan M, Luo H, Lee S, Jin F, Yang JS, Montellier E, Buchou T, Cheng Z, Rousseaux S, Rajagopal N, Lu Z, Ye Z, Zhu Q, Wysocka J, Ye Y, Khochbin S, Ren B, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "21925322", "url": "https://glygen.org/publication/PubMed/21925322" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "Control of the senescence-associated secretory phenotype by NF-kappaB promotes senescence and enhances chemosensitivity.", "journal": "Genes & development", "date": "2011", "authors": "Chien Y, Scuoppo C, Wang X, Fang X, Balgley B, Bolden JE, Premsrirut P, Luo W, Chicas A, Lee CS, Kogan SC, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "21979375", "url": "https://glygen.org/publication/PubMed/21979375" } ] }, { "title": "Oligomerization of DNMT3A controls the mechanism of de novo DNA methylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Holz-Schietinger C, Matje DM, Harrison MF, Reich NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "21979949", "url": "https://glygen.org/publication/PubMed/21979949" } ] }, { "title": "Regulation of MDM2 E3 ligase activity by phosphorylation after DNA damage.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Cheng Q, Cross B, Li B, Chen L, Li Z, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "21986495", "url": "https://glygen.org/publication/PubMed/21986495" } ] }, { "title": "The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.", "journal": "Leukemia research", "date": "2012", "authors": "Diakiw SM, Kok CH, To LB, Lewis ID, Brown AL, D'Andrea RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21993314", "url": "https://glygen.org/publication/PubMed/21993314" } ] }, { "title": "The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.", "journal": "Blood", "date": "2011", "authors": "Huang G, Zhao X, Wang L, Elf S, Xu H, Zhao X, Sashida G, Zhang Y, Liu Y, Lee J, Menendez S, Yang Y, Yan X, Zhang P, Tenen DG, Osato M, Hsieh JJ, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "22012064", "url": "https://glygen.org/publication/PubMed/22012064" } ] }, { "title": "Loss of the candidate tumor suppressor BTG3 triggers acute cellular senescence via the ERK-JMJD3-p16(INK4a) signaling axis.", "journal": "Oncogene", "date": "2012", "authors": "Lin TY, Cheng YC, Yang HC, Lin WC, Wang CC, Lai PL, Shieh SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22020331", "url": "https://glygen.org/publication/PubMed/22020331" } ] }, { "title": "Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.", "journal": "PloS one", "date": "2011", "authors": "Li Jing, Li Zhihong, Ruan Jianbin, Xu Chao, Tong Yufeng, Pan Patricia W, Tempel Wolfram, Crombet Lissete, Min Jinrong, Zang Jianye", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "22022377", "url": "https://glygen.org/publication/PubMed/22022377" } ] }, { "title": "Human RNA polymerase II-association factor 1 (hPaf1/PD2) regulates histone methylation and chromatin remodeling in pancreatic cancer.", "journal": "PloS one", "date": "2011", "authors": "Dey P, Ponnusamy MP, Deb S, Batra SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "22046413", "url": "https://glygen.org/publication/PubMed/22046413" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "S phase-dependent interaction with DNMT1 dictates the role of UHRF1 but not UHRF2 in DNA methylation maintenance.", "journal": "Cell research", "date": "2011", "authors": "Zhang J, Gao Q, Li P, Liu X, Jia Y, Wu W, Li J, Dong S, Koseki H, Wong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "22064703", "url": "https://glygen.org/publication/PubMed/22064703" } ] }, { "title": "Direct evidence of nuclear Argonaute distribution during transcriptional silencing links the actin cytoskeleton to nuclear RNAi machinery in human cells.", "journal": "Nucleic acids research", "date": "2012", "authors": "Ahlenstiel CL, Lim HG, Cooper DA, Ishida T, Kelleher AD, Suzuki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22064859", "url": "https://glygen.org/publication/PubMed/22064859" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "NSD2 links dimethylation of histone H3 at lysine 36 to oncogenic programming.", "journal": "Molecular cell", "date": "2011", "authors": "Kuo AJ, Cheung P, Chen K, Zee BM, Kioi M, Lauring J, Xi Y, Park BH, Shi X, Garcia BA, Li W, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "22099308", "url": "https://glygen.org/publication/PubMed/22099308" } ] }, { "title": "Jarid2 (Jumonji, AT rich interactive domain 2) regulates NOTCH1 expression via histone modification in the developing heart.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Mysliwiec MR, Carlson CD, Tietjen J, Hung H, Ansari AZ, Lee Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "22110129", "url": "https://glygen.org/publication/PubMed/22110129" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "Akt2 interacts with Snail1 in the E-cadherin promoter.", "journal": "Oncogene", "date": "2012", "authors": "Villagrasa P, Diaz VM, Vinas-Castells R, Peiro S, Del Valle-Perez B, Dave N, Rodriguez-Asiain A, Casal JI, Lizcano JM, Dunach M, Garcia de Herreros A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "22158034", "url": "https://glygen.org/publication/PubMed/22158034" } ] }, { "title": "The human cytomegalovirus UL11 protein interacts with the receptor tyrosine phosphatase CD45, resulting in functional paralysis of T cells.", "journal": "PLoS pathogens", "date": "2011", "authors": "Gabaev I, Steinbruck L, Pokoyski C, Pich A, Stanton RJ, Schwinzer R, Schulz TF, Jacobs R, Messerle M, Kay-Fedorov PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "22174689", "url": "https://glygen.org/publication/PubMed/22174689" } ] }, { "title": "DNA damage signaling triggers degradation of histone methyltransferases through APC/C(Cdh1) in senescent cells.", "journal": "Molecular cell", "date": "2012", "authors": "Takahashi A, Imai Y, Yamakoshi K, Kuninaka S, Ohtani N, Yoshimoto S, Hori S, Tachibana M, Anderton E, Takeuchi T, Shinkai Y, Peters G, Saya H, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22178396", "url": "https://glygen.org/publication/PubMed/22178396" } ] }, { "title": "Pygo2 regulates histone gene expression and H3 K56 acetylation in human mammary epithelial cells.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Gu B, Watanabe K, Dai X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22186018", "url": "https://glygen.org/publication/PubMed/22186018" } ] }, { "title": "Probing transcription-specific outputs of beta-catenin in vivo.", "journal": "Genes & development", "date": "2011", "authors": "Valenta T, Gay M, Steiner S, Draganova K, Zemke M, Hoffmans R, Cinelli P, Aguet M, Sommer L, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22190459", "url": "https://glygen.org/publication/PubMed/22190459" } ] }, { "title": "A specific function for the histone chaperone NASP to fine-tune a reservoir of soluble H3-H4 in the histone supply chain.", "journal": "Mol. Cell", "date": "2011", "authors": "Cook Adam J L, Gurard-Levin Zachary A, Vassias Isabelle, Almouzni Genevi\u00e8ve", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "22195965", "url": "https://glygen.org/publication/PubMed/22195965" } ] }, { "title": "Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Migliori V, Muller J, Phalke S, Low D, Bezzi M, Mok WC, Sahu SK, Gunaratne J, Capasso P, Bassi C, Cecatiello V, De Marco A, Blackstock W, Kuznetsov V, Amati B, Mapelli M, Guccione E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "22231400", "url": "https://glygen.org/publication/PubMed/22231400" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Somatic histone H3 alterations in pediatric diffuse intrinsic pontine gliomas and non-brainstem glioblastomas.", "journal": "Nature genetics", "date": "2012", "authors": "Wu G, Broniscer A, McEachron TA, Lu C, Paugh BS, Becksfort J, Qu C, Ding L, Huether R, Parker M, Zhang J, Gajjar A, Dyer MA, Mullighan CG, Gilbertson RJ, Mardis ER, Wilson RK, Downing JR, Ellison DW, Zhang J, Baker SJ", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "22286216", "url": "https://glygen.org/publication/PubMed/22286216" } ] }, { "title": "Mutation of A677 in histone methyltransferase EZH2 in human B-cell lymphoma promotes hypertrimethylation of histone H3 on lysine 27 (H3K27).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "McCabe MT, Graves AP, Ganji G, Diaz E, Halsey WS, Jiang Y, Smitheman KN, Ott HM, Pappalardi MB, Allen KE, Chen SB, Della Pietra A 3rd, Dul E, Hughes AM, Gilbert SA, Thrall SH, Tummino PJ, Kruger RG, Brandt M, Schwartz B, Creasy CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "22323599", "url": "https://glygen.org/publication/PubMed/22323599" } ] }, { "title": "PCGF homologs, CBX proteins, and RYBP define functionally distinct PRC1 family complexes.", "journal": "Molecular cell", "date": "2012", "authors": "Gao Z, Zhang J, Bonasio R, Strino F, Sawai A, Parisi F, Kluger Y, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22325352", "url": "https://glygen.org/publication/PubMed/22325352" } ] }, { "title": "Regulation of p14ARF expression by miR-24: a potential mechanism compromising the p53 response during retinoblastoma development.", "journal": "BMC cancer", "date": "2012", "authors": "To KH, Pajovic S, Gallie BL, Theriault BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22336108", "url": "https://glygen.org/publication/PubMed/22336108" } ] }, { "title": "Kinetics of DNA methylation inheritance by the Dnmt1-including complexes during the cell cycle.", "journal": "Cell division", "date": "2012", "authors": "Hervouet E, Nadaradjane A, Gueguen M, Vallette FM, Cartron PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "22348533", "url": "https://glygen.org/publication/PubMed/22348533" } ] }, { "title": "Overexpression of wild-type or mutants forms of CEBPA alter normal human hematopoiesis.", "journal": "Leukemia", "date": "2012", "authors": "Quintana-Bustamante O, Lan-Lan Smith S, Griessinger E, Reyal Y, Vargaftig J, Lister TA, Fitzgibbon J, Bonnet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22371011", "url": "https://glygen.org/publication/PubMed/22371011" } ] }, { "title": "beta-N-Acetylglucosamine (O-GlcNAc) is a novel regulator of mitosis-specific phosphorylations on histone H3.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Fong JJ, Nguyen BL, Bridger R, Medrano EE, Wells L, Pan S, Sifers RN", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" }, { "database": "O-GlcNAc Atlas", "id": "P68431", "url": "https://oglcnac.org/atlas/detail/P68431" } ], "reference": [ { "type": "PubMed", "id": "22371497", "url": "https://glygen.org/publication/PubMed/22371497" } ] }, { "title": "Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.", "journal": "Molecular cell", "date": "2012", "authors": "Yu Y, Song C, Zhang Q, DiMaggio PA, Garcia BA, York A, Carey MF, Grunstein M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "22387026", "url": "https://glygen.org/publication/PubMed/22387026" } ] }, { "title": "Lysine succinylation and lysine malonylation in histones.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Xie Z, Dai J, Dai L, Tan M, Cheng Z, Wu Y, Boeke JD, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "22389435", "url": "https://glygen.org/publication/PubMed/22389435" } ] }, { "title": "The BAH domain of ORC1 links H4K20me2 to DNA replication licensing and Meier-Gorlin syndrome.", "journal": "Nature", "date": "2012", "authors": "Kuo AJ, Song J, Cheung P, Ishibe-Murakami S, Yamazoe S, Chen JK, Patel DJ, Gozani O", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "22398447", "url": "https://glygen.org/publication/PubMed/22398447" } ] }, { "title": "Studies of H3K4me3 demethylation by KDM5B/Jarid1B/PLU1 reveals strong substrate recognition in vitro and identifies 2,4-pyridine-dicarboxylic acid as an in vitro and in cell inhibitor.", "journal": "The FEBS journal", "date": "2012-06", "authors": "Kristensen Line H, Nielsen Anders L, Helgstrand Charlotte, Lees Michael, Cloos Paul, Kastrup Jette S, Helin Kristian, Olsen Lars, Gajhede Michael", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "22420752", "url": "https://glygen.org/publication/PubMed/22420752" } ] }, { "title": "Secreted HLA recapitulates the immunopeptidome and allows in-depth coverage of HLA A*02:01 ligands.", "journal": "Molecular immunology", "date": "2012-06", "authors": "Scull Katherine E, Dudek Nadine L, Corbett Alexandra J, Ramarathinam Sri H, Gorasia Dhana G, Williamson Nicholas A, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "489132", "url": "https://www.iedb.org/epitope/489132" } ], "reference": [ { "type": "PubMed", "id": "22424782", "url": "https://glygen.org/publication/PubMed/22424782" } ] }, { "title": "A role for small RNAs in DNA double-strand break repair.", "journal": "Cell", "date": "2012", "authors": "Wei W, Ba Z, Gao M, Wu Y, Ma Y, Amiard S, White CI, Rendtlew Danielsen JM, Yang YG, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22445173", "url": "https://glygen.org/publication/PubMed/22445173" } ] }, { "title": "Histone recognition and large-scale structural analysis of the human bromodomain family.", "journal": "Cell", "date": "2012", "authors": "Filippakopoulos P, Picaud S, Mangos M, Keates T, Lambert JP, Barsyte-Lovejoy D, Felletar I, Volkmer R, Muller S, Pawson T, Gingras AC, Arrowsmith CH, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "22464331", "url": "https://glygen.org/publication/PubMed/22464331" } ] }, { "title": "Sequential ChIP-bisulfite sequencing enables direct genome-scale investigation of chromatin and DNA methylation cross-talk.", "journal": "Genome research", "date": "2012", "authors": "Brinkman AB, Gu H, Bartels SJ, Zhang Y, Matarese F, Simmer F, Marks H, Bock C, Gnirke A, Meissner A, Stunnenberg HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "22466170", "url": "https://glygen.org/publication/PubMed/22466170" } ] }, { "title": "C/EBPalpha and DEK coordinately regulate myeloid differentiation.", "journal": "Blood", "date": "2012", "authors": "Koleva RI, Ficarro SB, Radomska HS, Carrasco-Alfonso MJ, Alberta JA, Webber JT, Luckey CJ, Marcucci G, Tenen DG, Marto JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22474248", "url": "https://glygen.org/publication/PubMed/22474248" } ] }, { "title": "Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.", "journal": "Mol. Cell", "date": "2012", "authors": "Herranz Nicol\u00e1s, Dave Nat\u00e0lia, Millanes-Romero Alba, Morey Lluis, D\u00edaz V\u00edctor M, L\u00f3renz-Fonfr\u00eda V\u00edctor, Gutierrez-Gallego Ricardo, Jer\u00f3nimo Celia, Di Croce Luciano, Garc\u00eda de Herreros Antonio, Peir\u00f3 Sandra", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "22483618", "url": "https://glygen.org/publication/PubMed/22483618" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "Chd2 interacts with H3.3 to determine myogenic cell fate.", "journal": "The EMBO journal", "date": "2012", "authors": "Harada A, Okada S, Konno D, Odawara J, Yoshimi T, Yoshimura S, Kumamaru H, Saiwai H, Tsubota T, Kurumizaka H, Akashi K, Tachibana T, Imbalzano AN, Ohkawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "22569126", "url": "https://glygen.org/publication/PubMed/22569126" } ] }, { "title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.", "journal": "Nature communications", "date": "2012", "authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22569366", "url": "https://glygen.org/publication/PubMed/22569366" } ] }, { "title": "KDM3B is the H3K9 demethylase involved in transcriptional activation of lmo2 in leukemia.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Kim JY, Kim KB, Eom GH, Choe N, Kee HJ, Son HJ, Oh ST, Kim DW, Pak JH, Baek HJ, Kook H, Hahn Y, Kook H, Chakravarti D, Seo SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "22615488", "url": "https://glygen.org/publication/PubMed/22615488" } ] }, { "title": "The many faces and functions of beta-catenin.", "journal": "The EMBO journal", "date": "2012", "authors": "Valenta T, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22617422", "url": "https://glygen.org/publication/PubMed/22617422" } ] }, { "title": "A polymorphism in the upstream regulatory region of the interleukin-1alpha gene confers differential binding by transcription factors of the AP-1 family.", "journal": "Life sciences", "date": "2012", "authors": "Moerman-Herzog AM, Barger SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22634325", "url": "https://glygen.org/publication/PubMed/22634325" } ] }, { "title": "Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.", "journal": "Cell", "date": "2012", "authors": "Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J, Hentze MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "22658674", "url": "https://glygen.org/publication/PubMed/22658674" } ] }, { "title": "The mitochondrial pathway and reactive oxygen species are critical contributors to interferon-alpha/beta-mediated apoptosis in Ubp43-deficient hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Yim HY, Yang Y, Lim JS, Lee MS, Zhang DE, Kim KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "22683641", "url": "https://glygen.org/publication/PubMed/22683641" } ] }, { "title": "CBX3 regulates efficient RNA processing genome-wide.", "journal": "Genome research", "date": "2012", "authors": "Smallwood A, Hon GC, Jin F, Henry RE, Espinosa JM, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-427389", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389" } ], "reference": [ { "type": "PubMed", "id": "22684280", "url": "https://glygen.org/publication/PubMed/22684280" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Li Q, Zhu F, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22705304", "url": "https://glygen.org/publication/PubMed/22705304" } ] }, { "title": "Site-specific DICER and DROSHA RNA products control the DNA-damage response.", "journal": "Nature", "date": "2012", "authors": "Francia S, Michelini F, Saxena A, Tang D, de Hoon M, Anelli V, Mione M, Carninci P, d'Adda di Fagagna F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22722852", "url": "https://glygen.org/publication/PubMed/22722852" } ] }, { "title": "Unraveling cell type-specific and reprogrammable human replication origin signatures associated with G-quadruplex consensus motifs.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Besnard E, Babled A, Lapasset L, Milhavet O, Parrinello H, Dantec C, Marin JM, Lemaitre JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "22751019", "url": "https://glygen.org/publication/PubMed/22751019" } ] }, { "title": "Histone arginine methylation keeps RUNX1 target genes in an intermediate state.", "journal": "Oncogene", "date": "2013", "authors": "Herglotz J, Kuvardina ON, Kolodziej S, Kumar A, Hussong H, Grez M, Lausen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "22777353", "url": "https://glygen.org/publication/PubMed/22777353" } ] }, { "title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.", "journal": "PloS one", "date": "2012", "authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22879880", "url": "https://glygen.org/publication/PubMed/22879880" } ] }, { "title": "Core transcriptional regulatory circuit controlled by the TAL1 complex in human T cell acute lymphoblastic leukemia.", "journal": "Cancer cell", "date": "2012", "authors": "Sanda T, Lawton LN, Barrasa MI, Fan ZP, Kohlhammer H, Gutierrez A, Ma W, Tatarek J, Ahn Y, Kelliher MA, Jamieson CH, Staudt LM, Young RA, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "22897851", "url": "https://glygen.org/publication/PubMed/22897851" } ] }, { "title": "PKM2 phosphorylates histone H3 and promotes gene transcription and tumorigenesis.", "journal": "Cell", "date": "2012", "authors": "Yang W, Xia Y, Hawke D, Li X, Liang J, Xing D, Aldape K, Hunter T, Alfred Yung WK, Lu Z", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" } ], "reference": [ { "type": "PubMed", "id": "22901803", "url": "https://glygen.org/publication/PubMed/22901803" } ] }, { "title": "Chromatin remodelers Isw1 and Chd1 maintain chromatin structure during transcription by preventing histone exchange.", "journal": "Nature structural & molecular biology", "date": "2012-09", "authors": "Smolle Michaela, Venkatesh Swaminathan, Gogol Madelaine M, Li Hua, Zhang Ying, Florens Laurence, Washburn Michael P, Workman Jerry L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "22922743", "url": "https://glygen.org/publication/PubMed/22922743" } ] }, { "title": "Prdm3 and Prdm16 are H3K9me1 methyltransferases required for mammalian heterochromatin integrity.", "journal": "Cell", "date": "2012", "authors": "Pinheiro I, Margueron R, Shukeir N, Eisold M, Fritzsch C, Richter FM, Mittler G, Genoud C, Goyama S, Kurokawa M, Son J, Reinberg D, Lachner M, Jenuwein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841" } ], "reference": [ { "type": "PubMed", "id": "22939622", "url": "https://glygen.org/publication/PubMed/22939622" } ] }, { "title": "Argonaute proteins couple chromatin silencing to alternative splicing.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Ameyar-Zazoua M, Rachez C, Souidi M, Robin P, Fritsch L, Young R, Morozova N, Fenouil R, Descostes N, Andrau JC, Mathieu J, Hamiche A, Ait-Si-Ali S, Muchardt C, Batsche E, Harel-Bellan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22961379", "url": "https://glygen.org/publication/PubMed/22961379" } ] }, { "title": "The many roles of the conserved eukaryotic Paf1 complex in regulating transcription, histone modifications, and disease states.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Tomson BN, Arndt KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "22982193", "url": "https://glygen.org/publication/PubMed/22982193" } ] }, { "title": "Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.", "journal": "Nature medicine", "date": "2012", "authors": "Skokowa J, Klimiankou M, Klimenkova O, Lan D, Gupta K, Hussein K, Carrizosa E, Kusnetsova I, Li Z, Sustmann C, Ganser A, Zeidler C, Kreipe HH, Burkhardt J, Grosschedl R, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "23001182", "url": "https://glygen.org/publication/PubMed/23001182" } ] }, { "title": "Association of UHRF1 with methylated H3K9 directs the maintenance of DNA methylation.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Rothbart SB, Krajewski K, Nady N, Tempel W, Xue S, Badeaux AI, Barsyte-Lovejoy D, Martinez JY, Bedford MT, Fuchs SM, Arrowsmith CH, Strahl BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "23022729", "url": "https://glygen.org/publication/PubMed/23022729" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "Human TNRC6A is an Argonaute-navigator protein for microRNA-mediated gene silencing in the nucleus.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Nishi K, Nishi A, Nagasawa T, Ui-Tei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23150874", "url": "https://glygen.org/publication/PubMed/23150874" } ] }, { "title": "Structural insight into coordinated recognition of trimethylated histone H3 lysine 9 (H3K9me3) by the plant homeodomain (PHD) and tandem tudor domain (TTD) of UHRF1 (ubiquitin-like, containing PHD and RING finger domains, 1) protein.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Cheng J, Yang Y, Fang J, Xiao J, Zhu T, Chen F, Wang P, Li Z, Yang H, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "23161542", "url": "https://glygen.org/publication/PubMed/23161542" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Cloning of the human and murine interleukin-7 receptors: demonstration of a soluble form and homology to a new receptor superfamily.", "journal": "Cell", "date": "1990", "authors": "Goodwin RG, Friend D, Ziegler SF, Jerzy R, Falk BA, Gimpel S, Cosman D, Dower SK, March CJ, Namen AE, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "2317865", "url": "https://glygen.org/publication/PubMed/2317865" } ] }, { "title": "Genome-wide mapping of human DNA-replication origins: levels of transcription at ORC1 sites regulate origin selection and replication timing.", "journal": "Genome research", "date": "2013", "authors": "Dellino GI, Cittaro D, Piccioni R, Luzi L, Banfi S, Segalla S, Cesaroni M, Mendoza-Maldonado R, Giacca M, Pelicci PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "23187890", "url": "https://glygen.org/publication/PubMed/23187890" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.", "journal": "Cancer letters", "date": "2013", "authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23219899", "url": "https://glygen.org/publication/PubMed/23219899" } ] }, { "title": "Unique features of the anti-parallel, heterodimeric coiled-coil interaction between methyl-cytosine binding domain 2 (MBD2) homologues and GATA zinc finger domain containing 2A (GATAD2A/p66alpha).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Walavalkar NM, Gordon N, Williams DC Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "23239876", "url": "https://glygen.org/publication/PubMed/23239876" } ] }, { "title": "Identification and characterization of FAM124B as a novel component of a CHD7 and CHD8 containing complex.", "journal": "PloS one", "date": "2012", "authors": "Batsukh T, Schulz Y, Wolf S, Rabe TI, Oellerich T, Urlaub H, Schaefer IM, Pauli S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "23285124", "url": "https://glygen.org/publication/PubMed/23285124" } ] }, { "title": "Nucleolar transcription factor hUBF contains a DNA-binding motif with homology to HMG proteins.", "journal": "Nature", "date": "1990", "authors": "Jantzen HM, Admon A, Bell SP, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73728", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728" } ], "reference": [ { "type": "PubMed", "id": "2330041", "url": "https://glygen.org/publication/PubMed/2330041" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Coordinate regulation of DNA methylation and H3K27me3 in mouse embryonic stem cells.", "journal": "PloS one", "date": "2013", "authors": "Hagarman JA, Motley MP, Kristjansdottir K, Soloway PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "23326524", "url": "https://glygen.org/publication/PubMed/23326524" } ] }, { "title": "Differential roles for MBD2 and MBD3 at methylated CpG islands, active promoters and binding to exon sequences.", "journal": "Nucleic acids research", "date": "2013-03-01", "authors": "G\u00fcnther Katharina, Rust Mareike, Leers Joerg, Boettger Thomas, Scharfe Maren, Jarek Michael, Bartkuhn Marek, Renkawitz Rainer", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "23361464", "url": "https://glygen.org/publication/PubMed/23361464" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "CHD6, a cellular repressor of influenza virus replication, is degraded in human alveolar epithelial cells and mice lungs during infection.", "journal": "Journal of virology", "date": "2013", "authors": "Alfonso R, Rodriguez A, Rodriguez P, Lutz T, Nieto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "23408615", "url": "https://glygen.org/publication/PubMed/23408615" } ] }, { "title": "Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.", "journal": "Cell", "date": "2013", "authors": "Tropberger P, Pott S, Keller C, Kamieniarz-Gdula K, Caron M, Richter F, Li G, Mittler G, Liu ET, Buhler M, Margueron R, Schneider R", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "23415232", "url": "https://glygen.org/publication/PubMed/23415232" } ] }, { "title": "Noncoding RNA and Polycomb recruitment.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Brockdorff N", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "23431328", "url": "https://glygen.org/publication/PubMed/23431328" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "ZEB2 zinc-finger missense mutations lead to hypomorphic alleles and a mild Mowat-Wilson syndrome.", "journal": "Human molecular genetics", "date": "2013-07-01", "authors": "Ghoumid Jamal, Drevillon Lo\u00efc, Alavi-Naini Seyedeh Maryam, Bondurand Nad\u00e8ge, Rio Marl\u00e8ne, Briand-Suleau Audrey, Nasser Mayssa, Goodwin Linda, Raymond Patrick, Yanicostas Constantin, Goossens Michel, Lyonnet Stanislas, Mowat David, Amiel Jeanne, Soussi-Yanicostas Nadia, Giurgea Irina", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "23466526", "url": "https://glygen.org/publication/PubMed/23466526" } ] }, { "title": "Characterisation of retinoblastomas without RB1 mutations: genomic, gene expression, and clinical studies.", "journal": "The Lancet. Oncology", "date": "2013", "authors": "Rushlow DE, Mol BM, Kennett JY, Yee S, Pajovic S, Theriault BL, Prigoda-Lee NL, Spencer C, Dimaras H, Corson TW, Pang R, Massey C, Godbout R, Jiang Z, Zacksenhaus E, Paton K, Moll AC, Houdayer C, Raizis A, Halliday W, Lam WL, Boutros PC, Lohmann D, Dorsman JC, Gallie BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2299718", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718" } ], "reference": [ { "type": "PubMed", "id": "23498719", "url": "https://glygen.org/publication/PubMed/23498719" } ] }, { "title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2013", "authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23534758", "url": "https://glygen.org/publication/PubMed/23534758" } ] }, { "title": "Nuclear myosin 1c facilitates the chromatin modifications required to activate rRNA gene transcription and cell cycle progression.", "journal": "PLoS genetics", "date": "2013", "authors": "Sarshad A, Sadeghifar F, Louvet E, Mori R, Bohm S, Al-Muzzaini B, Vintermist A, Fomproix N, Ostlund AK, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "23555303", "url": "https://glygen.org/publication/PubMed/23555303" } ] }, { "title": "The histone H3.3K27M mutation in pediatric glioma reprograms H3K27 methylation and gene expression.", "journal": "Genes & development", "date": "2013", "authors": "Chan KM, Fang D, Gan H, Hashizume R, Yu C, Schroeder M, Gupta N, Mueller S, James CD, Jenkins R, Sarkaria J, Zhang Z", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "23603901", "url": "https://glygen.org/publication/PubMed/23603901" } ] }, { "title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23630040", "url": "https://glygen.org/publication/PubMed/23630040" } ] }, { "title": "The chromatin remodeling factor CSB recruits histone acetyltransferase PCAF to rRNA gene promoters in active state for transcription initiation.", "journal": "PloS one", "date": "2013", "authors": "Shen M, Zhou T, Xie W, Ling T, Zhu Q, Zong L, Lyu G, Gao Q, Zhang F, Tao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "23667505", "url": "https://glygen.org/publication/PubMed/23667505" } ] }, { "title": "Convergent evolution of chromatin modification by structurally distinct enzymes: comparative enzymology of histone H3 Lys(2)(7) methylation by human polycomb repressive complex 2 and vSET.", "journal": "The Biochemical journal", "date": "2013", "authors": "Swalm BM, Hallenbeck KK, Majer CR, Jin L, Scott MP, Moyer MP, Copeland RA, Wigle TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "23679895", "url": "https://glygen.org/publication/PubMed/23679895" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "Multivalent histone engagement by the linked tandem Tudor and PHD domains of UHRF1 is required for the epigenetic inheritance of DNA methylation.", "journal": "Genes & development", "date": "2013", "authors": "Rothbart SB, Dickson BM, Ong MS, Krajewski K, Houliston S, Kireev DB, Arrowsmith CH, Strahl BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "23752590", "url": "https://glygen.org/publication/PubMed/23752590" } ] }, { "title": "Concerted interaction between origin recognition complex (ORC), nucleosomes and replication origin DNA ensures stable ORC-origin binding.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2013", "authors": "Hizume K, Yagura M, Araki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "23795651", "url": "https://glygen.org/publication/PubMed/23795651" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1alpha by human gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Murakami Y, Watari K, Shibata T, Uba M, Ureshino H, Kawahara A, Abe H, Izumi H, Mukaida N, Kuwano M, Ono M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "23846687", "url": "https://glygen.org/publication/PubMed/23846687" } ] }, { "title": "The double-stranded RNA binding domain of human Dicer functions as a nuclear localization signal.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Doyle M, Badertscher L, Jaskiewicz L, Guttinger S, Jurado S, Hugenschmidt T, Kutay U, Filipowicz W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23882114", "url": "https://glygen.org/publication/PubMed/23882114" } ] }, { "title": "Regulation of SirT1-nucleomethylin binding by rRNA coordinates ribosome biogenesis with nutrient availability.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Yang L, Song T, Chen L, Kabra N, Zheng H, Koomen J, Seto E, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359" } ], "reference": [ { "type": "PubMed", "id": "23897426", "url": "https://glygen.org/publication/PubMed/23897426" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "Human origin recognition complex binds preferentially to G-quadruplex-preferable RNA and single-stranded DNA.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Hoshina S, Yura K, Teranishi H, Kiyasu N, Tominaga A, Kadoma H, Nakatsuka A, Kunichika T, Obuse C, Waga S", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "24003239", "url": "https://glygen.org/publication/PubMed/24003239" } ] }, { "title": "Involvement of a NF-kappa B-like transcription factor in the activation of the interleukin-6 gene by inflammatory lymphokines.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Shimizu H, Mitomo K, Watanabe T, Okamoto S, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2405250", "url": "https://glygen.org/publication/PubMed/2405250" } ] }, { "title": "Dnmt3L antagonizes DNA methylation at bivalent promoters and favors DNA methylation at gene bodies in ESCs.", "journal": "Cell", "date": "2013", "authors": "Neri F, Krepelova A, Incarnato D, Maldotti M, Parlato C, Galvagni F, Matarese F, Stunnenberg HG, Oliviero S", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "24074865", "url": "https://glygen.org/publication/PubMed/24074865" } ] }, { "title": "Ago1 Interacts with RNA polymerase II and binds to the promoters of actively transcribed genes in human cancer cells.", "journal": "PLoS genetics", "date": "2013", "authors": "Huang V, Zheng J, Qi Z, Wang J, Place RF, Yu J, Li H, Li LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24086155", "url": "https://glygen.org/publication/PubMed/24086155" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Hox in motion: tracking HoxA cluster conformation during differentiation.", "journal": "Nucleic acids research", "date": "2014", "authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24174538", "url": "https://glygen.org/publication/PubMed/24174538" } ] }, { "title": "CHD5 is required for spermiogenesis and chromatin condensation.", "journal": "Mechanisms of development", "date": "2014", "authors": "Zhuang T, Hess RA, Kolla V, Higashi M, Raabe TD, Brodeur GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "24252660", "url": "https://glygen.org/publication/PubMed/24252660" } ] }, { "title": "Probing the dynamic distribution of bound states for methylcytosine-binding domains on DNA.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Cramer JM, Scarsdale JN, Walavalkar NM, Buchwald WA, Ginder GD, Williams DC Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "24307175", "url": "https://glygen.org/publication/PubMed/24307175" } ] }, { "title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.", "journal": "PloS one", "date": "2013", "authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24312487", "url": "https://glygen.org/publication/PubMed/24312487" } ] }, { "title": "The UHRF1 protein stimulates the activity and specificity of the maintenance DNA methyltransferase DNMT1 by an allosteric mechanism.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Bashtrykov P, Jankevicius G, Jurkowska RZ, Ragozin S, Jeltsch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5334118", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118" } ], "reference": [ { "type": "PubMed", "id": "24368767", "url": "https://glygen.org/publication/PubMed/24368767" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.", "journal": "International journal of oncology", "date": "2014", "authors": "Iriyama N, Yuan B, Yoshino Y, Hatta Y, Horikoshi A, Aizawa S, Takei M, Takeuchi J, Takagi N, Toyoda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24379003", "url": "https://glygen.org/publication/PubMed/24379003" } ] }, { "title": "MBD3 localizes at promoters, gene bodies and enhancers of active genes.", "journal": "PLoS genetics", "date": "2013", "authors": "Shimbo Takashi, Du Ying, Grimm Sara A, Dhasarathy Archana, Mav Deepak, Shah Ruchir R, Shi Huidong, Wade Paul A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "24385926", "url": "https://glygen.org/publication/PubMed/24385926" } ] }, { "title": "RNAi factors are present and active in human cell nuclei.", "journal": "Cell reports", "date": "2014", "authors": "Gagnon KT, Li L, Chu Y, Janowski BA, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24388755", "url": "https://glygen.org/publication/PubMed/24388755" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "A SWI/SNF-related autism syndrome caused by de novo mutations in ADNP.", "journal": "Nature genetics", "date": "2014-04", "authors": "Helsmoortel C\u00e9line, Vulto-van Silfhout Anneke T, Coe Bradley P, Vandeweyer Geert, Rooms Liesbeth, van den Ende Jenneke, Schuurs-Hoeijmakers Janneke H M, Marcelis Carlo L, Willemsen Marjolein H, Vissers Lisenka E L M, Yntema Helger G, Bakshi Madhura, Wilson Meredith, Witherspoon Kali T, Malmgren Helena, Nordgren Ann, Anner\u00e9n G\u00f6ran, Fichera Marco, Bosco Paolo, Romano Corrado, de Vries Bert B A, Kleefstra Tjitske, Kooy R Frank, Eichler Evan E, Van der Aa Nathalie", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940465", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940465" } ], "reference": [ { "type": "PubMed", "id": "24531329", "url": "https://glygen.org/publication/PubMed/24531329" } ] }, { "title": "Structural and functional insights into the human B\u00f6rjeson-Forssman-Lehmann syndrome-associated protein PHF6.", "journal": "The Journal of biological chemistry", "date": "2014-04-04", "authors": "Liu Zhonghua, Li Fudong, Ruan Ke, Zhang Jiahai, Mei Yide, Wu Jihui, Shi Yunyu", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "24554700", "url": "https://glygen.org/publication/PubMed/24554700" } ] }, { "title": "CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.", "journal": "Scientific reports", "date": "2014", "authors": "Federzoni EA, Humbert M, Torbett BE, Behre G, Fey MF, Tschan MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24584857", "url": "https://glygen.org/publication/PubMed/24584857" } ] }, { "title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.", "journal": "PLoS genetics", "date": "2014", "authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24586203", "url": "https://glygen.org/publication/PubMed/24586203" } ] }, { "title": "Importin 8 regulates the transport of mature microRNAs into the cell nucleus.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wei Y, Li L, Wang D, Zhang CY, Zen K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24596094", "url": "https://glygen.org/publication/PubMed/24596094" } ] }, { "title": "Lysine 2-hydroxyisobutyrylation is a widely distributed active histone mark.", "journal": "Nature chemical biology", "date": "2014", "authors": "Dai L, Peng C, Montellier E, Lu Z, Chen Y, Ishii H, Debernardi A, Buchou T, Rousseaux S, Jin F, Sabari BR, Deng Z, Allis CD, Ren B, Khochbin S, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "24681537", "url": "https://glygen.org/publication/PubMed/24681537" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "Impact of genomic polymorphisms on the repertoire of human MHC class I-associated peptides.", "journal": "Nature communications", "date": "2014-04-09", "authors": "Granados Diana Paola, Sriranganadane Dev, Daouda Tariq, Zieger Antoine, Laumont C\u00e9line M, Caron-Lizotte Olivier, Boucher Genevi\u00e8ve, Hardy Marie-Pierre, Gendron Patrick, C\u00f4t\u00e9 Caroline, Lemieux S\u00e9bastien, Thibault Pierre, Perreault Claude", "evidence": [ { "database": "IEDB", "id": "213486", "url": "https://www.iedb.org/epitope/213486" }, { "database": "IEDB", "id": "213487", "url": "https://www.iedb.org/epitope/213487" } ], "reference": [ { "type": "PubMed", "id": "24714562", "url": "https://glygen.org/publication/PubMed/24714562" } ] }, { "title": "The nature and extent of contributions by defective ribosome products to the HLA peptidome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-04-22", "authors": "Bourdetsky Dmitry, Schmelzer Christian E H, Admon Arie", "evidence": [ { "database": "IEDB", "id": "448090", "url": "https://www.iedb.org/epitope/448090" }, { "database": "IEDB", "id": "506018", "url": "https://www.iedb.org/epitope/506018" } ], "reference": [ { "type": "PubMed", "id": "24715725", "url": "https://glygen.org/publication/PubMed/24715725" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "Glycogen synthase kinase (GSK) 3beta phosphorylates and protects nuclear myosin 1c from proteasome-mediated degradation to activate rDNA transcription in early G1 cells.", "journal": "PLoS genetics", "date": "2014", "authors": "Sarshad AA, Corcoran M, Al-Muzzaini B, Borgonovo-Brandter L, Von Euler A, Lamont D, Visa N, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "24901984", "url": "https://glygen.org/publication/PubMed/24901984" } ] }, { "title": "Insight into the architecture of the NuRD complex: structure of the RbAp48-MTA1 subcomplex.", "journal": "The Journal of biological chemistry", "date": "2014-08-08", "authors": "Alqarni Saad S M, Murthy Andal, Zhang Wei, Przewloka Marcin R, Silva Ana P G, Watson Aleksandra A, Lejon Sara, Pei Xue Y, Smits Arne H, Kloet Susan L, Wang Hongxin, Shepherd Nicholas E, Stokes Philippa H, Blobel Gerd A, Vermeulen Michiel, Glover David M, Mackay Joel P, Laue Ernest D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "24920672", "url": "https://glygen.org/publication/PubMed/24920672" } ] }, { "title": "New insight into role of myosin motors for activation of RNA polymerases.", "journal": "International review of cell and molecular biology", "date": "2014", "authors": "Sarshad AA, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "24952918", "url": "https://glygen.org/publication/PubMed/24952918" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "Targeting transcription regulation in cancer with a covalent CDK7 inhibitor.", "journal": "Nature", "date": "2014", "authors": "Kwiatkowski N, Zhang T, Rahl PB, Abraham BJ, Reddy J, Ficarro SB, Dastur A, Amzallag A, Ramaswamy S, Tesar B, Jenkins CE, Hannett NM, McMillin D, Sanda T, Sim T, Kim ND, Look T, Mitsiades CS, Weng AP, Brown JR, Benes CH, Marto JA, Young RA, Gray NS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "25043025", "url": "https://glygen.org/publication/PubMed/25043025" } ] }, { "title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.", "journal": "PLoS genetics", "date": "2014", "authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25101834", "url": "https://glygen.org/publication/PubMed/25101834" } ] }, { "title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25135475", "url": "https://glygen.org/publication/PubMed/25135475" } ] }, { "title": "NuRD-ZNF827 recruitment to telomeres creates a molecular scaffold for homologous recombination.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Conomos D, Reddel RR, Pickett HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "25150861", "url": "https://glygen.org/publication/PubMed/25150861" } ] }, { "title": "E1A-dependent trans-activation of the human MYC promoter is mediated by the E2F factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hiebert SW, Lipp M, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2524830", "url": "https://glygen.org/publication/PubMed/2524830" } ] }, { "title": "An evolutionary arms race between KRAB zinc-finger genes ZNF91/93 and SVA/L1 retrotransposons.", "journal": "Nature", "date": "2014", "authors": "Jacobs FM, Greenberg D, Nguyen N, Haeussler M, Ewing AD, Katzman S, Paten B, Salama SR, Haussler D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "25274305", "url": "https://glygen.org/publication/PubMed/25274305" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "Argonaute-1 binds transcriptional enhancers and controls constitutive and alternative splicing in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Allo M, Agirre E, Bessonov S, Bertucci P, Gomez Acuna L, Buggiano V, Bellora N, Singh B, Petrillo E, Blaustein M, Minana B, Dujardin G, Pozzi B, Pelisch F, Bechara E, Agafonov DE, Srebrow A, Luhrmann R, Valcarcel J, Eyras E, Kornblihtt AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "25313066", "url": "https://glygen.org/publication/PubMed/25313066" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Mansour MR, Abraham BJ, Anders L, Berezovskaya A, Gutierrez A, Durbin AD, Etchin J, Lawton L, Sallan SE, Silverman LB, Loh ML, Hunger SP, Sanda T, Young RA, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "25394790", "url": "https://glygen.org/publication/PubMed/25394790" } ] }, { "title": "Revisiting the arthritogenic peptide theory: quantitative not qualitative changes in the peptide repertoire of HLA-B27 allotypes.", "journal": "Arthritis & rheumatology (Hoboken, N.J.)", "date": "2015-03", "authors": "Schittenhelm Ralf B, Sian Terry C C Lim Kam, Wilmann Pascal G, Dudek Nadine L, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "236258", "url": "https://www.iedb.org/epitope/236258" }, { "database": "IEDB", "id": "492926", "url": "https://www.iedb.org/epitope/492926" } ], "reference": [ { "type": "PubMed", "id": "25418920", "url": "https://glygen.org/publication/PubMed/25418920" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "Screen identifies bromodomain protein ZMYND8 in chromatin recognition of transcription-associated DNA damage that promotes homologous recombination.", "journal": "Genes & development", "date": "2015-01-15", "authors": "Gong Fade, Chiu Li-Ya, Cox Ben, Aymard Fran\u00e7ois, Clouaire Thomas, Leung Justin W, Cammarata Michael, Perez Mercedes, Agarwal Poonam, Brodbelt Jennifer S, Legube Ga\u00eblle, Miller Kyle M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "25593309", "url": "https://glygen.org/publication/PubMed/25593309" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Exploration of peptides bound to MHC class I molecules in melanoma.", "journal": "Pigment cell & melanoma research", "date": "2015-05", "authors": "Pritchard Antonia L, Hastie Marcus L, Neller Michelle, Gorman Jeffrey J, Schmidt Chris W, Hayward Nicholas K", "evidence": [ { "database": "IEDB", "id": "418519", "url": "https://www.iedb.org/epitope/418519" }, { "database": "IEDB", "id": "448090", "url": "https://www.iedb.org/epitope/448090" } ], "reference": [ { "type": "PubMed", "id": "25645385", "url": "https://glygen.org/publication/PubMed/25645385" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "A Meier-Gorlin syndrome mutation impairs the ORC1-nucleosome association.", "journal": "ACS chemical biology", "date": "2015", "authors": "Zhang W, Sankaran S, Gozani O, Song J", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "25689043", "url": "https://glygen.org/publication/PubMed/25689043" } ] }, { "title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.", "journal": "Differentiation; research in biological diversity", "date": "1989", "authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "2570724", "url": "https://glygen.org/publication/PubMed/2570724" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP.", "journal": "Molecular cell", "date": "2015", "authors": "Ichikawa K, Kubota Y, Nakamura T, Weng JS, Tomida T, Saito H, Takekawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "25728771", "url": "https://glygen.org/publication/PubMed/25728771" } ] }, { "title": "An intrinsically disordered region of methyl-CpG binding domain protein 2 (MBD2) recruits the histone deacetylase core of the NuRD complex.", "journal": "Nucleic acids research", "date": "2015", "authors": "Desai MA, Webb HD, Sinanan LM, Scarsdale JN, Walavalkar NM, Ginder GD, Williams DC Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "25753662", "url": "https://glygen.org/publication/PubMed/25753662" } ] }, { "title": "Orc1 Binding to Mitotic Chromosomes Precedes Spatial Patterning during G1 Phase and Assembly of the Origin Recognition Complex in Human Cells.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Kara N, Hossain M, Prasanth SG, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "25784553", "url": "https://glygen.org/publication/PubMed/25784553" } ] }, { "title": "miR-191 promotes tumorigenesis of human colorectal cancer through targeting C/EBPbeta.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang XF, Li KK, Gao L, Li SZ, Chen K, Zhang JB, Wang D, Tu RF, Zhang JX, Tao KX, Wang G, Zhang XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "25784653", "url": "https://glygen.org/publication/PubMed/25784653" } ] }, { "title": "A Micropolymorphism Altering the Residue Triad 97/114/156 Determines the Relative Levels of Tapasin Independence and Distinct Peptide Profiles for HLA-A(*)24 Allotypes.", "journal": "Journal of immunology research", "date": "2014", "authors": "Badrinath Soumya, Kunze-Schumacher Heike, Blasczyk Rainer, Huyton Trevor, Bade-Doeding Christina", "evidence": [ { "database": "IEDB", "id": "418481", "url": "https://www.iedb.org/epitope/418481" } ], "reference": [ { "type": "PubMed", "id": "25802875", "url": "https://glygen.org/publication/PubMed/25802875" } ] }, { "title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.", "journal": "FEBS letters", "date": "2015", "authors": "Lonfat N, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25913784", "url": "https://glygen.org/publication/PubMed/25913784" } ] }, { "title": "A novel RNA binding surface of the TAM domain of TIP5/BAZ2A mediates epigenetic regulation of rRNA genes.", "journal": "Nucleic acids research", "date": "2015", "authors": "Anosova I, Melnik S, Tripsianes K, Kateb F, Grummt I, Sattler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "25916849", "url": "https://glygen.org/publication/PubMed/25916849" } ] }, { "title": "Loss of RUNX1/AML1 arginine-methylation impairs peripheral T cell homeostasis.", "journal": "British journal of haematology", "date": "2015", "authors": "Mizutani S, Yoshida T, Zhao X, Nimer SD, Taniwaki M, Okuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "26010396", "url": "https://glygen.org/publication/PubMed/26010396" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Tchasovnikarova IA, Timms RT, Matheson NJ, Wals K, Antrobus R, Gottgens B, Dougan G, Dawson MA, Lehner PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "26022416", "url": "https://glygen.org/publication/PubMed/26022416" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Dengue virus NS1 protein interacts with the ribosomal protein RPL18: this interaction is required for viral translation and replication in Huh-7 cells.", "journal": "Virology", "date": "2015", "authors": "Cervantes-Salazar M, Angel-Ambrocio AH, Soto-Acosta R, Bautista-Carbajal P, Hurtado-Monzon AM, Alcaraz-Estrada SL, Ludert JE, Del Angel RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "26092250", "url": "https://glygen.org/publication/PubMed/26092250" } ] }, { "title": "Belinostat in Patients With Relapsed or Refractory Peripheral T-Cell Lymphoma: Results of the Pivotal Phase II BELIEF (CLN-19) Study.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2015", "authors": "O'Connor OA, Horwitz S, Masszi T, Van Hoof A, Brown P, Doorduijn J, Hess G, Jurczak W, Knoblauch P, Chawla S, Bhat G, Choi MR, Walewski J, Savage K, Foss F, Allen LF, Shustov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "26101246", "url": "https://glygen.org/publication/PubMed/26101246" } ] }, { "title": "Drosophila model of Meier-Gorlin syndrome based on the mutation in a conserved C-Terminal domain of Orc6.", "journal": "American journal of medical genetics. Part A", "date": "2015", "authors": "Balasov M, Akhmetova K, Chesnokov I", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "26139588", "url": "https://glygen.org/publication/PubMed/26139588" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "An open-source computational and data resource to analyze digital maps of immunopeptidomes.", "journal": "eLife", "date": "2015-07-08", "authors": "Caron Etienne, Espona Lucia, Kowalewski Daniel J, Schuster Heiko, Ternette Nicola, Alp\u00edzar Ad\u00e1n, Schittenhelm Ralf B, Ramarathinam Sri H, Lindestam Arlehamn Cecilia S, Chiek Koh Ching, Gillet Ludovic C, Rabsteyn Armin, Navarro Pedro, Kim Sangtae, Lam Henry, Sturm Theo, Marcilla Miguel, Sette Alessandro, Campbell David S, Deutsch Eric W, Moritz Robert L, Purcell Anthony W, Rammensee Hans-Georg, Stevanovic Stefan, Aebersold Ruedi", "evidence": [ { "database": "IEDB", "id": "221761", "url": "https://www.iedb.org/epitope/221761" }, { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "441064", "url": "https://www.iedb.org/epitope/441064" }, { "database": "IEDB", "id": "444045", "url": "https://www.iedb.org/epitope/444045" }, { "database": "IEDB", "id": "445952", "url": "https://www.iedb.org/epitope/445952" }, { "database": "IEDB", "id": "448090", "url": "https://www.iedb.org/epitope/448090" } ], "reference": [ { "type": "PubMed", "id": "26154972", "url": "https://glygen.org/publication/PubMed/26154972" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "PAK5-mediated E47 phosphorylation promotes epithelial-mesenchymal transition and metastasis of colon cancer.", "journal": "Oncogene", "date": "2016", "authors": "Zhu G, Li X, Guo B, Ke Q, Dong M, Li F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "26212009", "url": "https://glygen.org/publication/PubMed/26212009" } ] }, { "title": "Histone reader BRWD1 targets and restricts recombination to the Igk locus.", "journal": "Nature immunology", "date": "2015", "authors": "Mandal M, Hamel KM, Maienschein-Cline M, Tanaka A, Teng G, Tuteja JH, Bunker JJ, Bahroos N, Eppig JJ, Schatz DG, Clark MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "26301565", "url": "https://glygen.org/publication/PubMed/26301565" } ] }, { "title": "Comprehensive Analysis of the Naturally Processed Peptide Repertoire: Differences between HLA-A and B in the Immunopeptidome.", "journal": "PloS one", "date": "2015", "authors": "Schellens Ingrid M M, Hoof Ilka, Meiring Hugo D, Spijkers Sanne N M, Poelen Martien C M, van Gaans-van den Brink Jacqueline A M, van der Poel Kees, Costa Ana I, van Els Cecile A C M, van Baarle Debbie, Kesmir Can", "evidence": [ { "database": "IEDB", "id": "439937", "url": "https://www.iedb.org/epitope/439937" } ], "reference": [ { "type": "PubMed", "id": "26375851", "url": "https://glygen.org/publication/PubMed/26375851" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "Cytomegalovirus latency and reactivation: recent insights into an age old problem.", "journal": "Reviews in medical virology", "date": "2016", "authors": "Dupont L, Reeves MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "26572645", "url": "https://glygen.org/publication/PubMed/26572645" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Comparative Analysis of the Endogenous Peptidomes Displayed by HLA-B*27 and Mamu-B*08: Two MHC Class I Alleles Associated with Elite Control of HIV/SIV Infection.", "journal": "Journal of proteome research", "date": "2016-03-04", "authors": "Marcilla Miguel, Alvarez I\u00f1aki, Ramos-Fern\u00e1ndez Antonio, Lombard\u00eda Manuel, Paradela Alberto, Albar Juan Pablo", "evidence": [ { "database": "IEDB", "id": "223829", "url": "https://www.iedb.org/epitope/223829" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "445952", "url": "https://www.iedb.org/epitope/445952" } ], "reference": [ { "type": "PubMed", "id": "26811146", "url": "https://glygen.org/publication/PubMed/26811146" } ] }, { "title": "Characterization of the Enzymatic Activity of SETDB1 and Its 1:1 Complex with ATF7IP.", "journal": "Biochemistry", "date": "2016", "authors": "Basavapathruni A, Gureasko J, Porter Scott M, Hermans W, Godbole A, Leland PA, Boriack-Sjodin PA, Wigle TJ, Copeland RA, Riera TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "26813693", "url": "https://glygen.org/publication/PubMed/26813693" } ] }, { "title": "Properties and catalytic activities of MICAL1, the flavoenzyme involved in cytoskeleton dynamics, and modulation by its CH, LIM and C-terminal domains.", "journal": "Archives of biochemistry and biophysics", "date": "2016", "authors": "Vitali T, Maffioli E, Tedeschi G, Vanoni MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "26845023", "url": "https://glygen.org/publication/PubMed/26845023" } ] }, { "title": "Human Leukocyte Antigen (HLA) B27 Allotype-Specific Binding and Candidate Arthritogenic Peptides Revealed through Heuristic Clustering of Data-independent Acquisition Mass Spectrometry (DIA-MS) Data.", "journal": "Molecular & cellular proteomics : MCP", "date": "2016-06", "authors": "Schittenhelm Ralf B, Sivaneswaran Saranjah, Lim Kam Sian Terry C C, Croft Nathan P, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" } ], "reference": [ { "type": "PubMed", "id": "26929215", "url": "https://glygen.org/publication/PubMed/26929215" } ] }, { "title": "LNK/SH2B3 regulates IL-7 receptor signaling in normal and malignant B-progenitors.", "journal": "The Journal of clinical investigation", "date": "2016", "authors": "Cheng Y, Chikwava K, Wu C, Zhang H, Bhagat A, Pei D, Choi JK, Tong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "26974155", "url": "https://glygen.org/publication/PubMed/26974155" } ] }, { "title": "Protein Kinase Ciota Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.", "journal": "Cancer cell", "date": "2016", "authors": "Ali SA, Justilien V, Jamieson L, Murray NR, Fields AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "26977885", "url": "https://glygen.org/publication/PubMed/26977885" } ] }, { "title": "High-sensitivity HLA class I peptidome analysis enables a precise definition of peptide motifs and the identification of peptides from cell lines and patients' sera.", "journal": "Proteomics", "date": "2016-05", "authors": "Ritz Danilo, Gloger Andreas, Weide Benjamin, Garbe Claus, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "241271", "url": "https://www.iedb.org/epitope/241271" }, { "database": "IEDB", "id": "241481", "url": "https://www.iedb.org/epitope/241481" }, { "database": "IEDB", "id": "438321", "url": "https://www.iedb.org/epitope/438321" }, { "database": "IEDB", "id": "494708", "url": "https://www.iedb.org/epitope/494708" }, { "database": "IEDB", "id": "618086", "url": "https://www.iedb.org/epitope/618086" } ], "reference": [ { "type": "PubMed", "id": "26992070", "url": "https://glygen.org/publication/PubMed/26992070" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Dynamic Competing Histone H4 K5K8 Acetylation and Butyrylation Are Hallmarks of Highly Active Gene Promoters.", "journal": "Molecular cell", "date": "2016", "authors": "Goudarzi A, Zhang D, Huang H, Barral S, Kwon OK, Qi S, Tang Z, Buchou T, Vitte AL, He T, Cheng Z, Montellier E, Gaucher J, Curtet S, Debernardi A, Charbonnier G, Puthier D, Petosa C, Panne D, Rousseaux S, Roeder RG, Zhao Y, Khochbin S", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "27105113", "url": "https://glygen.org/publication/PubMed/27105113" } ] }, { "title": "Metabolic Regulation of Gene Expression by Histone Lysine beta-Hydroxybutyrylation.", "journal": "Molecular cell", "date": "2016", "authors": "Xie Z, Zhang D, Chung D, Tang Z, Huang H, Dai L, Qi S, Li J, Colak G, Chen Y, Xia C, Peng C, Ruan H, Kirkey M, Wang D, Jensen LM, Kwon OK, Lee S, Pletcher SD, Tan M, Lombard DB, White KP, Zhao H, Li J, Roeder RG, Yang X, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "27105115", "url": "https://glygen.org/publication/PubMed/27105115" } ] }, { "title": "Mass spectrometric analysis of host cell proteins interacting with dengue virus nonstructural protein 1 in dengue virus-infected HepG2 cells.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Dechtawewat T, Paemanee A, Roytrakul S, Songprakhon P, Limjindaporn T, Yenchitsomanus PT, Saitornuang S, Puttikhunt C, Kasinrerk W, Malasit P, Noisakran S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "27108190", "url": "https://glygen.org/publication/PubMed/27108190" } ] }, { "title": "SCL/TAL1 in Hematopoiesis and Cellular Reprogramming.", "journal": "Current topics in developmental biology", "date": "2016", "authors": "Hoang T, Lambert JA, Martin R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236" } ], "reference": [ { "type": "PubMed", "id": "27137657", "url": "https://glygen.org/publication/PubMed/27137657" } ] }, { "title": "Histone H3K36 mutations promote sarcomagenesis through altered histone methylation landscape.", "journal": "Science (New York, N.Y.)", "date": "2016", "authors": "Lu C, Jain SU, Hoelper D, Bechet D, Molden RC, Ran L, Murphy D, Venneti S, Hameed M, Pawel BR, Wunder JS, Dickson BC, Lundgren SM, Jani KS, De Jay N, Papillon-Cavanagh S, Andrulis IL, Sawyer SL, Grynspan D, Turcotte RE, Nadaf J, Fahiminiyah S, Muir TW, Majewski J, Thompson CB, Chi P, Garcia BA, Allis CD, Jabado N, Lewis PW", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "27174990", "url": "https://glygen.org/publication/PubMed/27174990" } ] }, { "title": "Nuclear factor E2F mediates basic transcription and trans-activation by E1a of the human MYC promoter.", "journal": "Genes & development", "date": "1989", "authors": "Thalmeier K, Synovzik H, Mertz R, Winnacker EL, Lipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2721961", "url": "https://glygen.org/publication/PubMed/2721961" } ] }, { "title": "Suppressor of cytokine signaling (SOCS) proteins are induced by IL-7 and target surface CD127 protein for degradation in human CD8 T cells.", "journal": "Cellular immunology", "date": "2016", "authors": "Ghazawi FM, Faller EM, Parmar P, El-Salfiti A, MacPherson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "27423467", "url": "https://glygen.org/publication/PubMed/27423467" } ] }, { "title": "SIRT7 is a histone desuccinylase that functionally links to chromatin compaction and genome stability.", "journal": "Nature communications", "date": "2016", "authors": "Li L, Shi L, Yang S, Yan R, Zhang D, Yang J, He L, Li W, Yi X, Sun L, Liang J, Cheng Z, Shi L, Shang Y, Yu W", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "27436229", "url": "https://glygen.org/publication/PubMed/27436229" } ] }, { "title": "Human Cytomegalovirus Latency: Approaching the Gordian Knot.", "journal": "Annual review of virology", "date": "2016", "authors": "Goodrum F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "27501258", "url": "https://glygen.org/publication/PubMed/27501258" } ] }, { "title": "Hemi-methylated DNA regulates DNA methylation inheritance through allosteric activation of H3 ubiquitylation by UHRF1.", "journal": "eLife", "date": "2016-09-06", "authors": "Harrison Joseph S, Cornett Evan M, Goldfarb Dennis, DaRosa Paul A, Li Zimeng M, Yan Feng, Dickson Bradley M, Guo Angela H, Cantu Daniel V, Kaustov Lilia, Brown Peter J, Arrowsmith Cheryl H, Erie Dorothy A, Major Michael B, Klevit Rachel E, Krajewski Krzysztof, Kuhlman Brian, Strahl Brian D, Rothbart Scott B", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "27595565", "url": "https://glygen.org/publication/PubMed/27595565" } ] }, { "title": "Pathogenesis of Borjeson-Forssman-Lehmann syndrome: Insights from PHF6 function.", "journal": "Neurobiology of disease", "date": "2016", "authors": "Jahani-Asl A, Cheng C, Zhang C, Bonni A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "27633282", "url": "https://glygen.org/publication/PubMed/27633282" } ] }, { "title": "Pask integrates hormonal signaling with histone modification via Wdr5 phosphorylation to drive myogenesis.", "journal": "eLife", "date": "2016", "authors": "Kikani CK, Wu X, Paul L, Sabic H, Shen Z, Shakya A, Keefe A, Villanueva C, Kardon G, Graves B, Tantin D, Rutter J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943411", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411" } ], "reference": [ { "type": "PubMed", "id": "27661449", "url": "https://glygen.org/publication/PubMed/27661449" } ] }, { "title": "ATF7IP-Mediated Stabilization of the Histone Methyltransferase SETDB1 Is Essential for Heterochromatin Formation by the HUSH Complex.", "journal": "Cell reports", "date": "2016", "authors": "Timms RT, Tchasovnikarova IA, Antrobus R, Dougan G, Lehner PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "27732843", "url": "https://glygen.org/publication/PubMed/27732843" } ] }, { "title": "ZMYND8 Co-localizes with NuRD on Target Genes and Regulates Poly(ADP-Ribose)-Dependent Recruitment of GATAD2A/NuRD to Sites of DNA Damage.", "journal": "Cell reports", "date": "2016", "authors": "Spruijt CG, Luijsterburg MS, Menafra R, Lindeboom RG, Jansen PW, Edupuganti RR, Baltissen MP, Wiegant WW, Voelker-Albert MC, Matarese F, Mensinga A, Poser I, Vos HR, Stunnenberg HG, van Attikum H, Vermeulen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "27732854", "url": "https://glygen.org/publication/PubMed/27732854" } ] }, { "title": "Lysyl oxidase-like 2 (LOXL2) oxidizes trimethylated lysine 4 in histone H3.", "journal": "The FEBS journal", "date": "2016", "authors": "Herranz N, Dave N, Millanes-Romero A, Pascual-Reguant L, Morey L, Diaz VM, Lorenz-Fonfria V, Gutierrez-Gallego R, Jeronimo C, Iturbide A, Di Croce L, Garcia de Herreros A, Peiro S", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "27735137", "url": "https://glygen.org/publication/PubMed/27735137" } ] }, { "title": "A Functional Switch of NuRD Chromatin Remodeling Complex Subunits Regulates Mouse Cortical Development.", "journal": "Cell reports", "date": "2016-11-01", "authors": "Nitarska Justyna, Smith Jacob G, Sherlock William T, Hillege Michele M G, Nott Alexi, Barshop William D, Vashisht Ajay A, Wohlschlegel James A, Mitter Richard, Riccio Antonella", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "27806305", "url": "https://glygen.org/publication/PubMed/27806305" } ] }, { "title": "A large fraction of HLA class I ligands are proteasome-generated spliced peptides.", "journal": "Science (New York, N.Y.)", "date": "2016-10-21", "authors": "Liepe Juliane, Marino Fabio, Sidney John, Jeko Anita, Bunting Daniel E, Sette Alessandro, Kloetzel Peter M, Stumpf Michael P H, Heck Albert J R, Mishto Michele", "evidence": [ { "database": "IEDB", "id": "55785", "url": "https://www.iedb.org/epitope/55785" }, { "database": "IEDB", "id": "219933", "url": "https://www.iedb.org/epitope/219933" }, { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "223829", "url": "https://www.iedb.org/epitope/223829" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "241271", "url": "https://www.iedb.org/epitope/241271" }, { "database": "IEDB", "id": "241481", "url": "https://www.iedb.org/epitope/241481" }, { "database": "IEDB", "id": "492340", "url": "https://www.iedb.org/epitope/492340" }, { "database": "IEDB", "id": "494708", "url": "https://www.iedb.org/epitope/494708" }, { "database": "IEDB", "id": "586407", "url": "https://www.iedb.org/epitope/586407" }, { "database": "IEDB", "id": "588131", "url": "https://www.iedb.org/epitope/588131" }, { "database": "IEDB", "id": "588154", "url": "https://www.iedb.org/epitope/588154" } ], "reference": [ { "type": "PubMed", "id": "27846572", "url": "https://glygen.org/publication/PubMed/27846572" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "Impaired H3K36 methylation defines a subset of head and neck squamous cell carcinomas.", "journal": "Nature genetics", "date": "2017", "authors": "Papillon-Cavanagh S, Lu C, Gayden T, Mikael LG, Bechet D, Karamboulas C, Ailles L, Karamchandani J, Marchione DM, Garcia BA, Weinreb I, Goldstein D, Lewis PW, Dancu OM, Dhaliwal S, Stecho W, Howlett CJ, Mymryk JS, Barrett JW, Nichols AC, Allis CD, Majewski J, Jabado N", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "28067913", "url": "https://glygen.org/publication/PubMed/28067913" } ] }, { "title": "Serine ADP-Ribosylation Depends on HPF1.", "journal": "Molecular cell", "date": "2017", "authors": "Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E, Zaja R, Ahel I, Matic I", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "28190768", "url": "https://glygen.org/publication/PubMed/28190768" } ] }, { "title": "KRAB zinc-finger proteins contribute to the evolution of gene regulatory networks.", "journal": "Nature", "date": "2017", "authors": "Imbeault M, Helleboid PY, Trono D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "28273063", "url": "https://glygen.org/publication/PubMed/28273063" } ] }, { "title": "Proteomic analysis of proteome and histone post-translational modifications in heat shock protein 90 inhibition-mediated bladder cancer therapeutics.", "journal": "Scientific reports", "date": "2017", "authors": "Li QQ, Hao JJ, Zhang Z, Krane LS, Hammerich KH, Sanford T, Trepel JB, Neckers L, Agarwal PK", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" } ], "reference": [ { "type": "PubMed", "id": "28298630", "url": "https://glygen.org/publication/PubMed/28298630" } ] }, { "title": "DFNA5 promoter methylation a marker for breast tumorigenesis.", "journal": "Oncotarget", "date": "2017", "authors": "Croes L, de Beeck KO, Pauwels P, Vanden Berghe W, Peeters M, Fransen E, Van Camp G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "28404884", "url": "https://glygen.org/publication/PubMed/28404884" } ] }, { "title": "Viral gene products actively promote latent infection by epigenetic silencing mechanisms.", "journal": "Current opinion in virology", "date": "2017", "authors": "Knipe DM, Raja P, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "28415052", "url": "https://glygen.org/publication/PubMed/28415052" } ] }, { "title": "Class I histone deacetylases are major histone decrotonylases: evidence for critical and broad function of histone crotonylation in transcription.", "journal": "Cell research", "date": "2017", "authors": "Wei W, Liu X, Chen J, Gao S, Lu L, Zhang H, Ding G, Wang Z, Chen Z, Shi T, Li J, Yu J, Wong J", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "28497810", "url": "https://glygen.org/publication/PubMed/28497810" } ] }, { "title": "The Intergenic Recombinant HLA-B *46:01 Has a Distinctive Peptidome that Includes KIR2DL3 Ligands.", "journal": "Cell reports", "date": "2017", "authors": "Hilton HG, McMurtrey CP, Han AS, Djaoud Z, Guethlein LA, Blokhuis JH, Pugh JL, Goyos A, Horowitz A, Buchli R, Jackson KW, Bardet W, Bushnell DA, Robinson PJ, Mendoza JL, Birnbaum ME, Nielsen M, Garcia KC, Hildebrand WH, Parham P", "evidence": [ { "database": "IEDB", "id": "640330", "url": "https://www.iedb.org/epitope/640330" }, { "database": "IEDB", "id": "640963", "url": "https://www.iedb.org/epitope/640963" } ], "reference": [ { "type": "PubMed", "id": "28514659", "url": "https://glygen.org/publication/PubMed/28514659" } ] }, { "title": "The ATP-dependent chromatin remodeling enzymes CHD6, CHD7, and CHD8 exhibit distinct nucleosome binding and remodeling activities.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Manning BJ, Yusufzai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "28533432", "url": "https://glygen.org/publication/PubMed/28533432" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "Hyperactivation of HUSH complex function by Charcot-Marie-Tooth disease mutation in MORC2.", "journal": "Nature genetics", "date": "2017", "authors": "Tchasovnikarova IA, Timms RT, Douse CH, Roberts RC, Dougan G, Kingston RE, Modis Y, Lehner PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "28581500", "url": "https://glygen.org/publication/PubMed/28581500" } ] }, { "title": "Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity.", "journal": "PLoS computational biology", "date": "2017-08", "authors": "Bassani-Sternberg Michal, Chong Chlo\u00e9, Guillaume Philippe, Solleder Marthe, Pak HuiSong, Gannon Philippe O, Kandalaft Lana E, Coukos George, Gfeller David", "evidence": [ { "database": "IEDB", "id": "489132", "url": "https://www.iedb.org/epitope/489132" }, { "database": "IEDB", "id": "640330", "url": "https://www.iedb.org/epitope/640330" } ], "reference": [ { "type": "PubMed", "id": "28832583", "url": "https://glygen.org/publication/PubMed/28832583" } ] }, { "title": "Unveiling the Peptide Motifs of HLA-C and HLA-G from Naturally Presented Peptides and Generation of Binding Prediction Matrices.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2017-10-15", "authors": "Di Marco Moreno, Schuster Heiko, Backert Linus, Ghosh Michael, Rammensee Hans-Georg, Stevanovi\u0107 Stefan", "evidence": [ { "database": "IEDB", "id": "435791", "url": "https://www.iedb.org/epitope/435791" } ], "reference": [ { "type": "PubMed", "id": "28904123", "url": "https://glygen.org/publication/PubMed/28904123" } ] }, { "title": "CHD3 and CHD4 form distinct NuRD complexes with different yet overlapping functionality.", "journal": "Nucleic acids research", "date": "2017", "authors": "Hoffmeister H, Fuchs A, Erdel F, Pinz S, Grobner-Ferreira R, Bruckmann A, Deutzmann R, Schwartz U, Maldonado R, Huber C, Dendorfer AS, Rippe K, Langst G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "28977666", "url": "https://glygen.org/publication/PubMed/28977666" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "Transcription factor 19 interacts with histone 3 lysine 4 trimethylation and controls gluconeogenesis via the nucleosome-remodeling-deacetylase complex.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Sen S, Sanyal S, Srivastava DK, Dasgupta D, Roy S, Das C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "29042441", "url": "https://glygen.org/publication/PubMed/29042441" } ] }, { "title": "Structure of the Dnmt1 Reader Module Complexed with a Unique Two-Mono-Ubiquitin Mark on Histone H3 Reveals the Basis for DNA Methylation Maintenance.", "journal": "Molecular cell", "date": "2017-10-19", "authors": "Ishiyama Satoshi, Nishiyama Atsuya, Saeki Yasushi, Moritsugu Kei, Morimoto Daichi, Yamaguchi Luna, Arai Naoko, Matsumura Rumie, Kawakami Toru, Mishima Yuichi, Hojo Hironobu, Shimamura Shintaro, Ishikawa Fuyuki, Tajima Shoji, Tanaka Keiji, Ariyoshi Mariko, Shirakawa Masahiro, Ikeguchi Mitsunori, Kidera Akinori, Suetake Isao, Arita Kyohei, Nakanishi Makoto", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "29053958", "url": "https://glygen.org/publication/PubMed/29053958" } ] }, { "title": "Human NOTCH4 is a key target of RUNX1 in megakaryocytic differentiation.", "journal": "Blood", "date": "2018", "authors": "Li Y, Jin C, Bai H, Gao Y, Sun S, Chen L, Qin L, Liu PP, Cheng L, Wang QF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "29101237", "url": "https://glygen.org/publication/PubMed/29101237" } ] }, { "title": "Tofacitinib: A Review in Rheumatoid Arthritis.", "journal": "Drugs", "date": "2017", "authors": "Dhillon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "29139090", "url": "https://glygen.org/publication/PubMed/29139090" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Selective silencing of euchromatic L1s revealed by genome-wide screens for L1 regulators.", "journal": "Nature", "date": "2018", "authors": "Liu N, Lee CH, Swigut T, Grow E, Gu B, Bassik MC, Wysocka J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "29211708", "url": "https://glygen.org/publication/PubMed/29211708" } ] }, { "title": "KAT2A coupled with the alpha-KGDH complex acts as a histone H3 succinyltransferase.", "journal": "Nature", "date": "2017", "authors": "Wang Y, Guo YR, Liu K, Yin Z, Liu R, Xia Y, Tan L, Yang P, Lee JH, Li XJ, Hawke D, Zheng Y, Qian X, Lyu J, He J, Xing D, Tao YJ, Lu Z", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "29211711", "url": "https://glygen.org/publication/PubMed/29211711" } ] }, { "title": "High-throughput and Sensitive Immunopeptidomics Platform Reveals Profound Interferon\u03b3-Mediated Remodeling of the Human Leukocyte Antigen (HLA) Ligandome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2018-03", "authors": "Chong Chloe, Marino Fabio, Pak HuiSong, Racle Julien, Daniel Roy T, M\u00fcller Markus, Gfeller David, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "1258375", "url": "https://www.iedb.org/epitope/1258375" } ], "reference": [ { "type": "PubMed", "id": "29242379", "url": "https://glygen.org/publication/PubMed/29242379" } ] }, { "title": "Citrullinated histone H3 as a novel prognostic blood marker in patients with advanced cancer.", "journal": "PloS one", "date": "2018", "authors": "Th\u00e5lin Charlotte, Lundstr\u00f6m Staffan, Seignez Cedric, Daleskog Maud, Lundstr\u00f6m Annika, Henriksson Peter, Helleday Thomas, Phillipson Mia, Wall\u00e9n H\u00e5kan, Demers M\u00e9lanie", "evidence": [ { "database": "BiomarkerKB", "id": "AN6379-2", "url": "https://biomarkerkb.org/biomarker/AN6379-2" } ], "reference": [ { "type": "PubMed", "id": "29324871", "url": "https://glygen.org/publication/PubMed/29324871" } ] }, { "title": "MHC class I loaded ligands from breast cancer cell lines: A potential HLA-I-typed antigen collection.", "journal": "Journal of proteomics", "date": "2018-03-30", "authors": "Rozanov Dmitri V, Rozanov Nikita D, Chiotti Kami E, Reddy Ashok, Wilmarth Phillip A, David Larry L, Cha Seung W, Woo Sunghee, Pevzner Pavel, Bafna Vineet, Burrows Gregory G, Rantala Juha K, Levin Trevor, Anur Pavana, Johnson-Camacho Katie, Tabatabaei Shaadi, Munson Daniel J, Bruno Tullia C, Slansky Jill E, Kappler John W, Hirano Naoto, Boegel Sebastian, Fox Bernard A, Egelston Colt, Simons Diana L, Jimenez Grecia, Lee Peter P, Gray Joe W, Spellman Paul T", "evidence": [ { "database": "IEDB", "id": "640330", "url": "https://www.iedb.org/epitope/640330" } ], "reference": [ { "type": "PubMed", "id": "29331515", "url": "https://glygen.org/publication/PubMed/29331515" } ] }, { "title": "The Antigen ASB4 on Cancer Stem Cells Serves as a Target for CTL Immunotherapy of Colorectal Cancer.", "journal": "Cancer immunology research", "date": "2018", "authors": "Miyamoto S, Kochin V, Kanaseki T, Hongo A, Tokita S, Kikuchi Y, Takaya A, Hirohashi Y, Tsukahara T, Terui T, Ishitani K, Hata F, Takemasa I, Miyazaki A, Hiratsuka H, Sato N, Torigoe T", "evidence": [ { "database": "IEDB", "id": "418519", "url": "https://www.iedb.org/epitope/418519" } ], "reference": [ { "type": "PubMed", "id": "29371260", "url": "https://glygen.org/publication/PubMed/29371260" } ] }, { "title": "C/EBPalpha overrides epigenetic reprogramming by oncogenic transcription factors in acute myeloid leukemia.", "journal": "Blood advances", "date": "2018", "authors": "Loke J, Chin PS, Keane P, Pickin A, Assi SA, Ptasinska A, Imperato MR, Cockerill PN, Bonifer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "29431622", "url": "https://glygen.org/publication/PubMed/29431622" } ] }, { "title": "Serine is the major residue for ADP-ribosylation upon DNA damage.", "journal": "eLife", "date": "2018", "authors": "Palazzo L, Leidecker O, Prokhorova E, Dauben H, Matic I, Ahel I", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "29480802", "url": "https://glygen.org/publication/PubMed/29480802" } ] }, { "title": "T-Cell Immunopeptidomes Reveal Cell Subtype Surface Markers Derived From Intracellular Proteins.", "journal": "Proteomics", "date": "2018-06", "authors": "Olsson Niclas, Schultz Liora M, Zhang Lichao, Khodadoust Michael S, Narayan Rupa, Czerwinski Debra K, Levy Ronald, Elias Joshua E", "evidence": [ { "database": "IEDB", "id": "55785", "url": "https://www.iedb.org/epitope/55785" }, { "database": "IEDB", "id": "162146", "url": "https://www.iedb.org/epitope/162146" }, { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "224167", "url": "https://www.iedb.org/epitope/224167" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "241271", "url": "https://www.iedb.org/epitope/241271" }, { "database": "IEDB", "id": "441064", "url": "https://www.iedb.org/epitope/441064" }, { "database": "IEDB", "id": "489000", "url": "https://www.iedb.org/epitope/489000" }, { "database": "IEDB", "id": "598059", "url": "https://www.iedb.org/epitope/598059" }, { "database": "IEDB", "id": "606845", "url": "https://www.iedb.org/epitope/606845" }, { "database": "IEDB", "id": "627462", "url": "https://www.iedb.org/epitope/627462" }, { "database": "IEDB", "id": "925373", "url": "https://www.iedb.org/epitope/925373" }, { "database": "IEDB", "id": "929554", "url": "https://www.iedb.org/epitope/929554" } ], "reference": [ { "type": "PubMed", "id": "29493099", "url": "https://glygen.org/publication/PubMed/29493099" } ] }, { "title": "JMJD5 is a human arginyl C-3 hydroxylase.", "journal": "Nature communications", "date": "2018", "authors": "Wilkins SE, Islam MS, Gannon JM, Markolovic S, Hopkinson RJ, Ge W, Schofield CJ, Chowdhury R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842" } ], "reference": [ { "type": "PubMed", "id": "29563586", "url": "https://glygen.org/publication/PubMed/29563586" } ] }, { "title": "FIGL1 and its novel partner FLIP form a conserved complex that regulates homologous recombination.", "journal": "PLoS genetics", "date": "2018-04", "authors": "Fernandes Joiselle Blanche, Duhamel Marine, Segu\u00e9la-Arnaud Mathilde, Froger Nicole, Girard Chlo\u00e9, Choinard Sandrine, Solier Victor, De Winne Nancy, De Jaeger Geert, Gevaert Kris, Andrey Philippe, Grelon Mathilde, Guerois Raphael, Kumar Rajeev, Mercier Rapha\u00ebl", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "29608566", "url": "https://glygen.org/publication/PubMed/29608566" } ] }, { "title": "The HUSH complex cooperates with TRIM28 to repress young retrotransposons and new genes.", "journal": "Genome research", "date": "2018", "authors": "Robbez-Masson L, Tie CHC, Conde L, Tunbak H, Husovsky C, Tchasovnikarova IA, Timms RT, Herrero J, Lehner PJ, Rowe HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "29728366", "url": "https://glygen.org/publication/PubMed/29728366" } ] }, { "title": "Genomewide binding of transcription factor Snail1 in triple-negative breast cancer cells.", "journal": "Molecular oncology", "date": "2018", "authors": "Maturi V, Moren A, Enroth S, Heldin CH, Moustakas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "29729076", "url": "https://glygen.org/publication/PubMed/29729076" } ] }, { "title": "Activity-dependent neuroprotective protein recruits HP1 and CHD4 to control lineage-specifying genes.", "journal": "Nature", "date": "2018", "authors": "Ostapcuk V, Mohn F, Carl SH, Basters A, Hess D, Iesmantavicius V, Lampersberger L, Flemr M, Pandey A, Thoma NH, Betschinger J, Buhler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940465", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940465" } ], "reference": [ { "type": "PubMed", "id": "29795351", "url": "https://glygen.org/publication/PubMed/29795351" } ] }, { "title": "Flaviviruses Exploit the Lipid Droplet Protein AUP1 to Trigger Lipophagy and Drive Virus Production.", "journal": "Cell host & microbe", "date": "2018", "authors": "Zhang J, Lan Y, Li MY, Lamers MM, Fusade-Boyer M, Klemm E, Thiele C, Ashour J, Sanyal S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "29902443", "url": "https://glygen.org/publication/PubMed/29902443" } ] }, { "title": "Structural and functional characterization of the RBBP4-ZNF827 interaction and its role in NuRD recruitment to telomeres.", "journal": "The Biochemical journal", "date": "2018", "authors": "Yang SF, Sun AA, Shi Y, Li F, Pickett HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "30045876", "url": "https://glygen.org/publication/PubMed/30045876" } ] }, { "title": "Neutralizing Gatad2a-Chd4-Mbd3/NuRD Complex Facilitates Deterministic Induction of Naive Pluripotency.", "journal": "Cell stem cell", "date": "2018", "authors": "Mor N, Rais Y, Sheban D, Peles S, Aguilera-Castrejon A, Zviran A, Elinger D, Viukov S, Geula S, Krupalnik V, Zerbib M, Chomsky E, Lasman L, Shani T, Bayerl J, Gafni O, Hanna S, Buenrostro JD, Hagai T, Masika H, Vainorius G, Bergman Y, Greenleaf WJ, Esteban MA, Elling U, Levin Y, Massarwa R, Merbl Y, Novershtern N, Hanna JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "30122475", "url": "https://glygen.org/publication/PubMed/30122475" } ] }, { "title": "Enhancer-facilitated expression of prokaryotic and eukaryotic genes using human histone gene 5' regulatory sequences.", "journal": "Biochem. Cell Biol.", "date": "1986", "authors": "Marashi F, Helms S, Shiels A, Silverstein S, Greenspan DS, Stein G, Stein J", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "3013246", "url": "https://glygen.org/publication/PubMed/3013246" } ] }, { "title": "Positive Regulation of Transcription by Human ZMYND8 through Its Association with P-TEFb Complex.", "journal": "Cell reports", "date": "2018-08-21", "authors": "Ghosh Koushik, Tang Ming, Kumari Nidhi, Nandy Arijit, Basu Subham, Mall Dheerendra Pratap, Rai Kunal, Biswas Debabrata", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "30134174", "url": "https://glygen.org/publication/PubMed/30134174" } ] }, { "title": "Lysine benzoylation is a histone mark regulated by SIRT2.", "journal": "Nature communications", "date": "2018", "authors": "Huang H, Zhang D, Wang Y, Perez-Neut M, Han Z, Zheng YG, Hao Q, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "30154464", "url": "https://glygen.org/publication/PubMed/30154464" } ] }, { "title": "A variant NuRD complex containing PWWP2A/B excludes MBD2/3 to regulate transcription at active genes.", "journal": "Nature communications", "date": "2018", "authors": "Zhang T, Wei G, Millard CJ, Fischer R, Konietzny R, Kessler BM, Schwabe JWR, Brockdorff N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "30228260", "url": "https://glygen.org/publication/PubMed/30228260" } ] }, { "title": "Interplay of Histone Marks with Serine ADP-Ribosylation.", "journal": "Cell reports", "date": "2018", "authors": "Bartlett E, Bonfiglio JJ, Prokhorova E, Colby T, Zobel F, Ahel I, Matic I", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "30257210", "url": "https://glygen.org/publication/PubMed/30257210" } ] }, { "title": "PWWP2A binds distinct chromatin moieties and interacts with an MTA1-specific core NuRD complex.", "journal": "Nature communications", "date": "2018", "authors": "Link S, Spitzer RMM, Sana M, Torrado M, Volker-Albert MC, Keilhauer EC, Burgold T, Punzeler S, Low JKK, Lindstrom I, Nist A, Regnard C, Stiewe T, Hendrich B, Imhof A, Mann M, Mackay JP, Bartkuhn M, Hake SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "30327463", "url": "https://glygen.org/publication/PubMed/30327463" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "HCMV miRNA Targets Reveal Important Cellular Pathways for Viral Replication, Latency, and Reactivation.", "journal": "Non-coding RNA", "date": "2018", "authors": "Diggins NL, Hancock MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30360396", "url": "https://glygen.org/publication/PubMed/30360396" } ] }, { "title": "MLL3 enhances the transcription of PD-L1 and regulates anti-tumor immunity.", "journal": "Biochimica et biophysica acta. Molecular basis of disease", "date": "2019", "authors": "Xiong W, Deng H, Huang C, Zen C, Jian C, Ye K, Zhong Z, Zhao X, Zhu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9909649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9909649" } ], "reference": [ { "type": "PubMed", "id": "30385408", "url": "https://glygen.org/publication/PubMed/30385408" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "Dengue virus requires apoptosis linked gene-2-interacting protein X (ALIX) for viral propagation.", "journal": "Virus research", "date": "2019", "authors": "Thepparit C, Khongwichit S, Ketsuwan K, Libsittikul S, Auewarakul P, Smith DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "30599162", "url": "https://glygen.org/publication/PubMed/30599162" } ] }, { "title": "HCMV latency: what regulates the regulators?", "journal": "Medical microbiology and immunology", "date": "2019", "authors": "Elder E, Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30761409", "url": "https://glygen.org/publication/PubMed/30761409" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "Histone serotonylation is a permissive modification that enhances TFIID binding to H3K4me3.", "journal": "Nature", "date": "2019", "authors": "Farrelly LA, Thompson RE, Zhao S, Lepack AE, Lyu Y, Bhanu NV, Zhang B, Loh YE, Ramakrishnan A, Vadodaria KC, Heard KJ, Erikson G, Nakadai T, Bastle RM, Lukasak BJ, Zebroski H 3rd, Alenina N, Bader M, Berton O, Roeder RG, Molina H, Gage FH, Shen L, Garcia BA, Li H, Muir TW, Maze I", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "30867594", "url": "https://glygen.org/publication/PubMed/30867594" } ] }, { "title": "The coordination between ZNF217 and LSD1 contributes to hepatocellular carcinoma progress and is negatively regulated by miR-101.", "journal": "Experimental cell research", "date": "2019", "authors": "Si W, Zhao Y, Zhou J, Zhang Q, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "30898548", "url": "https://glygen.org/publication/PubMed/30898548" } ] }, { "title": "EZHIP/CXorf67 mimics K27M mutated oncohistones and functions as an intrinsic inhibitor of PRC2 function in aggressive posterior fossa ependymoma.", "journal": "Neuro-oncology", "date": "2019", "authors": "Hubner JM, Muller T, Papageorgiou DN, Mauermann M, Krijgsveld J, Russell RB, Ellison DW, Pfister SM, Pajtler KW, Kool M", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "30923826", "url": "https://glygen.org/publication/PubMed/30923826" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "Structural analyses reveal that MBD3 is a methylated CG binder.", "journal": "The FEBS journal", "date": "2019", "authors": "Liu K, Lei M, Wu Z, Gan B, Cheng H, Li Y, Min J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "30980593", "url": "https://glygen.org/publication/PubMed/30980593" } ] }, { "title": "Predictors of neutrophil extracellular traps markers in type 2 diabetes mellitus: associations with a prothrombotic state and hypofibrinolysis.", "journal": "Cardiovascular diabetology", "date": "2019-04-16", "authors": "Bryk Agata H, Prior Shannon M, Plens Krzysztof, Konieczynska Malgorzata, Hohendorff Jerzy, Malecki Maciej T, Butenas Saulius, Undas Anetta", "evidence": [ { "database": "BiomarkerKB", "id": "AN6379-3", "url": "https://biomarkerkb.org/biomarker/AN6379-3" } ], "reference": [ { "type": "PubMed", "id": "30992036", "url": "https://glygen.org/publication/PubMed/30992036" } ] }, { "title": "Methylation analysis of Gasdermin E shows great promise as a biomarker for colorectal cancer.", "journal": "Cancer medicine", "date": "2019", "authors": "Ibrahim J, Op de Beeck K, Fransen E, Croes L, Beyens M, Suls A, Vanden Berghe W, Peeters M, Van Camp G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "30993897", "url": "https://glygen.org/publication/PubMed/30993897" } ] }, { "title": "PFA ependymoma-associated protein EZHIP inhibits PRC2 activity through a H3 K27M-like mechanism.", "journal": "Nature communications", "date": "2019", "authors": "Jain SU, Do TJ, Lund PJ, Rashoff AQ, Diehl KL, Cieslik M, Bajic A, Juretic N, Deshmukh S, Venneti S, Muir TW, Garcia BA, Jabado N, Lewis PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-212300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300" } ], "reference": [ { "type": "PubMed", "id": "31086175", "url": "https://glygen.org/publication/PubMed/31086175" } ] }, { "title": "Identification of Immunodominant HIV-1 Epitopes Presented by HLA-C*12:02, a Protective Allele, Using an Immunopeptidomics Approach.", "journal": "Journal of virology", "date": "2019-09-01", "authors": "Chikata Takayuki, Paes Wayne, Akahoshi Tomohiro, Partridge Thomas, Murakoshi Hayato, Gatanaga Hiroyuki, Ternette Nicola, Oka Shinichi, Borrow Persephone, Takiguchi Masafumi", "evidence": [ { "database": "IEDB", "id": "438080", "url": "https://www.iedb.org/epitope/438080" }, { "database": "IEDB", "id": "468489", "url": "https://www.iedb.org/epitope/468489" } ], "reference": [ { "type": "PubMed", "id": "31217245", "url": "https://glygen.org/publication/PubMed/31217245" } ] }, { "title": "Structure of KAP1 tripartite motif identifies molecular interfaces required for retroelement silencing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Stoll GA, Oda SI, Chong ZS, Yu M, McLaughlin SH, Modis Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "31289231", "url": "https://glygen.org/publication/PubMed/31289231" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "KAP1 is an antiparallel dimer with a functional asymmetry.", "journal": "Life science alliance", "date": "2019", "authors": "Fonti G, Marcaida MJ, Bryan LC, Trager S, Kalantzi AS, Helleboid PJ, Demurtas D, Tully MD, Grudinin S, Trono D, Fierz B, Dal Peraro M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "31427381", "url": "https://glygen.org/publication/PubMed/31427381" } ] }, { "title": "VRK1 functional insufficiency due to alterations in protein stability or kinase activity of human VRK1 pathogenic variants implicated in neuromotor syndromes.", "journal": "Scientific reports", "date": "2019", "authors": "Martin-Doncel E, Rojas AM, Cantarero L, Lazo PA", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "31527692", "url": "https://glygen.org/publication/PubMed/31527692" } ] }, { "title": "Glutarylation of Histone H4 Lysine 91 Regulates Chromatin Dynamics.", "journal": "Molecular cell", "date": "2019", "authors": "Bao X, Liu Z, Zhang W, Gladysz K, Fung YME, Tian G, Xiong Y, Wong JWH, Yuen KWY, Li XD", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "31542297", "url": "https://glygen.org/publication/PubMed/31542297" } ] }, { "title": "Metabolic regulation of gene expression by histone lactylation.", "journal": "Nature", "date": "2019", "authors": "Zhang D, Tang Z, Huang H, Zhou G, Cui C, Weng Y, Liu W, Kim S, Lee S, Perez-Neut M, Ding J, Czyz D, Hu R, Ye Z, He M, Zheng YG, Shuman HA, Dai L, Ren B, Roeder RG, Becker L, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "31645732", "url": "https://glygen.org/publication/PubMed/31645732" } ] }, { "title": "TCF19 Promotes Cell Proliferation through Binding to the Histone H3K4me3 Mark.", "journal": "Biochemistry", "date": "2020", "authors": "Mondal P, Sen S, Klein BJ, Tiwary N, Gadad SS, Kutateladze TG, Roy S, Das C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "31746185", "url": "https://glygen.org/publication/PubMed/31746185" } ] }, { "title": "A large peptidome dataset improves HLA class I epitope prediction across most of the human population.", "journal": "Nature biotechnology", "date": "2020-02", "authors": "Sarkizova Siranush, Klaeger Susan, Le Phuong M, Li Letitia W, Oliveira Giacomo, Keshishian Hasmik, Hartigan Christina R, Zhang Wandi, Braun David A, Ligon Keith L, Bachireddy Pavan, Zervantonakis Ioannis K, Rosenbluth Jennifer M, Ouspenskaia Tamara, Law Travis, Justesen Sune, Stevens Jonathan, Lane William J, Eisenhaure Thomas, Lan Zhang Guang, Clauser Karl R, Hacohen Nir, Carr Steven A, Wu Catherine J, Keskin Derin B", "evidence": [ { "database": "IEDB", "id": "143126", "url": "https://www.iedb.org/epitope/143126" }, { "database": "IEDB", "id": "162519", "url": "https://www.iedb.org/epitope/162519" }, { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "240787", "url": "https://www.iedb.org/epitope/240787" }, { "database": "IEDB", "id": "418519", "url": "https://www.iedb.org/epitope/418519" }, { "database": "IEDB", "id": "435791", "url": "https://www.iedb.org/epitope/435791" }, { "database": "IEDB", "id": "438080", "url": "https://www.iedb.org/epitope/438080" }, { "database": "IEDB", "id": "438321", "url": "https://www.iedb.org/epitope/438321" }, { "database": "IEDB", "id": "439937", "url": "https://www.iedb.org/epitope/439937" }, { "database": "IEDB", "id": "441064", "url": "https://www.iedb.org/epitope/441064" }, { "database": "IEDB", "id": "444045", "url": "https://www.iedb.org/epitope/444045" }, { "database": "IEDB", "id": "448090", "url": "https://www.iedb.org/epitope/448090" }, { "database": "IEDB", "id": "468489", "url": "https://www.iedb.org/epitope/468489" }, { "database": "IEDB", "id": "485145", "url": "https://www.iedb.org/epitope/485145" }, { "database": "IEDB", "id": "488976", "url": "https://www.iedb.org/epitope/488976" }, { "database": "IEDB", "id": "506018", "url": "https://www.iedb.org/epitope/506018" }, { "database": "IEDB", "id": "547059", "url": "https://www.iedb.org/epitope/547059" }, { "database": "IEDB", "id": "588131", "url": "https://www.iedb.org/epitope/588131" }, { "database": "IEDB", "id": "606845", "url": "https://www.iedb.org/epitope/606845" }, { "database": "IEDB", "id": "633782", "url": "https://www.iedb.org/epitope/633782" }, { "database": "IEDB", "id": "711049", "url": "https://www.iedb.org/epitope/711049" }, { "database": "IEDB", "id": "721745", "url": "https://www.iedb.org/epitope/721745" }, { "database": "IEDB", "id": "775322", "url": "https://www.iedb.org/epitope/775322" }, { "database": "IEDB", "id": "925373", "url": "https://www.iedb.org/epitope/925373" }, { "database": "IEDB", "id": "929554", "url": "https://www.iedb.org/epitope/929554" }, { "database": "IEDB", "id": "1001619", "url": "https://www.iedb.org/epitope/1001619" }, { "database": "IEDB", "id": "1001620", "url": "https://www.iedb.org/epitope/1001620" }, { "database": "IEDB", "id": "1021376", "url": "https://www.iedb.org/epitope/1021376" }, { "database": "IEDB", "id": "1036870", "url": "https://www.iedb.org/epitope/1036870" }, { "database": "IEDB", "id": "1043608", "url": "https://www.iedb.org/epitope/1043608" }, { "database": "IEDB", "id": "1047209", "url": "https://www.iedb.org/epitope/1047209" } ], "reference": [ { "type": "PubMed", "id": "31844290", "url": "https://glygen.org/publication/PubMed/31844290" } ] }, { "title": "JAK3 inhibitors based on thieno[3,2-d]pyrimidine scaffold: design, synthesis and bioactivity evaluation for the treatment of B-cell lymphoma.", "journal": "Bioorganic chemistry", "date": "2020", "authors": "Chi F, Chen L, Wang C, Li L, Sun X, Xu Y, Ma T, Liu K, Ma X, Shu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "31918398", "url": "https://glygen.org/publication/PubMed/31918398" } ] }, { "title": "ADORA1 Inhibition Promotes Tumor Immune Evasion by Regulating the ATF3-PD-L1 Axis.", "journal": "Cancer cell", "date": "2020", "authors": "Liu H, Kuang X, Zhang Y, Ye Y, Li J, Liang L, Xie Z, Weng L, Guo J, Li H, Ma F, Chen X, Zhao S, Su J, Yang N, Fang F, Xie Y, Tao J, Zhang J, Chen M, Peng C, Sun L, Zhang X, Liu J, Han L, Xu X, Hung MC, Chen X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9909649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9909649" } ], "reference": [ { "type": "PubMed", "id": "32183950", "url": "https://glygen.org/publication/PubMed/32183950" } ] }, { "title": "Gasdermin E suppresses tumour growth by activating anti-tumour immunity.", "journal": "Nature", "date": "2020", "authors": "Zhang Z, Zhang Y, Xia S, Kong Q, Li S, Liu X, Junqueira C, Meza-Sosa KF, Mok TMY, Ansara J, Sengupta S, Yao Y, Wu H, Lieberman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9710421", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421" } ], "reference": [ { "type": "PubMed", "id": "32188940", "url": "https://glygen.org/publication/PubMed/32188940" } ] }, { "title": "Dopaminylation of histone H3 in ventral tegmental area regulates cocaine seeking.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Lepack AE, Werner CT, Stewart AF, Fulton SL, Zhong P, Farrelly LA, Smith ACW, Ramakrishnan A, Lyu Y, Bastle RM, Martin JA, Mitra S, O'Connor RM, Wang ZJ, Molina H, Turecki G, Shen L, Yan Z, Calipari ES, Dietz DM, Kenny PJ, Maze I", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "32273471", "url": "https://glygen.org/publication/PubMed/32273471" } ] }, { "title": "Neutrophil extracellular traps in COVID-19.", "journal": "JCI insight", "date": "2020-06-04", "authors": "Zuo Yu, Yalavarthi Srilakshmi, Shi Hui, Gockman Kelsey, Zuo Melanie, Madison Jacqueline A, Blair Christopher, Weber Andrew, Barnes Betsy J, Egeblad Mikala, Woods Robert J, Kanthi Yogendra, Knight Jason S", "evidence": [ { "database": "BiomarkerKB", "id": "AN6379-1", "url": "https://biomarkerkb.org/biomarker/AN6379-1" } ], "reference": [ { "type": "PubMed", "id": "32329756", "url": "https://glygen.org/publication/PubMed/32329756" } ] }, { "title": "Immunopeptidome Analysis of HLA-DPB1 Allelic Variants Reveals New Functional Hierarchies.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2020-06-15", "authors": "van Balen Peter, Kester Michel G D, de Klerk Wendy, Crivello Pietro, Arrieta-Bola\u00f1os Esteban, de Ru Arnoud H, Jedema Inge, Mohammed Yassene, Heemskerk Mirjam H M, Fleischhauer Katharina, van Veelen Peter A, Falkenburg J H Frederik", "evidence": [ { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "441064", "url": "https://www.iedb.org/epitope/441064" }, { "database": "IEDB", "id": "492926", "url": "https://www.iedb.org/epitope/492926" }, { "database": "IEDB", "id": "555825", "url": "https://www.iedb.org/epitope/555825" }, { "database": "IEDB", "id": "606984", "url": "https://www.iedb.org/epitope/606984" }, { "database": "IEDB", "id": "606985", "url": "https://www.iedb.org/epitope/606985" }, { "database": "IEDB", "id": "767963", "url": "https://www.iedb.org/epitope/767963" }, { "database": "IEDB", "id": "1125883", "url": "https://www.iedb.org/epitope/1125883" }, { "database": "IEDB", "id": "1125884", "url": "https://www.iedb.org/epitope/1125884" }, { "database": "IEDB", "id": "1127267", "url": "https://www.iedb.org/epitope/1127267" }, { "database": "IEDB", "id": "1127268", "url": "https://www.iedb.org/epitope/1127268" }, { "database": "IEDB", "id": "1130434", "url": "https://www.iedb.org/epitope/1130434" }, { "database": "IEDB", "id": "1133155", "url": "https://www.iedb.org/epitope/1133155" }, { "database": "IEDB", "id": "1133156", "url": "https://www.iedb.org/epitope/1133156" }, { "database": "IEDB", "id": "1133157", "url": "https://www.iedb.org/epitope/1133157" }, { "database": "IEDB", "id": "1133158", "url": "https://www.iedb.org/epitope/1133158" }, { "database": "IEDB", "id": "1135481", "url": "https://www.iedb.org/epitope/1135481" }, { "database": "IEDB", "id": "1135868", "url": "https://www.iedb.org/epitope/1135868" }, { "database": "IEDB", "id": "1135869", "url": "https://www.iedb.org/epitope/1135869" }, { "database": "IEDB", "id": "1137286", "url": "https://www.iedb.org/epitope/1137286" }, { "database": "IEDB", "id": "1137404", "url": "https://www.iedb.org/epitope/1137404" }, { "database": "IEDB", "id": "1137405", "url": "https://www.iedb.org/epitope/1137405" }, { "database": "IEDB", "id": "1148288", "url": "https://www.iedb.org/epitope/1148288" }, { "database": "IEDB", "id": "1148289", "url": "https://www.iedb.org/epitope/1148289" }, { "database": "IEDB", "id": "1149710", "url": "https://www.iedb.org/epitope/1149710" }, { "database": "IEDB", "id": "1154378", "url": "https://www.iedb.org/epitope/1154378" }, { "database": "IEDB", "id": "1167769", "url": "https://www.iedb.org/epitope/1167769" }, { "database": "IEDB", "id": "1167770", "url": "https://www.iedb.org/epitope/1167770" }, { "database": "IEDB", "id": "1172842", "url": "https://www.iedb.org/epitope/1172842" }, { "database": "IEDB", "id": "1172843", "url": "https://www.iedb.org/epitope/1172843" }, { "database": "IEDB", "id": "1172844", "url": "https://www.iedb.org/epitope/1172844" }, { "database": "IEDB", "id": "1172845", "url": "https://www.iedb.org/epitope/1172845" }, { "database": "IEDB", "id": "1176984", "url": "https://www.iedb.org/epitope/1176984" } ], "reference": [ { "type": "PubMed", "id": "32350084", "url": "https://glygen.org/publication/PubMed/32350084" } ] }, { "title": "In-depth mining of the immunopeptidome of an acute myeloid leukemia cell line using complementary ligand enrichment and data acquisition strategies.", "journal": "Molecular immunology", "date": "2020-07", "authors": "Pandey Kirti, Mifsud Nicole A, Lim Kam Sian Terry C C, Ayala Rochelle, Ternette Nicola, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "55785", "url": "https://www.iedb.org/epitope/55785" }, { "database": "IEDB", "id": "143126", "url": "https://www.iedb.org/epitope/143126" }, { "database": "IEDB", "id": "221761", "url": "https://www.iedb.org/epitope/221761" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "236257", "url": "https://www.iedb.org/epitope/236257" }, { "database": "IEDB", "id": "241271", "url": "https://www.iedb.org/epitope/241271" }, { "database": "IEDB", "id": "241481", "url": "https://www.iedb.org/epitope/241481" }, { "database": "IEDB", "id": "438321", "url": "https://www.iedb.org/epitope/438321" }, { "database": "IEDB", "id": "444045", "url": "https://www.iedb.org/epitope/444045" }, { "database": "IEDB", "id": "489000", "url": "https://www.iedb.org/epitope/489000" }, { "database": "IEDB", "id": "489132", "url": "https://www.iedb.org/epitope/489132" }, { "database": "IEDB", "id": "494708", "url": "https://www.iedb.org/epitope/494708" }, { "database": "IEDB", "id": "630283", "url": "https://www.iedb.org/epitope/630283" }, { "database": "IEDB", "id": "778670", "url": "https://www.iedb.org/epitope/778670" }, { "database": "IEDB", "id": "1364264", "url": "https://www.iedb.org/epitope/1364264" } ], "reference": [ { "type": "PubMed", "id": "32387766", "url": "https://glygen.org/publication/PubMed/32387766" } ] }, { "title": "Multiplexed relative and absolute quantitative immunopeptidomics reveals MHC I repertoire alterations induced by CDK4/6 inhibition.", "journal": "Nature communications", "date": "2020-06-02", "authors": "Stopfer Lauren E, Mesfin Joshua M, Joughin Brian A, Lauffenburger Douglas A, White Forest M", "evidence": [ { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "224167", "url": "https://www.iedb.org/epitope/224167" }, { "database": "IEDB", "id": "439937", "url": "https://www.iedb.org/epitope/439937" }, { "database": "IEDB", "id": "441064", "url": "https://www.iedb.org/epitope/441064" }, { "database": "IEDB", "id": "568135", "url": "https://www.iedb.org/epitope/568135" }, { "database": "IEDB", "id": "568615", "url": "https://www.iedb.org/epitope/568615" } ], "reference": [ { "type": "PubMed", "id": "32488085", "url": "https://glygen.org/publication/PubMed/32488085" } ] }, { "title": "Methylation-directed glycosylation of chromatin factors represses retrotransposon promoters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Boulard M, Rucli S, Edwards JR, Bestor TH", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" } ], "reference": [ { "type": "PubMed", "id": "32522876", "url": "https://glygen.org/publication/PubMed/32522876" } ] }, { "title": "The dynamic nature of the human origin recognition complex revealed through five cryoEM structures.", "journal": "eLife", "date": "2020", "authors": "Jaremko MJ, On KF, Thomas DR, Stillman B, Joshua-Tor L", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "32808929", "url": "https://glygen.org/publication/PubMed/32808929" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "\u03b2-Catenin induces transcriptional expression of PD-L1 to promote glioblastoma immune evasion.", "journal": "The Journal of experimental medicine", "date": "2020-11-02", "authors": "Du Linyong, Lee Jong-Ho, Jiang Hongfei, Wang Chengde, Wang Silu, Zheng Zhihong, Shao Fei, Xu Daqian, Xia Yan, Li Jing, Zheng Yanhua, Qian Xu, Li Xinjian, Kim Hyung-Ryong, Xing Dongming, Liu Pengyuan, Lu Zhimin, Lyu Jianxin", "evidence": [ { "database": "Reactome", "id": "R-HSA-9909649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9909649" } ], "reference": [ { "type": "PubMed", "id": "32860047", "url": "https://glygen.org/publication/PubMed/32860047" } ] }, { "title": "Structural basis for the inhibition of cGAS by nucleosomes.", "journal": "Science", "date": "2020", "authors": "Kujirai T, Zierhut C, Takizawa Y, Kim R, Negishi L, Uruma N, Hirai S, Funabiki H, Kurumizaka H", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "32912999", "url": "https://glygen.org/publication/PubMed/32912999" } ] }, { "title": "Periphilin self-association underpins epigenetic silencing by the HUSH complex.", "journal": "Nucleic acids research", "date": "2020", "authors": "Prigozhin DM, Douse CH, Farleigh LE, Albecka A, Tchasovnikarova IA, Timms RT, Oda SI, Adolf F, Freund SMV, Maslen S, Lehner PJ, Modis Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "32976585", "url": "https://glygen.org/publication/PubMed/32976585" } ] }, { "title": "TASOR is a pseudo-PARP that directs HUSH complex assembly and epigenetic transposon control.", "journal": "Nature communications", "date": "2020", "authors": "Douse CH, Tchasovnikarova IA, Timms RT, Protasio AV, Seczynska M, Prigozhin DM, Albecka A, Wagstaff J, Williamson JC, Freund SMV, Lehner PJ, Modis Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843970", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970" } ], "reference": [ { "type": "PubMed", "id": "33009411", "url": "https://glygen.org/publication/PubMed/33009411" } ] }, { "title": "Borrelia burgdorferi-Induced Changes in the Class II Self-Immunopeptidome Displayed on HLA-DR Molecules Expressed by Dendritic Cells.", "journal": "Frontiers in medicine", "date": "2020", "authors": "Gutierrez-Hoffmann Maria G, O'Meally Robert N, Cole Robert N, Tiniakou Eleni, Darrah Erika, Soloski Mark J", "evidence": [ { "database": "IEDB", "id": "606984", "url": "https://www.iedb.org/epitope/606984" }, { "database": "IEDB", "id": "1385258", "url": "https://www.iedb.org/epitope/1385258" } ], "reference": [ { "type": "PubMed", "id": "33043033", "url": "https://glygen.org/publication/PubMed/33043033" } ] }, { "title": "Structural basis for nucleosome-mediated inhibition of cGAS activity.", "journal": "Cell Res.", "date": "2020", "authors": "Cao D, Han X, Fan X, Xu RM, Zhang X", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "33051594", "url": "https://glygen.org/publication/PubMed/33051594" } ] }, { "title": "Bridging of nucleosome-proximal DNA double-strand breaks by PARP2 enhances its interaction with HPF1.", "journal": "PLoS ONE", "date": "2020", "authors": "Gaullier G, Roberts G, Muthurajan UM, Bowerman S, Rudolph J, Mahadevan J, Jha A, Rae PS, Luger K", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "33141820", "url": "https://glygen.org/publication/PubMed/33141820" } ] }, { "title": "Dengue virus infection impedes megakaryopoiesis in MEG-01 cells where the virus envelope protein interacts with the transcription factor TAL-1.", "journal": "Scientific reports", "date": "2020", "authors": "Banerjee A, Tripathi A, Duggal S, Banerjee A, Vrati S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "33177556", "url": "https://glygen.org/publication/PubMed/33177556" } ] }, { "title": "The topology of chromatin-binding domains in the NuRD deacetylase complex.", "journal": "Nucleic acids research", "date": "2020", "authors": "Millard CJ, Fairall L, Ragan TJ, Savva CG, Schwabe JWR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "33264408", "url": "https://glygen.org/publication/PubMed/33264408" } ] }, { "title": "Cross-linking mass spectrometry reveals the structural topology of peripheral NuRD subunits relative to the core complex.", "journal": "The FEBS journal", "date": "2021-05", "authors": "Spruijt Cornelia G, Gr\u00e4we Cathrin, Kleinendorst Simone C, Baltissen Marijke P A, Vermeulen Michiel", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "33283408", "url": "https://glygen.org/publication/PubMed/33283408" } ] }, { "title": "Structural insight into the assembly and conformational activation of human origin recognition complex.", "journal": "Cell discovery", "date": "2020", "authors": "Cheng J, Li N, Wang X, Hu J, Zhai Y, Gao N", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "33298899", "url": "https://glygen.org/publication/PubMed/33298899" } ] }, { "title": "PPAR\u03b3 S273 Phosphorylation Modifies the Dynamics of Coregulator Proteins Recruitment.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Dias Marieli Mariano Gon\u00e7alves, Batista Fernanda Aparecida Heleno, Tittanegro Thais Helena, de Oliveira Andr\u00e9 Gustavo, Le Maire Albane, Torres Felipe Rafael, Filho Helder Veras Ribeiro, Silveira Leonardo Reis, Figueira Ana Carolina Migliorini", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "33329381", "url": "https://glygen.org/publication/PubMed/33329381" } ] }, { "title": "Distinct Ring1b complexes defined by DEAD-box helicases and EMT transcription factors synergistically enhance E-cadherin silencing in breast cancer.", "journal": "Cell death & disease", "date": "2021", "authors": "Wang Y, Sun Y, Shang C, Chen L, Chen H, Wang D, Zeng X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "33608512", "url": "https://glygen.org/publication/PubMed/33608512" } ] }, { "title": "ERAP2 Increases the Abundance of a Peptide Submotif Highly Selective for the Birdshot Uveitis-Associated HLA-A29.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Venema Wouter J, Hiddingh Sanne, de Boer Joke H, Claas Frans H J, Mulder Arend, den Hollander Anneke I, Stratikos Efstratios, Sarkizova Siranush, van der Veken Lars T, Janssen George M C, van Veelen Peter A, Kuiper Jonas J W", "evidence": [ { "database": "IEDB", "id": "1402716", "url": "https://www.iedb.org/epitope/1402716" } ], "reference": [ { "type": "PubMed", "id": "33717175", "url": "https://glygen.org/publication/PubMed/33717175" } ] }, { "title": "Investigation of the Interaction of Human Origin Recognition Complex Subunit 1 with G-Quadruplex DNAs of Human c-myc Promoter and Telomere Regions.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Eladl A, Yamaoki Y, Hoshina S, Horinouchi H, Kondo K, Waga S, Nagata T, Katahira M", "evidence": [ { "database": "Reactome", "id": "R-HSA-68616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616" } ], "reference": [ { "type": "PubMed", "id": "33801762", "url": "https://glygen.org/publication/PubMed/33801762" } ] }, { "title": "IFN\u03b3 Modulates the Immunopeptidome of Triple Negative Breast Cancer Cells by Enhancing and Diversifying Antigen Processing and Presentation.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Goncalves Gabriel, Mullan Kerry A, Duscharla Divya, Ayala Rochelle, Croft Nathan P, Faridi Pouya, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "489132", "url": "https://www.iedb.org/epitope/489132" } ], "reference": [ { "type": "PubMed", "id": "33968037", "url": "https://glygen.org/publication/PubMed/33968037" } ] }, { "title": "CSPG4 Is a Potential Therapeutic Target in Anaplastic Thyroid Cancer.", "journal": "Thyroid : official journal of the American Thyroid Association", "date": "2021", "authors": "Egan CE, Stefanova D, Ahmed A, Raja VJ, Thiesmeyer JW, Chen KJ, Greenberg JA, Zhang T, He B, Finnerty BM, Zarnegar R, Jin MM, Scognamiglio T, Dephoure N, Fahey T 3rd, Min IM", "evidence": [ { "database": "IEDB", "id": "441529", "url": "https://www.iedb.org/epitope/441529" } ], "reference": [ { "type": "PubMed", "id": "34078123", "url": "https://glygen.org/publication/PubMed/34078123" } ] }, { "title": "Regulated expression of a gene encoding a nuclear factor, IRF-1, that specifically binds to IFN-beta gene regulatory elements.", "journal": "Cell", "date": "1988", "authors": "Miyamoto M, Fujita T, Kimura Y, Maruyama M, Harada H, Sudo Y, Miyata T, Taniguchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "3409321", "url": "https://glygen.org/publication/PubMed/3409321" } ] }, { "title": "Proteogenomic identification of an immunogenic HLA class I neoantigen in mismatch repair-deficient colorectal cancer tissue.", "journal": "JCI insight", "date": "2021-07-22", "authors": "Hirama Tomomi, Tokita Serina, Nakatsugawa Munehide, Murata Kenji, Nannya Yasuhito, Matsuo Kazuhiko, Inoko Hidetoshi, Hirohashi Yoshihiko, Hashimoto Shinichi, Ogawa Seishi, Takemasa Ichiro, Sato Noriyuki, Hata Fumitake, Kanaseki Takayuki, Torigoe Toshihiko", "evidence": [ { "database": "IEDB", "id": "418519", "url": "https://www.iedb.org/epitope/418519" }, { "database": "IEDB", "id": "1047209", "url": "https://www.iedb.org/epitope/1047209" } ], "reference": [ { "type": "PubMed", "id": "34185709", "url": "https://glygen.org/publication/PubMed/34185709" } ] }, { "title": "Immunopeptidogenomics: Harnessing RNA-Seq to Illuminate the Dark Immunopeptidome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Scull Katherine E, Pandey Kirti, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "489132", "url": "https://www.iedb.org/epitope/489132" } ], "reference": [ { "type": "PubMed", "id": "34509645", "url": "https://glygen.org/publication/PubMed/34509645" } ] }, { "title": "Isonicotinylation is a histone mark induced by the anti-tuberculosis first-line drug isoniazid.", "journal": "Nature communications", "date": "2021-09-20", "authors": "Jiang Yuhan, Li Yixiao, Liu Cheng, Zhang Lei, Lv Danyu, Weng Yejing, Cheng Zhongyi, Chen Xiangmei, Zhan Jun, Zhang Hongquan", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "34545082", "url": "https://glygen.org/publication/PubMed/34545082" } ] }, { "title": "Completion of the primary structure of human high-molecular-mass kininogen. The amino acid sequence of the entire heavy chain and evidence for its evolution by gene triplication.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Kellermann J, Lottspeich F, Henschen A, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "3484703", "url": "https://glygen.org/publication/PubMed/3484703" } ] }, { "title": "Serine ADP-ribosylation marks nucleosomes for ALC1-dependent chromatin remodeling.", "journal": "eLife", "date": "2021", "authors": "Mohapatra J, Tashiro K, Beckner RL, Sierra J, Kilgore JA, Williams NS, Liszczak G", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "34874266", "url": "https://glygen.org/publication/PubMed/34874266" } ] }, { "title": "Histone lysine methacrylation is a dynamic post-translational modification regulated by HAT1 and SIRT2.", "journal": "Cell discovery", "date": "2021-12-28", "authors": "Delaney Kyle, Tan Minjia, Zhu Zhesi, Gao Jinjun, Dai Lunzhi, Kim Sunjoo, Ding Jun, He Maomao, Halabelian Levon, Yang Lu, Nagarajan Prabakaran, Parthun Mark Robert, Lee Sangkyu, Khochbin Saadi, Zheng Yujun George, Zhao Yingming", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "34961760", "url": "https://glygen.org/publication/PubMed/34961760" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "TdIF1-LSD1 Axis Regulates Epithelial-Mesenchymal Transition and Metastasis via Histone Demethylation of E-Cadherin Promoter in Lung Cancer.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Liu Q, Xiong J, Xu D, Hao N, Zhang Y, Sang Y, Wang Z, Zheng X, Min J, Diao H, Raphael J, Maleki Vareki S, Koropatnick J, Min W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "35008676", "url": "https://glygen.org/publication/PubMed/35008676" } ] }, { "title": "ZEB1 recruits BRG1 to regulate airway remodelling epithelial-to-mesenchymal transition in asthma.", "journal": "Experimental physiology", "date": "2022", "authors": "Wang T, Peng B, Luo T, Tian D, Zhao Z, Fu Z, Li Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "35138000", "url": "https://glygen.org/publication/PubMed/35138000" } ] }, { "title": "Dengue and Zika Virus Capsid Proteins Contain a Common PEX19-Binding Motif.", "journal": "Viruses", "date": "2022", "authors": "Farelo MA, Korrou-Karava D, Brooks KF, Russell TA, Maringer K, Mayerhofer PU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9918481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481" } ], "reference": [ { "type": "PubMed", "id": "35215846", "url": "https://glygen.org/publication/PubMed/35215846" } ] }, { "title": "PPP1R26 drives hepatocellular carcinoma progression by controlling glycolysis and epithelial-mesenchymal transition.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2022-03-15", "authors": "Yang Yang, Ren Pengwei, Liu Xiaofeng, Sun Xiaoyan, Zhang Chunfeng, Du Xiaojuan, Xing Baocai", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "35292107", "url": "https://glygen.org/publication/PubMed/35292107" } ] }, { "title": "Rolling back human pluripotent stem cells to an eight-cell embryo-like stage.", "journal": "Nature", "date": "2022-05", "authors": "Mazid Md Abdul, Ward Carl, Luo Zhiwei, Liu Chuanyu, Li Yunpan, Lai Yiwei, Wu Liang, Li Jinxiu, Jia Wenqi, Jiang Yu, Liu Hao, Fu Lixin, Yang Yueli, Iba\u00f1ez David P, Lai Junjian, Wei Xiaoyu, An Juan, Guo Pengcheng, Yuan Yue, Deng Qiuting, Wang Yang, Liu Ying, Gao Fei, Wang Junwen, Zaman Shahriar, Qin Baoming, Wu Guangming, Maxwell Patrick H, Xu Xun, Liu Longqi, Li Wenjuan, Esteban Miguel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "35314832", "url": "https://glygen.org/publication/PubMed/35314832" } ] }, { "title": "Unmasking the suppressed immunopeptidome of EZH2-mutated diffuse large B-cell lymphomas through combination drug treatment.", "journal": "Blood advances", "date": "2022-07-26", "authors": "Bourne Christopher M, Mun Sung Soo, Dao Tao, Aretz Zita E H, Molvi Zaki, Gejman Ron S, Daman Andrew, Takata Katsuyoshi, Steidl Christian, Klatt Martin G, Scheinberg David A", "evidence": [ { "database": "IEDB", "id": "640330", "url": "https://www.iedb.org/epitope/640330" } ], "reference": [ { "type": "PubMed", "id": "35561310", "url": "https://glygen.org/publication/PubMed/35561310" } ] }, { "title": "Kaiso phosphorylation at threonine 606 leads to its accumulation in the cytoplasm, reducing its transcriptional repression of the tumour suppressor CDH1.", "journal": "Molecular oncology", "date": "2022", "authors": "Tian W, Yuan H, Qin S, Liu W, Zhang B, Gu L, Zhou J, Deng D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725" } ], "reference": [ { "type": "PubMed", "id": "35851744", "url": "https://glygen.org/publication/PubMed/35851744" } ] }, { "title": "Potent Activation of NAD+-Dependent Deacetylase Sirt7 by Nucleosome Binding.", "journal": "ACS chemical biology", "date": "2022-08-19", "authors": "Kuznetsov Vyacheslav I, Liu Wallace H, Klein Mark A, Denu John M", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "35939806", "url": "https://glygen.org/publication/PubMed/35939806" } ] }, { "title": "The Role of PHF6 in Hematopoiesis and Hematologic Malignancies.", "journal": "Stem cell reviews and reports", "date": "2022-08-26", "authors": "Eisa Yusra A, Guo Ying, Yang Feng-Chun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "36008597", "url": "https://glygen.org/publication/PubMed/36008597" } ] }, { "title": "The Autophagy Receptor TAX1BP1 (T6BP) improves antigen presentation by MHC-II molecules.", "journal": "EMBO reports", "date": "2022-12-06", "authors": "Sarango Gabriela, Richetta Cl\u00e9mence, Pereira Mathias, Kumari Anita, Ghosh Michael, Bertrand Lisa, Pionneau C\u00e9dric, Le Gall Morgane, Gr\u00e9goire Sylvie, Jeger-Madiot Rapha\u00ebl, Rosoy Elina, Subra Fr\u00e9d\u00e9ric, Delelis Olivier, Faure Mathias, Esclatine Audrey, Graff-Dubois St\u00e9phanie, Stevanovi\u0107 Stefan, Manoury B\u00e9n\u00e9dicte, Ramirez Bertha Cecilia, Moris Arnaud", "evidence": [ { "database": "IEDB", "id": "556494", "url": "https://www.iedb.org/epitope/556494" }, { "database": "IEDB", "id": "556752", "url": "https://www.iedb.org/epitope/556752" }, { "database": "IEDB", "id": "1127267", "url": "https://www.iedb.org/epitope/1127267" }, { "database": "IEDB", "id": "1127268", "url": "https://www.iedb.org/epitope/1127268" }, { "database": "IEDB", "id": "1154378", "url": "https://www.iedb.org/epitope/1154378" } ], "reference": [ { "type": "PubMed", "id": "36215666", "url": "https://glygen.org/publication/PubMed/36215666" } ] }, { "title": "Direct identification of HLA class I and class II-restricted T cell epitopes in pancreatic cancer tissues by mass spectrometry.", "journal": "Journal of hematology & oncology", "date": "2022-10-25", "authors": "Fujiwara Kenji, Shao Yingkuan, Niu Nan, Zhang Tengyi, Herbst Brian, Henderson Mackenzie, Muth Stephen, Zhang Pingbo, Zheng Lei", "evidence": [ { "database": "IEDB", "id": "55785", "url": "https://www.iedb.org/epitope/55785" }, { "database": "IEDB", "id": "219933", "url": "https://www.iedb.org/epitope/219933" }, { "database": "IEDB", "id": "223695", "url": "https://www.iedb.org/epitope/223695" }, { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" }, { "database": "IEDB", "id": "241271", "url": "https://www.iedb.org/epitope/241271" }, { "database": "IEDB", "id": "441064", "url": "https://www.iedb.org/epitope/441064" }, { "database": "IEDB", "id": "485145", "url": "https://www.iedb.org/epitope/485145" }, { "database": "IEDB", "id": "606845", "url": "https://www.iedb.org/epitope/606845" }, { "database": "IEDB", "id": "721745", "url": "https://www.iedb.org/epitope/721745" } ], "reference": [ { "type": "PubMed", "id": "36284347", "url": "https://glygen.org/publication/PubMed/36284347" } ] }, { "title": "Investigation of in vitro histone H3 glycosylation using H3 tail peptides.", "journal": "Scientific reports", "date": "2022-11-10", "authors": "Merx Jona, Hintzen Jordi C J, Proietti Giordano, Elferink Hidde, Wang Yali, Porzberg Miriam R B, Sondag Daan, Bilgin Nurg\u00fcl, Park Jin, Mecinovi\u0107 Jasmin, Boltje Thomas J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" } ], "reference": [ { "type": "PubMed", "id": "36357422", "url": "https://glygen.org/publication/PubMed/36357422" } ] }, { "title": "Structural basis of RNA polymerase II transcription on the chromatosome containing linker histone H1.", "journal": "Nat. Commun.", "date": "2022", "authors": "Takizawa Y., Kurumizaka H., Uejima T., Hirano R., Kujirai T., Sekine S.I., Ehara H.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "36435862", "url": "https://glygen.org/publication/PubMed/36435862" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "H3K4me3 remodeling induced acquired resistance through O-GlcNAc transferase.", "journal": "Drug resistance updates : reviews and commentaries in antimicrobial and anticancer chemotherapy", "date": "2023-08-10", "authors": "Ravindran Menon Dinoop, Hammerlindl Heinz, Gimenez Gregory, Hammerlindl Sabrina, Zuegner Elmar, Torrano Joachim, Bordag Natalie, Emran Abdullah Al, Giam Maybelline, Denil Simon, Pavelka Norman, Tan Aik-Choon, Sturm Richard A, Haass Nikolas K, Rancati Giulia, Herlyn Meenhard, Magnes Christoph, Eccles Michael R, Fujita Mayumi, Schaider Helmut", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" } ], "reference": [ { "type": "PubMed", "id": "37639774", "url": "https://glygen.org/publication/PubMed/37639774" } ] }, { "title": "TNRC18 engages H3K9me3 to mediate silencing of endogenous retrotransposons.", "journal": "Nature", "date": "2023-11", "authors": "Zhao Shuai, Lu Jiuwei, Pan Bo, Fan Huitao, Byrum Stephanie D, Xu Chenxi, Kim Arum, Guo Yiran, Kanchi Krishna L, Gong Weida, Sun Tongyu, Storey Aaron J, Burkholder Nathaniel T, Mackintosh Samuel G, Kuhlers Peyton C, Edmondson Ricky D, Strahl Brian D, Diao Yarui, Tackett Alan J, Raab Jesse R, Cai Ling, Song Jikui, Wang Gang Greg", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "37938770", "url": "https://glygen.org/publication/PubMed/37938770" } ] }, { "title": "Targeting of intracellular oncoproteins with peptide-centric CARs.", "journal": "Nature", "date": "2023-11", "authors": "Yarmarkovich Mark, Marshall Quinlen F, Warrington John M, Premaratne Rasika, Farrel Alvin, Groff David, Li Wei, di Marco Moreno, Runbeck Erin, Truong Hau, Toor Jugmohit S, Tripathi Sarvind, Nguyen Son, Shen Helena, Noel Tiffany, Church Nicole L, Weiner Amber, Kendsersky Nathan, Martinez Dan, Weisberg Rebecca, Christie Molly, Eisenlohr Laurence, Bosse Kristopher R, Dimitrov Dimiter S, Stevanovic Stefan, Sgourakis Nikolaos G, Kiefel Ben R, Maris John M", "evidence": [ { "database": "IEDB", "id": "418519", "url": "https://www.iedb.org/epitope/418519" }, { "database": "IEDB", "id": "439018", "url": "https://www.iedb.org/epitope/439018" }, { "database": "IEDB", "id": "568135", "url": "https://www.iedb.org/epitope/568135" }, { "database": "IEDB", "id": "568615", "url": "https://www.iedb.org/epitope/568615" }, { "database": "IEDB", "id": "568909", "url": "https://www.iedb.org/epitope/568909" }, { "database": "IEDB", "id": "721745", "url": "https://www.iedb.org/epitope/721745" }, { "database": "IEDB", "id": "1192580", "url": "https://www.iedb.org/epitope/1192580" }, { "database": "IEDB", "id": "1212971", "url": "https://www.iedb.org/epitope/1212971" }, { "database": "IEDB", "id": "1257208", "url": "https://www.iedb.org/epitope/1257208" }, { "database": "IEDB", "id": "1257209", "url": "https://www.iedb.org/epitope/1257209" } ], "reference": [ { "type": "PubMed", "id": "37938771", "url": "https://glygen.org/publication/PubMed/37938771" } ] }, { "title": "C19ORF84 connects piRNA and DNA methylation machineries to defend the mammalian germ line.", "journal": "Molecular cell", "date": "2024-02-07", "authors": "Zoch Ansgar, Konieczny Gabriela, Auchynnikava Tania, Stallmeyer Birgit, Rotte Nadja, Heep Madeleine, Berrens Rebecca V, Schito Martina, Kabayama Yuka, Sch\u00f6pp Theresa, Kliesch Sabine, Houston Brendan, Nagirnaja Liina, O'Bryan Moira K, Aston Kenneth I, Conrad Donald F, Rappsilber Juri, Allshire Robin C, Cook Atlanta G, T\u00fcttelmann Frank, O'Carroll D\u00f3nal", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845323" } ], "reference": [ { "type": "PubMed", "id": "38359823", "url": "https://glygen.org/publication/PubMed/38359823" } ] }, { "title": "Macrophage MCT4 inhibition activates reparative genes and protects from atherosclerosis by histone H3 lysine 18 lactylation.", "journal": "Cell reports", "date": "2024-05-28", "authors": "Zhang Yunjia, Jiang Hong, Dong Mengdie, Min Jiao, He Xian, Tan Yongkang, Liu Fuhao, Chen Minghong, Chen Xiang, Yin Quanwen, Zheng Longbin, Shao Yongfeng, Li Xuesong, Chen Hongshan", "evidence": [ { "database": "RefSeq", "id": "NP_003520", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003520" } ], "reference": [ { "type": "PubMed", "id": "38733581", "url": "https://glygen.org/publication/PubMed/38733581" } ] }, { "title": "Amino acid sequence of the heavy chain of human alpha-factor XIIa (activated Hageman factor).", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "McMullen BA, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "3886654", "url": "https://glygen.org/publication/PubMed/3886654" } ] }, { "title": "The amino acid sequence of the light chain of human high-molecular-mass kininogen.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Lottspeich F, Kellermann J, Henschen A, Foertsch B, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "4054110", "url": "https://glygen.org/publication/PubMed/4054110" } ] }, { "title": "Genetic manipulation of OGT enhances NK cell-mediated cytotoxicity in tumor immunity.", "journal": "Journal of advanced research", "date": "2025-09-04", "authors": "Oh Se-Chan, Jeon Bong Chan, Jang In-Hwan, Song Mi-Ran, Hwang Heeyoun, An Dasom, Yue Liu, Jung Yuri, Lee Yunhee, Jo Seona, Park Sung-Kyun, Kim Tae-Don", "evidence": [ { "database": "O-GlcNAc Database", "id": "P68431", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68431" } ], "reference": [ { "type": "PubMed", "id": "40914422", "url": "https://glygen.org/publication/PubMed/40914422" } ] }, { "title": "A conserved H3K14ub-driven H3K9me3 for chromatin compartmentalization.", "journal": "Nature", "date": "2025-11", "authors": "Huang Yuanyong, Sun Yimei, Qi Hongyun, Jiang Quanlong, Li Jialun, Chang Mingzhi, Li Xinyan, Shu Lei, Duan Xiaoya, Wang Yiqin, Fang Kailun, Mao Hailei, Han Mengmeng, Weng Yuan, Zhang Qiao, Chen Zhaosu, Wei Wei, Song Gaojie, Zhang Qiansen, Li Jiwen, Han Jing-Dong J, Chen Charlie Degui, Wong Jiemin", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "41094145", "url": "https://glygen.org/publication/PubMed/41094145" } ] }, { "title": "Human high molecular weight kininogen. Studies of structure-function relationships and of proteolysis of the molecule occurring during contact activation of plasma.", "journal": "The Journal of biological chemistry", "date": "1979", "authors": "Kerbiriou DM, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "500690", "url": "https://glygen.org/publication/PubMed/500690" } ] }, { "title": "A unique cap(m7GpppXm)-dependent influenza virion endonuclease cleaves capped RNAs to generate the primers that initiate viral RNA transcription.", "journal": "Cell", "date": "1981", "authors": "Plotch SJ, Bouloy M, Ulmanen I, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9943962", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962" } ], "reference": [ { "type": "PubMed", "id": "6261960", "url": "https://glygen.org/publication/PubMed/6261960" } ] }, { "title": "Amino acid sequence of human beta-factor XIIa.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Fujikawa K, McMullen BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "6604055", "url": "https://glygen.org/publication/PubMed/6604055" } ] }, { "title": "The primary structure and expression of four cloned human histone genes.", "journal": "Nucleic Acids Res.", "date": "1983", "authors": "Zhong R, Roeder R G, Heintz N", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "6647026", "url": "https://glygen.org/publication/PubMed/6647026" } ] }, { "title": "Human spleen histone H3. Isolation and amino acid sequence.", "journal": "J. Biochem.", "date": "1981", "authors": "Ohe Y, Iwai K", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "7309716", "url": "https://glygen.org/publication/PubMed/7309716" } ] }, { "title": "Autoactivation of human Hageman factor. Demonstration utilizing a synthetic substrate.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Silverberg M, Dunn JT, Garen L, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "7391081", "url": "https://glygen.org/publication/PubMed/7391081" } ] }, { "title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7488013", "url": "https://glygen.org/publication/PubMed/7488013" } ] }, { "title": "Interleukin-7 can induce the activation of Jak 1, Jak 3 and STAT 5 proteins in murine T cells.", "journal": "European journal of immunology", "date": "1995", "authors": "Foxwell BM, Beadling C, Guschin D, Kerr I, Cantrell D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7489741", "url": "https://glygen.org/publication/PubMed/7489741" } ] }, { "title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "1996", "authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7501971", "url": "https://glygen.org/publication/PubMed/7501971" } ] }, { "title": "FR901228, a novel antitumor bicyclic depsipeptide produced by Chromobacterium violaceum No. 968. I. Taxonomy, fermentation, isolation, physico-chemical and biological properties, and antitumor activity.", "journal": "The Journal of antibiotics", "date": "1994", "authors": "Ueda H, Nakajima H, Hori Y, Fujita T, Nishimura M, Goto T, Okuhara M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "7513682", "url": "https://glygen.org/publication/PubMed/7513682" } ] }, { "title": "Cytoplasmic domains of the interleukin-2 receptor beta and gamma chains mediate the signal for T-cell proliferation.", "journal": "Nature", "date": "1994", "authors": "Nelson BH, Lord JD, Greenberg PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7514277", "url": "https://glygen.org/publication/PubMed/7514277" } ] }, { "title": "Pro-inflammatory cytokines and environmental stress cause p38 mitogen-activated protein kinase activation by dual phosphorylation on tyrosine and threonine.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Raingeaud J, Gupta S, Rogers JS, Dickens M, Han J, Ulevitch RJ, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7535770", "url": "https://glygen.org/publication/PubMed/7535770" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "The Mos/MAP kinase pathway stabilizes c-Fos by phosphorylation and augments its transforming activity in NIH 3T3 cells.", "journal": "The EMBO journal", "date": "1995", "authors": "Okazaki K, Sagata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7588633", "url": "https://glygen.org/publication/PubMed/7588633" } ] }, { "title": "Molecular coevolution of mammalian ribosomal gene terminator sequences and the transcription termination factor TTF-I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Evers R, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "7597036", "url": "https://glygen.org/publication/PubMed/7597036" } ] }, { "title": "The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15.", "journal": "Immunity", "date": "1995", "authors": "Lin JX, Migone TS, Tsang M, Friedmann M, Weatherbee JA, Zhou L, Yamauchi A, Bloom ET, Mietz J, John S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7719938", "url": "https://glygen.org/publication/PubMed/7719938" } ] }, { "title": "Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA.", "journal": "Nature", "date": "1995", "authors": "Glover JN, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7816143", "url": "https://glygen.org/publication/PubMed/7816143" } ] }, { "title": "A retinoic acid-triggered cascade of HOXB1 gene activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ogura T, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7831296", "url": "https://glygen.org/publication/PubMed/7831296" } ] }, { "title": "Lack of cyclin D-Cdk complexes in Rb-negative cells correlates with high levels of p16INK4/MTS1 tumour suppressor gene product.", "journal": "The EMBO journal", "date": "1995", "authors": "Parry D, Bates S, Mann DJ, Peters G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "7859739", "url": "https://glygen.org/publication/PubMed/7859739" } ] }, { "title": "Autoregulation of the human C/EBP alpha gene by stimulation of upstream stimulatory factor binding.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Timchenko N, Wilson DR, Taylor LR, Abdelsayed S, Wilde M, Sawadogo M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "7862113", "url": "https://glygen.org/publication/PubMed/7862113" } ] }, { "title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.", "journal": "Blood", "date": "1994", "authors": "Sengupta PK, Lavelle DE, DeSimone J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7906964", "url": "https://glygen.org/publication/PubMed/7906964" } ] }, { "title": "Regulation of the human HOXD4 gene by retinoids.", "journal": "Mechanisms of development", "date": "1993", "authors": "Moroni MC, Vigano MA, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7908827", "url": "https://glygen.org/publication/PubMed/7908827" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "The Ikaros gene encodes a family of functionally diverse zinc finger DNA-binding proteins.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Molnar A, Georgopoulos K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "7969165", "url": "https://glygen.org/publication/PubMed/7969165" } ] }, { "title": "Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.", "journal": "Genes & development", "date": "1994", "authors": "Guan KL, Jenkins CW, Li Y, Nichols MA, Wu X, O'Keefe CL, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8001816", "url": "https://glygen.org/publication/PubMed/8001816" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.", "journal": "Nature", "date": "1994", "authors": "Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8078588", "url": "https://glygen.org/publication/PubMed/8078588" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "Functional participation of the IL-2 receptor gamma chain in IL-7 receptor complexes.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Kondo M, Takeshita T, Higuchi M, Nakamura M, Sudo T, Nishikawa S, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8128231", "url": "https://glygen.org/publication/PubMed/8128231" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular `heads` of C1q.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Ghebrehiwet B, Lim BL, Peerschke EI, Willis AC, Reid KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "8195709", "url": "https://glygen.org/publication/PubMed/8195709" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Association of a human H1 histone gene with an H2A pseudogene and genes encoding H2B.1 and H3.1 histones.", "journal": "J. Cell. Biochem.", "date": "1993", "authors": "Kardalinou E, Eick S, Albig W, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "8227173", "url": "https://glygen.org/publication/PubMed/8227173" } ] }, { "title": "Transcription factors NF-IL6 and NF-kappa B synergistically activate transcription of the inflammatory cytokines, interleukin 6 and interleukin 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Matsusaka T, Fujikawa K, Nishio Y, Mukaida N, Matsushima K, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8234276", "url": "https://glygen.org/publication/PubMed/8234276" } ] }, { "title": "A new regulatory motif in cell-cycle control causing specific inhibition of cyclin D/CDK4.", "journal": "Nature", "date": "1993", "authors": "Serrano M, Hannon GJ, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8259215", "url": "https://glygen.org/publication/PubMed/8259215" } ] }, { "title": "Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Noguchi M, Nakamura Y, Russell SM, Ziegler SF, Tsang M, Cao X, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8266077", "url": "https://glygen.org/publication/PubMed/8266077" } ] }, { "title": "The p53-mdm-2 autoregulatory feedback loop.", "journal": "Genes & development", "date": "1993", "authors": "Wu X, Bayle JH, Olson D, Levine AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8319905", "url": "https://glygen.org/publication/PubMed/8319905" } ] }, { "title": "Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Nakajima T, Kinoshita S, Sasagawa T, Sasaki K, Naruto M, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8384717", "url": "https://glygen.org/publication/PubMed/8384717" } ] }, { "title": "NF-kappa B subunit-specific regulation of the interleukin-8 promoter.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Kunsch C, Rosen CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413215", "url": "https://glygen.org/publication/PubMed/8413215" } ] }, { "title": "Distinct mechanisms for regulation of the interleukin-8 gene involve synergism and cooperativity between C/EBP and NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Stein B, Baldwin AS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413306", "url": "https://glygen.org/publication/PubMed/8413306" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "15-Deoxy-delta 12, 14-prostaglandin J2 is a ligand for the adipocyte determination factor PPAR gamma.", "journal": "Cell", "date": "1995-12-01", "authors": "Forman B M, Tontonoz P, Chen J, Brun R P, Spiegelman B M, Evans R M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "8521497", "url": "https://glygen.org/publication/PubMed/8521497" } ] }, { "title": "A prostaglandin J2 metabolite binds peroxisome proliferator-activated receptor gamma and promotes adipocyte differentiation.", "journal": "Cell", "date": "1995-12-01", "authors": "Kliewer S A, Lenhard J M, Willson T M, Patel I, Morris D C, Lehmann J M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "8521498", "url": "https://glygen.org/publication/PubMed/8521498" } ] }, { "title": "Interleukin-1 alpha activates an NF-kappaB-like factor in osteoclast-like cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8617720", "url": "https://glygen.org/publication/PubMed/8617720" } ] }, { "title": "MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Raingeaud J, Whitmarsh AJ, Barrett T, Derijard B, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622669", "url": "https://glygen.org/publication/PubMed/8622669" } ] }, { "title": "3pK, a new mitogen-activated protein kinase-activated protein kinase located in the small cell lung cancer tumor suppressor gene region.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Sithanandam G, Latif F, Duh FM, Bernal R, Smola U, Li H, Kuzmin I, Wixler V, Geil L, Shrestha S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8622688", "url": "https://glygen.org/publication/PubMed/8622688" } ] }, { "title": "Identification of mitogen-activated protein (MAP) kinase-activated protein kinase-3, a novel substrate of CSBP p38 MAP kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "McLaughlin MM, Kumar S, McDonnell PC, Van Horn S, Lee JC, Livi GP, Young PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8626550", "url": "https://glygen.org/publication/PubMed/8626550" } ] }, { "title": "Isolation of inositol 1,3,4-trisphosphate 5/6-kinase, cDNA cloning and expression of the recombinant enzyme.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wilson MP, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8662638", "url": "https://glygen.org/publication/PubMed/8662638" } ] }, { "title": "Natural ligand motifs of closely related HLA-DR4 molecules predict features of rheumatoid arthritis associated peptides.", "journal": "Biochimica et biophysica acta", "date": "1996-06-07", "authors": "Friede T, Gnau V, Jung G, Keilholz W, Stevanovi\u0107 S, Rammensee H G", "evidence": [ { "database": "IEDB", "id": "423230", "url": "https://www.iedb.org/epitope/423230" } ], "reference": [ { "type": "PubMed", "id": "8672555", "url": "https://glygen.org/publication/PubMed/8672555" } ] }, { "title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.", "journal": "Development (Cambridge, England)", "date": "1996", "authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8674428", "url": "https://glygen.org/publication/PubMed/8674428" } ] }, { "title": "The transcription factor AP-1 binds to the human interleukin 1 alpha promoter.", "journal": "European cytokine network", "date": "1996", "authors": "Bailly S, Fay M, Israel N, Gougerot-Pocidalo MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8688489", "url": "https://glygen.org/publication/PubMed/8688489" } ] }, { "title": "PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells.", "journal": "Blood", "date": "1996", "authors": "Smith LT, Hohaus S, Gonzalez DA, Dziennis SE, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8695841", "url": "https://glygen.org/publication/PubMed/8695841" } ] }, { "title": "Distinct tyrosine residues within the interleukin-2 receptor beta chain drive signal transduction specificity, redundancy, and diversity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gaffen SL, Lai SY, Ha M, Liu X, Hennighausen L, Greene WC, Goldsmith MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8702919", "url": "https://glygen.org/publication/PubMed/8702919" } ] }, { "title": "Interleukin-7 signaling in human B cell precursor acute lymphoblastic leukemia cells and murine BAF3 cells involves activation of STAT1 and STAT5 mediated via the interleukin-7 receptor alpha chain.", "journal": "Leukemia", "date": "1996", "authors": "van der Plas DC, Smiers F, Pouwels K, Hoefsloot LH, Lowenberg B, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8709637", "url": "https://glygen.org/publication/PubMed/8709637" } ] }, { "title": "Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular `heads` of C1q (gC1q-R).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Joseph K, Ghebrehiwet B, Peerschke EI, Reid KB, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "8710908", "url": "https://glygen.org/publication/PubMed/8710908" } ] }, { "title": "Activation and function of human Hageman factor. The role of high molecular weight kininogen and prekallikrein.", "journal": "The Journal of clinical investigation", "date": "1977", "authors": "Meier HL, Pierce JV, Colman RW, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "874082", "url": "https://glygen.org/publication/PubMed/874082" } ] }, { "title": "Isolation and characterization of p19INK4d, a p16-related inhibitor specific to CDK6 and CDK4.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Guan KL, Jenkins CW, Li Y, O'Keefe CL, Noh S, Wu X, Zariwala M, Matera AG, Xiong Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8741839", "url": "https://glygen.org/publication/PubMed/8741839" } ] }, { "title": "XTcf-3 transcription factor mediates beta-catenin-induced axis formation in Xenopus embryos.", "journal": "Cell", "date": "1996", "authors": "Molenaar M, van de Wetering M, Oosterwegel M, Peterson-Maduro J, Godsave S, Korinek V, Roose J, Destree O, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "8756721", "url": "https://glygen.org/publication/PubMed/8756721" } ] }, { "title": "Functional interaction of beta-catenin with the transcription factor LEF-1.", "journal": "Nature", "date": "1996", "authors": "Behrens J, von Kries JP, Kuhl M, Bruhn L, Wedlich D, Grosschedl R, Birchmeier W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "8757136", "url": "https://glygen.org/publication/PubMed/8757136" } ] }, { "title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.", "journal": "Nucleic acids research", "date": "1996", "authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8759021", "url": "https://glygen.org/publication/PubMed/8759021" } ] }, { "title": "KAP-1, a novel corepressor for the highly conserved KRAB repression domain.", "journal": "Genes & development", "date": "1996", "authors": "Friedman JR, Fredericks WJ, Jensen DE, Speicher DW, Huang XP, Neilson EG, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "8769649", "url": "https://glygen.org/publication/PubMed/8769649" } ] }, { "title": "A comparison of the substrate specificity of MAPKAP kinase-2 and MAPKAP kinase-3 and their activation by cytokines and cellular stress.", "journal": "FEBS letters", "date": "1996", "authors": "Clifton AD, Young PR, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8774846", "url": "https://glygen.org/publication/PubMed/8774846" } ] }, { "title": "NF-E2 disrupts chromatin structure at human beta-globin locus control region hypersensitive site 2 in vitro.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Armstrong JA, Emerson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "8816476", "url": "https://glygen.org/publication/PubMed/8816476" } ] }, { "title": "Identification of novel phosphorylation sites required for activation of MAPKAP kinase-2.", "journal": "The EMBO journal", "date": "1995", "authors": "Ben-Levy R, Leighton IA, Doza YN, Attwood P, Morrice N, Marshall CJ, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8846784", "url": "https://glygen.org/publication/PubMed/8846784" } ] }, { "title": "CCAAT/enhancer-binding protein alpha (C/EBP alpha) inhibits cell proliferation through the p21 (WAF-1/CIP-1/SDI-1) protein.", "journal": "Genes & development", "date": "1996", "authors": "Timchenko NA, Wilde M, Nakanishi M, Smith JR, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8846917", "url": "https://glygen.org/publication/PubMed/8846917" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Notch3 mutations in CADASIL, a hereditary adult-onset condition causing stroke and dementia.", "journal": "Nature", "date": "1996", "authors": "Joutel A, Corpechot C, Ducros A, Vahedi K, Chabriat H, Mouton P, Alamowitch S, Domenga V, Cecillion M, Marechal E, Maciazek J, Vayssiere C, Cruaud C, Cabanis EA, Ruchoux MM, Weissenbach J, Bach JF, Bousser MG, Tournier-Lasserve E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "8878478", "url": "https://glygen.org/publication/PubMed/8878478" } ] }, { "title": "Dermatotoxic chemical stimulate of c-jun and c-fos transcription and AP-1 DNA binding in human keratinocytes.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1996", "authors": "Burleson FG, Simeonova PP, Germolec DR, Luster MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8884985", "url": "https://glygen.org/publication/PubMed/8884985" } ] }, { "title": "Human Rad51 protein promotes ATP-dependent homologous pairing and strand transfer reactions in vitro.", "journal": "Cell", "date": "1996", "authors": "Baumann P, Benson FE, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "8929543", "url": "https://glygen.org/publication/PubMed/8929543" } ] }, { "title": "An AP-1 site is involved in the NGF induction of IL-1 alpha in PC12 cells.", "journal": "Neurochemistry international", "date": "1996", "authors": "Alheim K, McDowell TL, Symons JA, Duff GW, Bartfai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8939459", "url": "https://glygen.org/publication/PubMed/8939459" } ] }, { "title": "Products of the grg (Groucho-related gene) family can dimerize through the amino-terminal Q domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Pinto M, Lobe CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "8955148", "url": "https://glygen.org/publication/PubMed/8955148" } ] }, { "title": "Induction of apoptosis by ASK1, a mammalian MAPKKK that activates SAPK/JNK and p38 signaling pathways.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Ichijo H, Nishida E, Irie K, ten Dijke P, Saitoh M, Moriguchi T, Takagi M, Matsumoto K, Miyazono K, Gotoh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "8974401", "url": "https://glygen.org/publication/PubMed/8974401" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "Association of BRCA1 with Rad51 in mitotic and meiotic cells.", "journal": "Cell", "date": "1997", "authors": "Scully R, Chen J, Plug A, Xiao Y, Weaver D, Feunteun J, Ashley T, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9008167", "url": "https://glygen.org/publication/PubMed/9008167" } ] }, { "title": "Transcriptional repression by RING finger protein TIF1 beta that interacts with the KRAB repressor domain of KOX1.", "journal": "Nucleic acids research", "date": "1996-12-15", "authors": "Moosmann P, Georgiev O, Le Douarin B, Bourquin J P, Schaffner W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9843940", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940" } ], "reference": [ { "type": "PubMed", "id": "9016654", "url": "https://glygen.org/publication/PubMed/9016654" } ] }, { "title": "Regulatory mechanisms involved in activator-protein-1 (AP-1)-mediated activation of glutathione-S-transferase gene expression by chemical agents.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Ainbinder E, Bergelson S, Pinkus R, Daniel V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9030721", "url": "https://glygen.org/publication/PubMed/9030721" } ] }, { "title": "Characterization of the H1.5 gene completes the set of human H1 subtype genes.", "journal": "Gene", "date": "1997", "authors": "Albig W, Meergans T, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "9031620", "url": "https://glygen.org/publication/PubMed/9031620" } ] }, { "title": "Susceptibility to ankylosing spondylitis correlates with the C-terminal residue of peptides presented by various HLA-B27 subtypes.", "journal": "European journal of immunology", "date": "1997-02", "authors": "Fiorillo M T, Meadows L, D'Amato M, Shabanowitz J, Hunt D F, Appella E, Sorrentino R", "evidence": [ { "database": "IEDB", "id": "236256", "url": "https://www.iedb.org/epitope/236256" } ], "reference": [ { "type": "PubMed", "id": "9045906", "url": "https://glygen.org/publication/PubMed/9045906" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9065479", "url": "https://glygen.org/publication/PubMed/9065479" } ] }, { "title": "Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mukherjee R, Jow L, Croston GE, Paterniti JR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "9065481", "url": "https://glygen.org/publication/PubMed/9065481" } ] }, { "title": "Armadillo coactivates transcription driven by the product of the Drosophila segment polarity gene dTCF.", "journal": "Cell", "date": "1997", "authors": "van de Wetering M, Cavallo R, Dooijes D, van Beest M, van Es J, Loureiro J, Ypma A, Hursh D, Jones T, Bejsovec A, Peifer M, Mortin M, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9118222", "url": "https://glygen.org/publication/PubMed/9118222" } ] }, { "title": "Human histone gene organization: nonregular arrangement within a large cluster.", "journal": "Genomics", "date": "1997", "authors": "Albig W, Kioschis P, Poustka A, Meergans K, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "9119399", "url": "https://glygen.org/publication/PubMed/9119399" } ] }, { "title": "Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.", "journal": "Cell", "date": "1997", "authors": "Zhang Y, Iratni R, Erdjument-Bromage H, Tempst P, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9150135", "url": "https://glygen.org/publication/PubMed/9150135" } ] }, { "title": "Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Deacon K, Blank JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9162092", "url": "https://glygen.org/publication/PubMed/9162092" } ] }, { "title": "Fatty acids, eicosanoids, and hypolipidemic agents identified as ligands of peroxisome proliferator-activated receptors by coactivator-dependent receptor ligand assay.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Krey G, Braissant O, L'Horset F, Kalkhoven E, Perroud M, Parker MG, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "9171241", "url": "https://glygen.org/publication/PubMed/9171241" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG, Xanthopoulos KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "9177240", "url": "https://glygen.org/publication/PubMed/9177240" } ] }, { "title": "A novel mechanism of JNK1 activation. Nuclear translocation and activation of JNK1 during ischemia and reperfusion.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizukami Y, Yoshioka K, Morimoto S, Yoshida Ki", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9195981", "url": "https://glygen.org/publication/PubMed/9195981" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "A novel class of RanGTP binding proteins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Gorlich D, Dabrowski M, Bischoff FR, Kutay U, Bork P, Hartmann E, Prehn S, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "9214382", "url": "https://glygen.org/publication/PubMed/9214382" } ] }, { "title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Di Rocco G, Mavilio F, Zappavigna V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9218805", "url": "https://glygen.org/publication/PubMed/9218805" } ] }, { "title": "FOG, a multitype zinc finger protein, acts as a cofactor for transcription factor GATA-1 in erythroid and megakaryocytic differentiation.", "journal": "Cell", "date": "1997", "authors": "Tsang AP, Visvader JE, Turner CA, Fujiwara Y, Yu C, Weiss MJ, Crossley M, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9230307", "url": "https://glygen.org/publication/PubMed/9230307" } ] }, { "title": "Differential association of phosphatidylinositol 3-kinase with insulin receptor substrate (IRS)-1 and IRS-2 in human thymocytes in response to IL-7.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Sharfe N, Roifman CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9233603", "url": "https://glygen.org/publication/PubMed/9233603" } ] }, { "title": "HOXD4 and regulation of the group 4 paralog genes.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9272954", "url": "https://glygen.org/publication/PubMed/9272954" } ] }, { "title": "Distribution of the Rad51 recombinase in human and mouse spermatocytes.", "journal": "The EMBO journal", "date": "1997", "authors": "Barlow AL, Benson FE, West SC, Hulten MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9311981", "url": "https://glygen.org/publication/PubMed/9311981" } ] }, { "title": "D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Huang LJ, Durick K, Weiner JA, Chun J, Taylor SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9326583", "url": "https://glygen.org/publication/PubMed/9326583" } ] }, { "title": "Vertebrates have conserved capping protein alpha isoforms with specific expression patterns.", "journal": "Cell motility and the cytoskeleton", "date": "1997", "authors": "Hart MC, Korshunova YO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9331217", "url": "https://glygen.org/publication/PubMed/9331217" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "IL-2 and IL-7 induce heterodimerization of STAT5 isoforms in human peripheral blood T lymphoblasts.", "journal": "Cellular immunology", "date": "1997", "authors": "Rosenthal LA, Winestock KD, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9398404", "url": "https://glygen.org/publication/PubMed/9398404" } ] }, { "title": "Structure of IRF-1 with bound DNA reveals determinants of interferon regulation.", "journal": "Nature", "date": "1998", "authors": "Escalante CR, Yie J, Thanos D, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9422515", "url": "https://glygen.org/publication/PubMed/9422515" } ] }, { "title": "Nucleosomal DNA regulates the core-histone-binding subunit of the human Hat1 acetyltransferase.", "journal": "Current biology : CB", "date": "1998", "authors": "Verreault A, Kaufman PD, Kobayashi R, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "9427644", "url": "https://glygen.org/publication/PubMed/9427644" } ] }, { "title": "High molecular weight kininogen regulates prekallikrein assembly and activation on endothelial cells: a novel mechanism for contact activation.", "journal": "Blood", "date": "1998", "authors": "Motta G, Rojkjaer R, Hasan AA, Cines DB, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9970672", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672" } ], "reference": [ { "type": "PubMed", "id": "9427705", "url": "https://glygen.org/publication/PubMed/9427705" } ] }, { "title": "The human histone gene cluster at the D6S105 locus.", "journal": "Hum. Genet.", "date": "1997", "authors": "Albig W, Doenecke D", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "reference": [ { "type": "PubMed", "id": "9439656", "url": "https://glygen.org/publication/PubMed/9439656" } ] }, { "title": "Synergistic actions of Rad51 and Rad52 in recombination and DNA repair.", "journal": "Nature", "date": "1998", "authors": "Benson FE, Baumann P, West SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9450758", "url": "https://glygen.org/publication/PubMed/9450758" } ] }, { "title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.", "journal": "The EMBO journal", "date": "1998", "authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9482740", "url": "https://glygen.org/publication/PubMed/9482740" } ] }, { "title": "Two members of the Tcf family implicated in Wnt/beta-catenin signaling during embryogenesis in the mouse.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Korinek V, Barker N, Willert K, Molenaar M, Roose J, Wagenaar G, Markman M, Lamers W, Destree O, Clevers H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9488439", "url": "https://glygen.org/publication/PubMed/9488439" } ] }, { "title": "Molecular cloning of translocation t(1;14)(q21;q32) defines a novel gene (BCL9) at chromosome 1q21.", "journal": "Blood", "date": "1998", "authors": "Willis TG, Zalcberg IR, Coignet LJ, Wlodarska I, Stul M, Jadayel DM, Bastard C, Treleaven JG, Catovsky D, Silva ML, Dyer MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9490669", "url": "https://glygen.org/publication/PubMed/9490669" } ] }, { "title": "Helios, a T cell-restricted Ikaros family member that quantitatively associates with Ikaros at centromeric heterochromatin.", "journal": "Genes & development", "date": "1998-03-15", "authors": "Hahm K, Cobb B S, McCarty A S, Brown K E, Klug C A, Lee R, Akashi K, Weissman I L, Fisher A G, Smale S T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9940951", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951" } ], "reference": [ { "type": "PubMed", "id": "9512513", "url": "https://glygen.org/publication/PubMed/9512513" } ] }, { "title": "ARF promotes MDM2 degradation and stabilizes p53: ARF-INK4a locus deletion impairs both the Rb and p53 tumor suppression pathways.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, Xiong Y, Yarbrough WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9529249", "url": "https://glygen.org/publication/PubMed/9529249" } ] }, { "title": "Delineation of the regions of interleukin-2 (IL-2) receptor beta chain important for association of Jak1 and Jak3. Jak1-independent functional recruitment of Jak3 to Il-2Rbeta.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhu MH, Berry JA, Russell SM, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9553136", "url": "https://glygen.org/publication/PubMed/9553136" } ] }, { "title": "A novel fusion between MOZ and the nuclear receptor coactivator TIF2 in acute myeloid leukemia.", "journal": "Blood", "date": "1998", "authors": "Carapeti M, Aguiar RC, Goldman JM, Cross NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "9558366", "url": "https://glygen.org/publication/PubMed/9558366" } ] }, { "title": "Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1.", "journal": "The EMBO journal", "date": "1998", "authors": "Saitoh M, Nishitoh H, Fujii M, Takeda K, Tobiume K, Sawada Y, Kawabata M, Miyazono K, Ichijo H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9564042", "url": "https://glygen.org/publication/PubMed/9564042" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tang J, Gary JD, Clarke S, Herschman HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "9642256", "url": "https://glygen.org/publication/PubMed/9642256" } ] }, { "title": "SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.", "journal": "Molecular cell", "date": "1998", "authors": "Zhang Y, Sun ZW, Iratni R, Erdjument-Bromage H, Tempst P, Hampsey M, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9651585", "url": "https://glygen.org/publication/PubMed/9651585" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "Cloning, characterization, and the complete 56.8-kilobase DNA sequence of the human NOTCH4 gene.", "journal": "Genomics", "date": "1998", "authors": "Li L, Huang GM, Banta AB, Deng Y, Smith T, Dong P, Friedman C, Chen L, Trask BJ, Spies T, Rowen L, Hood L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1912408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408" } ], "reference": [ { "type": "PubMed", "id": "9693032", "url": "https://glygen.org/publication/PubMed/9693032" } ] }, { "title": "Characterization of cytokine differential induction of STAT complexes in primary human T and NK cells.", "journal": "Journal of leukocyte biology", "date": "1998", "authors": "Yu CR, Young HA, Ortaldo JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9715265", "url": "https://glygen.org/publication/PubMed/9715265" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "Ligand binding and co-activator assembly of the peroxisome proliferator-activated receptor-gamma.", "journal": "Nature", "date": "1998", "authors": "Nolte RT, Wisely GB, Westin S, Cobb JE, Lambert MH, Kurokawa R, Rosenfeld MG, Willson TM, Glass CK, Milburn MV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9841922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922" } ], "reference": [ { "type": "PubMed", "id": "9744270", "url": "https://glygen.org/publication/PubMed/9744270" } ] }, { "title": "Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Levanon D, Goldstein RE, Bernstein Y, Tang H, Goldenberg D, Stifani S, Paroush Z, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9751710", "url": "https://glygen.org/publication/PubMed/9751710" } ] }, { "title": "Nuclear export of the stress-activated protein kinase p38 mediated by its substrate MAPKAP kinase-2.", "journal": "Current biology : CB", "date": "1998", "authors": "Ben-Levy R, Hooper S, Wilson R, Paterson HF, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9768359", "url": "https://glygen.org/publication/PubMed/9768359" } ] }, { "title": "Crossing over analysis at pachytene in man.", "journal": "European journal of human genetics : EJHG", "date": "1998", "authors": "Barlow AL, Hulten MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9781043", "url": "https://glygen.org/publication/PubMed/9781043" } ] }, { "title": "The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.", "journal": "Cell", "date": "1998", "authors": "Zhang Y, LeRoy G, Seelig HP, Lane WS, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214815", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815" } ], "reference": [ { "type": "PubMed", "id": "9790534", "url": "https://glygen.org/publication/PubMed/9790534" } ] }, { "title": "Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.", "journal": "Nature", "date": "1998-10-29", "authors": "Tong J K, Hassig C A, Schnitzler G R, Kingston R E, Schreiber S L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "9804427", "url": "https://glygen.org/publication/PubMed/9804427" } ] }, { "title": "A role for Groucho tetramerization in transcriptional repression.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Chen G, Nguyen PH, Courey AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9819412", "url": "https://glygen.org/publication/PubMed/9819412" } ] }, { "title": "Mdm2 association with p53 targets its ubiquitination.", "journal": "Oncogene", "date": "1998", "authors": "Fuchs SY, Adler V, Buschmann T, Wu X, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580" } ], "reference": [ { "type": "PubMed", "id": "9824166", "url": "https://glygen.org/publication/PubMed/9824166" } ] }, { "title": "Interaction of human rad51 recombination protein with single-stranded DNA binding protein, RPA.", "journal": "Nucleic acids research", "date": "1998", "authors": "Golub EI, Gupta RC, Haaf T, Wold MS, Radding CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-912446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446" } ], "reference": [ { "type": "PubMed", "id": "9826763", "url": "https://glygen.org/publication/PubMed/9826763" } ] }, { "title": "Pontin52, an interaction partner of beta-catenin, binds to the TATA box binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Bauer A, Huber O, Kemler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201722", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722" } ], "reference": [ { "type": "PubMed", "id": "9843967", "url": "https://glygen.org/publication/PubMed/9843967" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Overlapping but distinct patterns of histone acetylation by the human coactivators p300 and PCAF within nucleosomal substrates.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Schiltz RL, Mizzen CA, Vassilev A, Cook RG, Allis CD, Nakatani Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214847", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847" } ], "reference": [ { "type": "PubMed", "id": "9880483", "url": "https://glygen.org/publication/PubMed/9880483" } ] }, { "title": "NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities.", "journal": "Molecular cell", "date": "1998-12", "authors": "Xue Y, Wong J, Moreno G T, Young M K, C\u00f4t\u00e9 J, Wang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9937850", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850" } ], "reference": [ { "type": "PubMed", "id": "9885572", "url": "https://glygen.org/publication/PubMed/9885572" } ] }, { "title": "FOG-2: A novel GATA-family cofactor related to multitype zinc-finger proteins Friend of GATA-1 and U-shaped.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Tevosian SG, Deconinck AE, Cantor AB, Rieff HI, Fujiwara Y, Corfas G, Orkin SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231" } ], "reference": [ { "type": "PubMed", "id": "9927674", "url": "https://glygen.org/publication/PubMed/9927674" } ] } ], "pathway": [ { "id": "hsa:8350", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8350", "resource": "KEGG Pathway" }, { "id": "hsa:8351", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8351", "resource": "KEGG Pathway" }, { "id": "hsa:8352", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8352", "resource": "KEGG Pathway" }, { "id": "hsa:8353", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8353", "resource": "KEGG Pathway" }, { "id": "hsa:8354", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8354", "resource": "KEGG Pathway" }, { "id": "hsa:8355", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8355", "resource": "KEGG Pathway" }, { "id": "hsa:8356", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8356", "resource": "KEGG Pathway" }, { "id": "hsa:8357", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8357", "resource": "KEGG Pathway" }, { "id": "hsa:8358", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8358", "resource": "KEGG Pathway" }, { "id": "hsa:8968", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8968", "resource": "KEGG Pathway" }, { "id": "R-HSA-1266695", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695", "resource": "Reactome", "description": "Interleukin-7 signaling" }, { "id": "R-HSA-1912408", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1912408", "resource": "Reactome", "description": "Pre-NOTCH Transcription and Translation" }, { "id": "R-HSA-201722", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201722", "resource": "Reactome", "description": "Formation of the beta-catenin:TCF transactivating complex" }, { "id": "R-HSA-212300", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212300", "resource": "Reactome", "description": "PRC2 methylates histones and DNA" }, { "id": "R-HSA-2299718", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2299718", "resource": "Reactome", "description": "Condensation of Prophase Chromosomes" }, { "id": "R-HSA-2559580", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-HSA-2559582", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-HSA-3214815", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214815", "resource": "Reactome", "description": "HDACs deacetylate histones" }, { "id": "R-HSA-3214841", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214841", "resource": "Reactome", "description": "PKMTs methylate histone lysines" }, { "id": "R-HSA-3214842", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842", "resource": "Reactome", "description": "HDMs demethylate histones" }, { "id": "R-HSA-3214847", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214847", "resource": "Reactome", "description": "HATs acetylate histones" }, { "id": "R-HSA-3214858", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-HSA-3247509", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3247509", "resource": "Reactome", "description": "Chromatin modifying enzymes" }, { "id": "R-HSA-427359", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427359", "resource": "Reactome", "description": "SIRT1 negatively regulates rRNA expression" }, { "id": "R-HSA-427389", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427389", "resource": "Reactome", "description": "ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression" }, { "id": "R-HSA-427413", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413", "resource": "Reactome", "description": "NoRC negatively regulates rRNA expression" }, { "id": "R-HSA-5250924", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924", "resource": "Reactome", "description": "B-WICH complex positively regulates rRNA expression" }, { "id": "R-HSA-5334118", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5334118", "resource": "Reactome", "description": "DNA methylation" }, { "id": "R-HSA-5578749", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "resource": "Reactome", "description": "Transcriptional regulation by small RNAs" }, { "id": "R-HSA-5617472", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "resource": "Reactome", "description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis" }, { "id": "R-HSA-5625886", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625886", "resource": "Reactome", "description": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3" }, { "id": "R-HSA-68616", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68616", "resource": "Reactome", "description": "Assembly of the ORC complex at the origin of replication" }, { "id": "R-HSA-73728", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73728", "resource": "Reactome", "description": "RNA Polymerase I Promoter Opening" }, { "id": "R-HSA-73772", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772", "resource": "Reactome", "description": "RNA Polymerase I Promoter Escape" }, { "id": "R-HSA-8936459", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "resource": "Reactome", "description": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function" }, { "id": "R-HSA-8939236", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "id": "R-HSA-9018519", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-912446", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912446", "resource": "Reactome", "description": "Meiotic recombination" }, { "id": "R-HSA-9609690", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "resource": "Reactome", "description": "HCMV Early Events" }, { "id": "R-HSA-9610379", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379", "resource": "Reactome", "description": "HCMV Late Events" }, { "id": "R-HSA-9616222", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "resource": "Reactome", "description": "Transcriptional regulation of granulopoiesis" }, { "id": "R-HSA-9710421", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421", "resource": "Reactome", "description": "Defective pyroptosis" }, { "id": "R-HSA-9764725", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764725", "resource": "Reactome", "description": "Negative Regulation of CDH1 Gene Transcription" }, { "id": "R-HSA-977225", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" }, { "id": "R-HSA-9821002", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002", "resource": "Reactome", "description": "Chromatin modifications during the maternal to zygotic transition (MZT)" }, { "id": "R-HSA-983231", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983231", "resource": "Reactome", "description": "Factors involved in megakaryocyte development and platelet production" }, { "id": "R-HSA-9841922", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9841922", "resource": "Reactome", "description": "MLL4 and MLL3 complexes regulate expression of PPARG target genes in adipogenesis and hepatic steatosis" }, { "id": "R-HSA-9843940", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843940", "resource": "Reactome", "description": "Regulation of endogenous retroelements by KRAB-ZFP proteins" }, { "id": "R-HSA-9843970", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9843970", "resource": "Reactome", "description": "Regulation of endogenous retroelements by the Human Silencing Hub (HUSH) complex" }, { "id": "R-HSA-9845323", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845323", "resource": "Reactome", "description": "Regulation of endogenous retroelements by Piwi-interacting RNAs (piRNAs)" }, { "id": "R-HSA-9909649", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9909649", "resource": "Reactome", "description": "Regulation of PD-L1(CD274) transcription" }, { "id": "R-HSA-9918481", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9918481", "resource": "Reactome", "description": "Dengue Virus-Host Interactions" }, { "id": "R-HSA-9937850", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9937850", "resource": "Reactome", "description": "NuRD complex assembly" }, { "id": "R-HSA-9940465", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940465", "resource": "Reactome", "description": "ChAHP complex assembly" }, { "id": "R-HSA-9940951", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9940951", "resource": "Reactome", "description": "Interaction of NuRD complexes with transcription factors" }, { "id": "R-HSA-9943411", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943411", "resource": "Reactome", "description": "CHD1 and CHD2 subfamily" }, { "id": "R-HSA-9943962", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9943962", "resource": "Reactome", "description": "CHD6, CHD7, CHD8, CHD9 subfamily" }, { "id": "R-HSA-9970672", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9970672", "resource": "Reactome", "description": "FXIIa activates plasma kallikrein-kinin system" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A286ZJQ0-1", "protein_name": "Histone H3", "gene_name": "H3C14", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8I4SYN6-1", "protein_name": "Histone H3", "gene_name": "H3f4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A8I6A289-1", "protein_name": "Histone H3", "gene_name": "H3f3bl2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKASHKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRILGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8M1NED1-1", "protein_name": "Uncharacterized protein LOC100037365", "gene_name": "", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MLRNKHDETPQVDADREEEYHFSSEEEQEDDIEDDEYEEETADSSDDCDNDSEQIPVAKRAKTVSWRTERDADKLPKNLRFQPAREPGPQLSPADPLNPLSLFKLFFSKSVVSNLCKNTNAQAARAMAKQCKYPWTDVSVEELYHYIGLIFYMDVVRMYSVADYWRQDPFFSVPFPSTVMSMDRYHAILCNLHLSDPNADENDGDTLFKVKSLMDSIRQACSAHYQPRRNVVVSERFVLRKVKPVIKAKLGFRFFVLIDSSNGYTADVSVYKTSFPPRPGFSYDTVMSLLDAKALGSGYHVYMDDFYTTPKLMKDLFALKFGACGMYRDQRKDFPRNKSNPLTEKSARGSYRWIRDGPVVFVKWMDRPEVSICSTIHQAYTGEHVERKVRRQGSRKTKSIPCPAPVSAYSQHIVEVDPFDQLLQYYIMHYNSLKWYKKVFLQFLDIAAANAFILHKEQGGKLTHKKFMDQLIEELCSVSEEVPEQSSIQVEHLPVSGALLESHTATTGRQACSQCKKQDIRQLTPWKCQACHVFLCVEVDRNRFLDWHKNIACSGL", "length": 556 }, "evidence": [ { "id": "MGI:2448319", "url": "https://alliancegenome.org/gene/MGI:2448319#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "C0HL66-1", "protein_name": "Histone H3.3A", "gene_name": "His3.3A", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "C0HL67-1", "protein_name": "Histone H3.3B", "gene_name": "His3.3B", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "D3ZK97-1", "protein_name": "Histone H3", "gene_name": "H3f3c", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "E1BGN3-1", "protein_name": "Histone H3", "gene_name": "HIST2H3D", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MTRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "O15819-1", "protein_name": "Histone H3.3 type a", "gene_name": "H3a", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MARTKQTARKSTGAKVPRKHIGSKQAHKQTPVSSSSGGVKKVHRFRPGTVALREIRKYQKSTDLLIRKLPFQRLVREIAQEFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIHLARRIRGERS", "length": 139 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "P02299-1", "protein_name": "Histone H3", "gene_name": "His3:CG33848", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "MGI:2448319", "url": "https://alliancegenome.org/gene/MGI:2448319#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P02301-1", "protein_name": "Histone H3.3C", "gene_name": "H3-5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALTKQTARKSTGGKAPRKQLATKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P0DPK2-1", "protein_name": "Histone H3.Y", "gene_name": "H3Y1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P0DPK5-1", "protein_name": "Histone H3.X", "gene_name": "H3Y2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL", "length": 147 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P59169-1", "protein_name": "Histone H3.3", "gene_name": "HTR5", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P59226-1", "protein_name": "Histone H3.1", "gene_name": "HTR3", "tax_id": 3702, "organism": "Arabidopsis thaliana", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Arabidopsis", "common_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P61830-1", "protein_name": "Histone H3", "gene_name": "HHT1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS", "length": 136 }, "evidence": [ { "id": "MGI:2668828", "url": "https://alliancegenome.org/gene/MGI:2668828#orthology", "database": "AGR" }, { "id": "MGI:2145541", "url": "https://alliancegenome.org/gene/MGI:2145541#orthology", "database": "AGR" }, { "id": "MGI:2448349", "url": "https://alliancegenome.org/gene/MGI:2448349#orthology", "database": "AGR" }, { "id": "MGI:2448350", "url": "https://alliancegenome.org/gene/MGI:2448350#orthology", "database": "AGR" }, { "id": "MGI:2448319", "url": "https://alliancegenome.org/gene/MGI:2448319#orthology", "database": "AGR" }, { "id": "HGNC:4772", "url": "https://alliancegenome.org/gene/HGNC:4772#orthology", "database": "AGR" }, { "id": "HGNC:4768", "url": "https://alliancegenome.org/gene/HGNC:4768#orthology", "database": "AGR" }, { "id": "HGNC:4767", "url": "https://alliancegenome.org/gene/HGNC:4767#orthology", "database": "AGR" }, { "id": "HGNC:4776", "url": "https://alliancegenome.org/gene/HGNC:4776#orthology", "database": "AGR" }, { "id": "HGNC:4766", "url": "https://alliancegenome.org/gene/HGNC:4766#orthology", "database": "AGR" }, { "id": "HGNC:4775", "url": "https://alliancegenome.org/gene/HGNC:4775#orthology", "database": "AGR" }, { "id": "HGNC:4773", "url": "https://alliancegenome.org/gene/HGNC:4773#orthology", "database": "AGR" }, { "id": "HGNC:4771", "url": "https://alliancegenome.org/gene/HGNC:4771#orthology", "database": "AGR" }, { "id": "HGNC:4774", "url": "https://alliancegenome.org/gene/HGNC:4774#orthology", "database": "AGR" }, { "id": "HGNC:4769", "url": "https://alliancegenome.org/gene/HGNC:4769#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P68432-1", "protein_name": "Histone H3.1", "gene_name": "", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P68433-1", "protein_name": "Histone H3.1", "gene_name": "H3c10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "MGI:2668828", "url": "https://alliancegenome.org/gene/MGI:2668828#orthology", "database": "AGR" }, { "id": "MGI:2145541", "url": "https://alliancegenome.org/gene/MGI:2145541#orthology", "database": "AGR" }, { "id": "MGI:2448349", "url": "https://alliancegenome.org/gene/MGI:2448349#orthology", "database": "AGR" }, { "id": "MGI:2448350", "url": "https://alliancegenome.org/gene/MGI:2448350#orthology", "database": "AGR" }, { "id": "HGNC:4772", "url": "https://alliancegenome.org/gene/HGNC:4772#orthology", "database": "AGR" }, { "id": "HGNC:4768", "url": "https://alliancegenome.org/gene/HGNC:4768#orthology", "database": "AGR" }, { "id": "HGNC:4767", "url": "https://alliancegenome.org/gene/HGNC:4767#orthology", "database": "AGR" }, { "id": "HGNC:4776", "url": "https://alliancegenome.org/gene/HGNC:4776#orthology", "database": "AGR" }, { "id": "HGNC:4766", "url": "https://alliancegenome.org/gene/HGNC:4766#orthology", "database": "AGR" }, { "id": "HGNC:4775", "url": "https://alliancegenome.org/gene/HGNC:4775#orthology", "database": "AGR" }, { "id": "HGNC:4773", "url": "https://alliancegenome.org/gene/HGNC:4773#orthology", "database": "AGR" }, { "id": "HGNC:4771", "url": "https://alliancegenome.org/gene/HGNC:4771#orthology", "database": "AGR" }, { "id": "HGNC:4774", "url": "https://alliancegenome.org/gene/HGNC:4774#orthology", "database": "AGR" }, { "id": "HGNC:4769", "url": "https://alliancegenome.org/gene/HGNC:4769#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P84227-1", "protein_name": "Histone H3.2", "gene_name": "", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P84228-1", "protein_name": "Histone H3.2", "gene_name": "H3c7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "MGI:2448319", "url": "https://alliancegenome.org/gene/MGI:2448319#orthology", "database": "AGR" }, { "id": "HGNC:4776", "url": "https://alliancegenome.org/gene/HGNC:4776#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P84229-1", "protein_name": "Histone H3.2", "gene_name": "H3-VIII", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P84244-1", "protein_name": "Histone H3.3", "gene_name": "H3-3b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P84245-1", "protein_name": "Histone H3.3", "gene_name": "H3-3b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q00729-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2bc1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPEVSAKGTTISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK", "length": 127 }, "evidence": [ { "id": "MGI:2448319", "url": "https://alliancegenome.org/gene/MGI:2448319#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q4QRF4-1", "protein_name": "Histone H3.2", "gene_name": "", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q55BP0-1", "protein_name": "Histone H3.3 type c", "gene_name": "H3c", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MARTKQTARKSTGAKVPRKHLSSKSSFPSKPVNEVLKKTHRFRPGTVALREIRRYQKSSDLLIKKLPFQRLVREIAQEFKTDLRFQAAAIEALQEATEAYLVGLFEDTNLCAIHAKRVTIMVKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "Q5TEC6-1", "protein_name": "Histone H3-7", "gene_name": "H3-7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQEFKTDLRFQSSAVMALQEAREAYLVGLFEDTNLCAIHAKRVTIMPKDIQLVSRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q6LED0-1", "protein_name": "Histone H3.1", "gene_name": "", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6NXT2-1", "protein_name": "Histone H3.3C", "gene_name": "H3-5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 135 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q6PI20-1", "protein_name": "Histone H3.3", "gene_name": "h3f3d", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" }, { "id": "P68431", "url": "https://omabrowser.org/oma/group/P68431/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "length": 136 }, "evidence": [ { "id": "MGI:2448319", "url": "https://alliancegenome.org/gene/MGI:2448319#orthology", "database": "AGR" }, { "id": "SGD:S000000214", "url": "https://alliancegenome.org/gene/SGD:S000000214#orthology", "database": "AGR" }, { "id": "SGD:S000004976", "url": "https://alliancegenome.org/gene/SGD:S000004976#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "telomere organization", "id": "GO:0032200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032200", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "epigenetic regulation of gene expression", "id": "GO:0040029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040029", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "heterochromatin formation", "id": "GO:0031507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031507", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "nucleosomal DNA binding", "id": "GO:0031492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031492", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Acetylation is generally linked to gene activation. Acetylation on Lys-10 (H3K9ac) impairs methylation at Arg-9 (H3R8me2s). Acetylation on Lys-19 (H3K18ac) and Lys-24 (H3K24ac) favors methylation at Arg-18 (H3R17me). Acetylation at Lys-123 (H3K122ac) by EP300/p300 plays a central role in chromatin structure: localizes at the surface of the histone octamer and stimulates transcription, possibly by promoting nucleosome instability.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" }, { "database": "PubMed", "id": "23415232", "url": "https://glygen.org/publication/PubMed/23415232" }, { "database": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" }, { "database": "PubMed", "id": "16497732", "url": "https://glygen.org/publication/PubMed/16497732" }, { "database": "PubMed", "id": "15345777", "url": "https://glygen.org/publication/PubMed/15345777" }, { "database": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" }, { "database": "PubMed", "id": "19520870", "url": "https://glygen.org/publication/PubMed/19520870" }, { "database": "PubMed", "id": "16627869", "url": "https://glygen.org/publication/PubMed/16627869" }, { "database": "PubMed", "id": "17194708", "url": "https://glygen.org/publication/PubMed/17194708" }, { "database": "PubMed", "id": "16267050", "url": "https://glygen.org/publication/PubMed/16267050" }, { "database": "PubMed", "id": "15471871", "url": "https://glygen.org/publication/PubMed/15471871" } ] }, { "annotation": "Asymmetric dimethylation at Arg-18 (H3R17me2a) by CARM1 is linked to gene activation. Symmetric dimethylation at Arg-9 (H3R8me2s) by PRMT5 is linked to gene repression. Asymmetric dimethylation at Arg-3 (H3R2me2a) by PRMT6 is linked to gene repression and is mutually exclusive with H3 Lys-5 methylation (H3K4me2 and H3K4me3). H3R2me2a is present at the 3' of genes regardless of their transcription state and is enriched on inactive promoters, while it is absent on active promoters.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "16497732", "url": "https://glygen.org/publication/PubMed/16497732" }, { "database": "PubMed", "id": "18079182", "url": "https://glygen.org/publication/PubMed/18079182" }, { "database": "PubMed", "id": "15345777", "url": "https://glygen.org/publication/PubMed/15345777" }, { "database": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" }, { "database": "PubMed", "id": "17898714", "url": "https://glygen.org/publication/PubMed/17898714" }, { "database": "PubMed", "id": "17194708", "url": "https://glygen.org/publication/PubMed/17194708" }, { "database": "PubMed", "id": "16267050", "url": "https://glygen.org/publication/PubMed/16267050" }, { "database": "PubMed", "id": "18077460", "url": "https://glygen.org/publication/PubMed/18077460" }, { "database": "PubMed", "id": "15471871", "url": "https://glygen.org/publication/PubMed/15471871" } ] }, { "annotation": "Citrullination at Arg-9 (H3R8ci) and/or Arg-18 (H3R17ci) by PADI4 impairs methylation and represses transcription.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "16567635", "url": "https://glygen.org/publication/PubMed/16567635" }, { "database": "PubMed", "id": "16497732", "url": "https://glygen.org/publication/PubMed/16497732" }, { "database": "PubMed", "id": "15345777", "url": "https://glygen.org/publication/PubMed/15345777" }, { "database": "PubMed", "id": "15471871", "url": "https://glygen.org/publication/PubMed/15471871" } ] }, { "annotation": "Crotonylation (Kcr) is specifically present in male germ cells and marks testis-specific genes in post-meiotic cells, including X-linked genes that escape sex chromosome inactivation in haploid cells. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. It is also associated with post-meiotically activated genes on autosomes.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "21925322", "url": "https://glygen.org/publication/PubMed/21925322" } ] }, { "annotation": "Dopaminylated by TGM2 at Gln-6 (H3Q5dop) in ventral tegmental area (VTA) neurons (PubMed:32273471). H3Q5dop mediates neurotransmission-independent role of nuclear dopamine by regulating relapse-related transcriptional plasticity in the reward system (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "32273471", "url": "https://glygen.org/publication/PubMed/32273471" } ] }, { "annotation": "Lactylated in macrophages by EP300/P300 by using lactoyl-CoA directly derived from endogenous or exogenous lactate, leading to stimulates gene transcription.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "31645732", "url": "https://glygen.org/publication/PubMed/31645732" } ] }, { "annotation": "Lysine deamination at Lys-5 (H3K4all) to form allysine is mediated by LOXL2. Allysine formation by LOXL2 only takes place on H3K4me3 and results in gene repression.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "27735137", "url": "https://glygen.org/publication/PubMed/27735137" } ] }, { "annotation": "Methylation at Lys-5 (H3K4me), Lys-37 (H3K36me) and Lys-80 (H3K79me) are linked to gene activation. Methylation at Lys-5 (H3K4me) facilitates subsequent acetylation of H3 and H4. Methylation at Lys-80 (H3K79me) is associated with DNA double-strand break (DSB) responses and is a specific target for TP53BP1. Methylation at Lys-10 (H3K9me) and Lys-28 (H3K27me) are linked to gene repression. Methylation at Lys-10 (H3K9me) is a specific target for HP1 proteins (CBX1, CBX3 and CBX5) and prevents subsequent phosphorylation at Ser-11 (H3S10ph) and acetylation of H3 and H4. Methylation at Lys-5 (H3K4me) and Lys-80 (H3K79me) require preliminary monoubiquitination of H2B at 'Lys-120'. Methylation at Lys-10 (H3K9me) and Lys-28 (H3K27me) are enriched in inactive X chromosome chromatin. Monomethylation at Lys-57 (H3K56me1) by EHMT2/G9A in G1 phase promotes interaction with PCNA and is required for DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" }, { "database": "PubMed", "id": "11856369", "url": "https://glygen.org/publication/PubMed/11856369" }, { "database": "PubMed", "id": "15983376", "url": "https://glygen.org/publication/PubMed/15983376" }, { "database": "PubMed", "id": "15681610", "url": "https://glygen.org/publication/PubMed/15681610" }, { "database": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" }, { "database": "PubMed", "id": "16497732", "url": "https://glygen.org/publication/PubMed/16497732" }, { "database": "PubMed", "id": "22387026", "url": "https://glygen.org/publication/PubMed/22387026" }, { "database": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" }, { "database": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" }, { "database": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" }, { "database": "PubMed", "id": "15525939", "url": "https://glygen.org/publication/PubMed/15525939" }, { "database": "PubMed", "id": "16627869", "url": "https://glygen.org/publication/PubMed/16627869" }, { "database": "PubMed", "id": "17194708", "url": "https://glygen.org/publication/PubMed/17194708" }, { "database": "PubMed", "id": "17189264", "url": "https://glygen.org/publication/PubMed/17189264" }, { "database": "PubMed", "id": "16267050", "url": "https://glygen.org/publication/PubMed/16267050" } ] }, { "annotation": "Monoubiquitinated at Lys-15 (H3K14ub), Lys-19 (H3K18ub) and Lys-24 (H3K23ub) by UHRF1 and HLTF at hemimethylated DNA sites following DNA replication, promoting recruitment of DNMT1 DNA methyltransferase and replication-coupled DNA methylation maintenance (PubMed:27595565, PubMed:29053958). Monoubiquitinated at Lys-15 (H3K14ub) by G2E3: H3K14ub represents a specific tag for heterochromatin formation by facilitating the deposition of H3K9me3 (PubMed:41094145). Monoubiquitinated by RAG1 in lymphoid cells, monoubiquitination is required for V(D)J recombination (By similarity). Ubiquitinated by the CUL4-DDB-RBX1 complex in response to ultraviolet irradiation (PubMed:16678110). This may weaken the interaction between histones and DNA and facilitate DNA accessibility to repair proteins (PubMed:16678110).", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "16678110", "url": "https://glygen.org/publication/PubMed/16678110" }, { "database": "PubMed", "id": "41094145", "url": "https://glygen.org/publication/PubMed/41094145" }, { "database": "PubMed", "id": "29053958", "url": "https://glygen.org/publication/PubMed/29053958" }, { "database": "PubMed", "id": "27595565", "url": "https://glygen.org/publication/PubMed/27595565" } ] }, { "annotation": "Phosphorylated at Thr-4 (H3T3ph) by VRK1 (PubMed:31527692). Phosphorylated at Thr-4 (H3T3ph) by HASPIN during prophase and dephosphorylated during anaphase (PubMed:15681610, PubMed:16185088). Phosphorylation at Ser-11 (H3S10ph) by AURKB is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. In addition phosphorylation at Ser-11 (H3S10ph) by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-fos and c-jun. Phosphorylation at Ser-11 (H3S10ph), which is linked to gene activation, prevents methylation at Lys-10 (H3K9me) but facilitates acetylation of H3 and H4. Phosphorylation at Ser-11 (H3S10ph) by AURKB mediates the dissociation of HP1 proteins (CBX1, CBX3 and CBX5) from heterochromatin. Phosphorylation at Ser-11 (H3S10ph) is also an essential regulatory mechanism for neoplastic cell transformation. Phosphorylated at Ser-29 (H3S28ph) by MAP3K20 isoform 1, RPS6KA5 or AURKB during mitosis or upon ultraviolet B irradiation. Phosphorylation at Thr-7 (H3T6ph) by PRKCB is a specific tag for epigenetic transcriptional activation that prevents demethylation of Lys-5 (H3K4me) by LSD1/KDM1A. At centromeres, specifically phosphorylated at Thr-12 (H3T11ph) from prophase to early anaphase, by DAPK3 and PKN1. Phosphorylation at Thr-12 (H3T11ph) by PKN1 or isoform M2 of PKM (PKM2) is a specific tag for epigenetic transcriptional activation that promotes demethylation of Lys-10 (H3K9me) by KDM4C/JMJD2C. Phosphorylation at Thr-12 (H3T11ph) by chromatin-associated CHEK1 regulates the transcription of cell cycle regulatory genes by modulating acetylation of Lys-10 (H3K9ac). Phosphorylation at Tyr-42 (H3Y41ph) by JAK2 promotes exclusion of CBX5 (HP1 alpha) from chromatin.", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "20228790", "url": "https://glygen.org/publication/PubMed/20228790" }, { "database": "PubMed", "id": "11242053", "url": "https://glygen.org/publication/PubMed/11242053" }, { "database": "PubMed", "id": "11856369", "url": "https://glygen.org/publication/PubMed/11856369" }, { "database": "PubMed", "id": "15681610", "url": "https://glygen.org/publication/PubMed/15681610" }, { "database": "PubMed", "id": "19783980", "url": "https://glygen.org/publication/PubMed/19783980" }, { "database": "PubMed", "id": "16185088", "url": "https://glygen.org/publication/PubMed/16185088" }, { "database": "PubMed", "id": "18066052", "url": "https://glygen.org/publication/PubMed/18066052" }, { "database": "PubMed", "id": "16497732", "url": "https://glygen.org/publication/PubMed/16497732" }, { "database": "PubMed", "id": "20850016", "url": "https://glygen.org/publication/PubMed/20850016" }, { "database": "PubMed", "id": "18243098", "url": "https://glygen.org/publication/PubMed/18243098" }, { "database": "PubMed", "id": "12560483", "url": "https://glygen.org/publication/PubMed/12560483" }, { "database": "PubMed", "id": "10464286", "url": "https://glygen.org/publication/PubMed/10464286" }, { "database": "PubMed", "id": "16457588", "url": "https://glygen.org/publication/PubMed/16457588" }, { "database": "PubMed", "id": "22901803", "url": "https://glygen.org/publication/PubMed/22901803" }, { "database": "PubMed", "id": "16627869", "url": "https://glygen.org/publication/PubMed/16627869" }, { "database": "PubMed", "id": "17194708", "url": "https://glygen.org/publication/PubMed/17194708" }, { "database": "PubMed", "id": "16267050", "url": "https://glygen.org/publication/PubMed/16267050" }, { "database": "PubMed", "id": "15684425", "url": "https://glygen.org/publication/PubMed/15684425" }, { "database": "PubMed", "id": "31527692", "url": "https://glygen.org/publication/PubMed/31527692" } ] }, { "annotation": "Serine ADP-ribosylation by PARP1 or PARP2 constitutes the primary form of ADP-ribosylation of proteins in response to DNA damage (PubMed:30257210, PubMed:34874266). Serine ADP-ribosylation at Ser-11 (H3S10ADPr) promotes recruitment of CHD1L (PubMed:34874266). H3S10ADPr is mutually exclusive with phosphorylation at Ser-11 (H3S10ph) and impairs acetylation at Lys-10 (H3K9ac) (PubMed:30257210).", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "34874266", "url": "https://glygen.org/publication/PubMed/34874266" }, { "database": "PubMed", "id": "30257210", "url": "https://glygen.org/publication/PubMed/30257210" } ] }, { "annotation": "Serotonylated by TGM2 at Gln-6 (H3Q5ser) during serotonergic neuron differentiation (PubMed:30867594). H3Q5ser is associated with trimethylation of Lys-5 (H3K4me3) and enhances general transcription factor IID (TFIID) complex-binding to H3K4me3, thereby facilitating transcription (PubMed:30867594).", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "30867594", "url": "https://glygen.org/publication/PubMed/30867594" } ] }, { "annotation": "Succinylation at Lys-80 (H3K79succ) by KAT2A takes place with a maximum frequency around the transcription start sites of genes (PubMed:29211711). It gives a specific tag for epigenetic transcription activation (PubMed:29211711). Desuccinylation at Lys-123 (H3K122succ) by SIRT7 in response to DNA damage promotes chromatin condensation and double-strand breaks (DSBs) repair (PubMed:27436229).", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PubMed", "id": "29211711", "url": "https://glygen.org/publication/PubMed/29211711" }, { "database": "PubMed", "id": "27436229", "url": "https://glygen.org/publication/PubMed/27436229" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "biomarker_id": "AN6379-1", "biomarker_canonical_id": "AN6379", "best_biomarker_role": [ "prognostic" ], "condition": { "id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infectious disease that is characterized by fever, cough and shortness of breath and that has_material_basis_in Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), a subtype of Betacoronavirus pandemicum." }, "name_list": [ "COVID-19", "2019 Novel Coronavirus (2019-nCoV)", "2019-nCoV infection", "COVID19", "SARS-CoV-2 infection", "2019 novel coronavirus infection", "coronavirus disease 2019", "severe acute respiratory syndrome coronavirus 2 infectious disease", "2019 novel coronavirus", "2019-nCoV", "SARS-CoV-2", "SARS-coronavirus 2", "beta-CoV", "beta-CoVs", "betacoronavirus", "severe acute respiratory syndrome coronavirus 2", "-CoV", "-CoVs", "-coronavirus" ], "id_list": [ "DOID:0080600", "MONDO:0100096" ] }, "evidence": [ { "id": "AN6379-1", "database": "BiomarkerKB", "url": "https://biomarkerkb.org/biomarker/AN6379-1" }, { "id": "32329756", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32329756" } ], "assessed_biomarker_entity": [ "Histone H3.1" ], "biomarker": [ "increased CIT-H3 level" ] }, { "biomarker_id": "AN6379-2", "biomarker_canonical_id": "AN6379", "best_biomarker_role": [ "prognostic" ], "condition": { "id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "name_list": [ "lung cancer", "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "adenocarcinoma of lung, somatic", "cancer of lung", "lung cancer, protection against, autosomal dominant, somatic mutation", "lung cancer, resistance to, autosomal dominant, somatic mutation", "lung cancer, somatic", "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "malignant lung neoplasm", "malignant lung tumor", "malignant lung tumour", "malignant neoplasm of lung", "malignant neoplasm of the lung", "malignant tumor of lung", "malignant tumor of the lung", "malignant tumour of lung", "malignant tumour of the lung", "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "nonsmall cell lung cancer, somatic", "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "lung cancer susceptibility 1", "LNCR1", "lung cancer susceptibility", "lung cancer susceptibility 3", "LNCR3", "lung cancer susceptibility 4", "LNCR4", "lung cancer susceptibility 5", "LNCR5", "Lung cancer" ], "id_list": [ "DOID:1324", "MONDO:0008903", "MONDO:0012159", "MONDO:0012942", "MONDO:0012955", "MONDO:0013631", "MIM:211980" ] }, "evidence": [ { "id": "AN6379-2", "database": "BiomarkerKB", "url": "https://biomarkerkb.org/biomarker/AN6379-2" }, { "id": "29324871", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29324871" } ], "assessed_biomarker_entity": [ "Histone H3.1" ], "biomarker": [ "increased CIT-H3 level" ] }, { "biomarker_id": "AN6379-3", "biomarker_canonical_id": "AN6379", "best_biomarker_role": [ "monitoring" ], "condition": { "id": "DOID:9351", "recommended_name": { "id": "DOID:9351", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9351", "name": "diabetes mellitus", "description": "A glucose metabolism disease that is characterized by chronic hyperglycaemia with disturbances of carbohydrate, fat and protein metabolism resulting from defects in insulin secretion, insulin action, or both." }, "name_list": [ "diabetes mellitus", "diabetes" ], "id_list": [ "DOID:9351" ] }, "evidence": [ { "id": "AN6379-3", "database": "BiomarkerKB", "url": "https://biomarkerkb.org/biomarker/AN6379-3" }, { "id": "30992036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30992036" } ], "assessed_biomarker_entity": [ "Histone H3.1" ], "biomarker": [ "increased CIT-H3 level" ] } ], "structures": [ { "pdb_id": "AF-P68431-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 136, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-P68431-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/P68431" }, { "pdb_id": "5y0d", "pdb_chain": "a/e", "start_pos": 1, "end_pos": 136, "overlap": "1.0", "method": "X-Ray_Crystallography", "type": "experimental", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/5y0d.pdb", "url_external": "https://www.rcsb.org/structure/5y0d" } ], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 11, 29, 33, 46 ], "snv_sites": [ 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136 ], "sites_with_glycoeffect": [ 11, 11, 33, 46, 100, 100, 100, 100, 108, 108, 108, 108, 109, 109, 109, 10, 110, 111, 111, 111, 119, 119, 11, 11, 11, 12, 12, 12, 23, 23, 23, 29, 29, 29, 29, 29, 33, 33, 33, 33, 42, 42, 42, 46, 46, 46, 46, 46, 4, 4, 4, 4, 55, 55, 55, 57, 58, 58, 58, 58, 58, 58, 59, 59, 5, 7, 7, 7, 7, 7, 81, 81, 81, 81, 87, 87, 88, 88, 88 ], "glycation_sites": [], "phosphorylation_sites": [ 4, 7, 11, 12, 29, 42, 46, 58, 81, 87, 108 ], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "exact_o_linked_glycan_sites", "count": 4 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "exact_o_linked_glycan_sites", "count": 4 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 34 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 570 }, { "field": "total_sites", "count": 134 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 562 }, { "field": "total_sites", "count": 134 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1135 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ], "tool_support": { "graph_view": "yes" } } ]