[ { "title": "Phf19 links methylated Lys36 of histone H3 to regulation of Polycomb activity.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Ballare C, Lange M, Lapinaite A, Martin GM, Morey L, Pascual G, Liefke R, Simon B, Shi Y, Gozani O, Carlomagno T, Benitah SA, Di Croce L", "reference": { "type": "PubMed", "id": "23104054", "url": "https://pubmed.ncbi.nlm.nih.gov/23104054" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5T6S3-1", "protein_name": "PHD finger protein 19", "gene_name": "PHF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CXG9-1", "protein_name": "PHD finger protein 19", "gene_name": "Phf19", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Z1B8-1", "protein_name": "PHD finger protein 1", "gene_name": "Phf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q02395-1", "protein_name": "Metal-response element-binding transcription factor 2", "gene_name": "Mtf2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q24459-1", "protein_name": "Polycomb protein Pcl", "gene_name": "Pcl", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 50, "end_pos": 50, "sequence_org": "W", "sequence_mut": "A", "comment": "In muthPhf19; abolishes histone H3K36me3-binding and impaired activity of the PRC2 complex and subsequent H3K27me3 methylation.", "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" }, { "database": "PubMed", "id": "23104054", "url": "https://pubmed.ncbi.nlm.nih.gov/23104054" }, { "database": "PubMed", "id": "23160351", "url": "https://pubmed.ncbi.nlm.nih.gov/23160351" } ], "uniprot_canonical_ac": "Q5T6S3-1" }, { "start_pos": 50, "end_pos": 50, "sequence_org": "W", "sequence_mut": "C", "comment": "Abolishes histone H3K36me3-binding and recruitment of the PRC2 complex and RIOX1; when associated with A-56.", "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" }, { "database": "PubMed", "id": "23104054", "url": "https://pubmed.ncbi.nlm.nih.gov/23104054" }, { "database": "PubMed", "id": "23160351", "url": "https://pubmed.ncbi.nlm.nih.gov/23160351" } ], "uniprot_canonical_ac": "Q5T6S3-1" } ], "record_id": "pubmed.23104054", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polycomb PHF19 binds H3K36me3 and recruits PRC2 and demethylase NO66 to embryonic stem cell genes during differentiation.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Brien GL, Gambero G, O'Connell DJ, Jerman E, Turner SA, Egan CM, Dunne EJ, Jurgens MC, Wynne K, Piao L, Lohan AJ, Ferguson N, Shi X, Sinha KM, Loftus BJ, Cagney G, Bracken AP", "reference": { "type": "PubMed", "id": "23160351", "url": "https://pubmed.ncbi.nlm.nih.gov/23160351" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5T6S3-1", "protein_name": "PHD finger protein 19", "gene_name": "PHF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "A5PK74-1", "protein_name": "Ribosomal oxygenase 1", "gene_name": "RIOX1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9CXG9-1", "protein_name": "PHD finger protein 19", "gene_name": "Phf19", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H6W3-1", "protein_name": "Ribosomal oxygenase 1", "gene_name": "RIOX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 50, "end_pos": 50, "sequence_org": "W", "sequence_mut": "A", "comment": "In muthPhf19; abolishes histone H3K36me3-binding and impaired activity of the PRC2 complex and subsequent H3K27me3 methylation.", "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" }, { "database": "PubMed", "id": "23104054", "url": "https://pubmed.ncbi.nlm.nih.gov/23104054" }, { "database": "PubMed", "id": "23160351", "url": "https://pubmed.ncbi.nlm.nih.gov/23160351" } ], "uniprot_canonical_ac": "Q5T6S3-1" }, { "start_pos": 50, "end_pos": 50, "sequence_org": "W", "sequence_mut": "C", "comment": "Abolishes histone H3K36me3-binding and recruitment of the PRC2 complex and RIOX1; when associated with A-56.", "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" }, { "database": "PubMed", "id": "23104054", "url": "https://pubmed.ncbi.nlm.nih.gov/23104054" }, { "database": "PubMed", "id": "23160351", "url": "https://pubmed.ncbi.nlm.nih.gov/23160351" } ], "uniprot_canonical_ac": "Q5T6S3-1" }, { "start_pos": 56, "end_pos": 56, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes histone H3K36me3-binding. Abolishes histone H3K36me3-binding and recruitment of the PRC2 complex and RIOX1; when associated with C-50.", "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" }, { "database": "PubMed", "id": "23273982", "url": "https://pubmed.ncbi.nlm.nih.gov/23273982" }, { "database": "PubMed", "id": "23160351", "url": "https://pubmed.ncbi.nlm.nih.gov/23160351" } ], "uniprot_canonical_ac": "Q5T6S3-1" } ], "record_id": "pubmed.23160351", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PHF19 activates hedgehog signaling and promotes tumorigenesis in hepatocellular carcinoma.", "journal": "Experimental cell research", "date": "2021", "authors": "Xiaoyun S, Yuyuan Z, Jie X, Yingjie N, Qing X, Yuezhen D, Haiguang X", "reference": { "type": "PubMed", "id": "34129846", "url": "https://pubmed.ncbi.nlm.nih.gov/34129846" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5T6S3-1", "protein_name": "PHD finger protein 19", "gene_name": "PHF19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34129846", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PHD finger protein 19 expression in multiple myeloma: Association with clinical features, induction therapy outcome, disease progression, and survival.", "journal": "Journal of clinical laboratory analysis", "date": "2021", "authors": "Li Y, Gong J, Zhang L", "reference": { "type": "PubMed", "id": "34390275", "url": "https://pubmed.ncbi.nlm.nih.gov/34390275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5T6S3-1", "protein_name": "PHD finger protein 19", "gene_name": "PHF19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34390275", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of hPCL3 isoforms' ubiquitination by TRIM21 in non-small cell lung cancer progression.", "journal": "Life science alliance", "date": "2023-10", "authors": "Xu Ye, Liu Wenhong, Jiang Xiawei, Li Junfeng, Liu Qingling, Su Fang, Ruan Shanming, Zhang Zhiqian, Tao Fangfang", "reference": { "type": "PubMed", "id": "37507137", "url": "https://pubmed.ncbi.nlm.nih.gov/37507137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5T6S3-1", "protein_name": "PHD finger protein 19", "gene_name": "PHF19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37507137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "1q amplification and PHF19 expressing high-risk cells are associated with relapsed/refractory multiple myeloma.", "journal": "Nature communications", "date": "2024-05-16", "authors": "Johnson Travis S, Sudha Parvathi, Liu Enze, Becker Nathan, Robertson Sylvia, Blaney Patrick, Morgan Gareth, Chopra Vivek S, Dos Santos Cedric, Nixon Michael, Huang Kun, Suvannasankha Attaya, Zaid Mohammad Abu, Abonour Rafat, Walker Brian A", "reference": { "type": "PubMed", "id": "38755140", "url": "https://pubmed.ncbi.nlm.nih.gov/38755140" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5T6S3-1", "protein_name": "PHD finger protein 19", "gene_name": "PHF19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5T6S3", "url": "https://www.uniprot.org/uniprotkb/Q5T6S3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38755140", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MAPKAP kinase 2 phosphorylates serum response factor in vitro and in vivo.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Heidenreich O, Neininger A, Schratt G, Zinck R, Cahill MA, Engel K, Kotlyarov A, Kraft R, Kostka S, Gaestel M, Nordheim A", "reference": { "type": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "12171911", "url": "https://pubmed.ncbi.nlm.nih.gov/12171911" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.10318869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Skeletal muscle CaMKII enriches in nuclei and phosphorylates myogenic factor SRF at multiple sites.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Fluck M, Booth FW, Waxham MN", "reference": { "type": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "12171911", "url": "https://pubmed.ncbi.nlm.nih.gov/12171911" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" } ], "site_lbl": "Thr160", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "15282327", "url": "https://pubmed.ncbi.nlm.nih.gov/15282327" } ], "site_lbl": "Thr160", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.10753652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vav1 couples T cell receptor to serum response factor-dependent transcription via a MEK-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Charvet C, Auberger P, Tartare-Deckert S, Bernard A, Deckert M", "reference": { "type": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.11859076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel sites of O-N-acetylglucosamine modification of serum response factor using quadrupole time-of-flight mass spectrometry.", "journal": "Molecular & cellular proteomics : MCP", "date": "2003", "authors": "Chalkley RJ, Burlingame AL", "reference": { "type": "PubMed", "id": "12684542", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 277, "start_aa": "Ser", "end_pos": 277, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser277", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" }, { "id": "1687959", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1687959" }, { "id": "561", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/561" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 288, "start_aa": "Thr", "end_pos": 288, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr288", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 307, "start_aa": "Ser", "end_pos": 307, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser307", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 309, "start_aa": "Ser", "end_pos": 309, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser309", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 311, "start_aa": "Ser", "end_pos": 311, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser311", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 313, "start_aa": "Ser", "end_pos": 313, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser313", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 316, "start_aa": "Ser", "end_pos": 316, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser316", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" }, { "id": "1687959", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1687959" }, { "id": "561", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/561" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 383, "start_aa": "Ser", "end_pos": 383, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser383", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 402, "start_aa": "Thr", "end_pos": 402, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr402", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 460, "start_aa": "Thr", "end_pos": 460, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr460", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 462, "start_aa": "Ser", "end_pos": 462, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser462", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 463, "start_aa": "Ser", "end_pos": 463, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser463", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 465, "start_aa": "Thr", "end_pos": 465, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr465", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 471, "start_aa": "Ser", "end_pos": 471, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser471", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.12684542", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 16 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_o_linked_sites", "count": 16 }, { "field": "exact_o_linked_glycan_sites", "count": 16 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 16 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_o_linked_sites", "count": 16 }, { "field": "exact_o_linked_glycan_sites", "count": 16 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Megakaryoblastic leukemia-1/2, a transcriptional co-activator of serum response factor, is required for skeletal myogenic differentiation.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Selvaraj A, Prywes R", "reference": { "type": "PubMed", "id": "14565952", "url": "https://pubmed.ncbi.nlm.nih.gov/14565952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969V6-1", "protein_name": "Myocardin-related transcription factor A", "gene_name": "MRTFA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULH7-1", "protein_name": "Myocardin-related transcription factor B", "gene_name": "MRTFB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14565952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of O-GlcNAc modification on the serum response transcription factor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Reason AJ, Morris HR, Panico M, Marais R, Treisman RH, Haltiwanger RS, Hart GW, Kelly WG, Dell A", "reference": { "type": "PubMed", "id": "1512232", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 277, "start_aa": "Ser", "end_pos": 277, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser277", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" }, { "id": "1687959", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1687959" }, { "id": "561", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/561" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 277, "start_aa": "Ser", "end_pos": 277, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser277", "evidence": [ { "id": "P11831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11831#ptm_processing" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" } ], "filter_code": "000000000000000100000.00000001000000.00.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 288, "start_aa": "Thr", "end_pos": 288, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr288", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 307, "start_aa": "Ser", "end_pos": 307, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser307", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 307, "start_aa": "Ser", "end_pos": 307, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser307", "evidence": [ { "id": "P11831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11831#ptm_processing" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" } ], "filter_code": "000000000000000100000.00000001000000.00.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 309, "start_aa": "Ser", "end_pos": 309, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser309", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 309, "start_aa": "Ser", "end_pos": 309, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser309", "evidence": [ { "id": "P11831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11831#ptm_processing" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" } ], "filter_code": "000000000000000100000.00000001000000.00.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 311, "start_aa": "Ser", "end_pos": 311, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser311", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 313, "start_aa": "Ser", "end_pos": 313, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser313", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 316, "start_aa": "Ser", "end_pos": 316, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser316", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" }, { "id": "1687959", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1687959" }, { "id": "561", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/561" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 316, "start_aa": "Ser", "end_pos": 316, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser316", "evidence": [ { "id": "P11831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11831#ptm_processing" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" } ], "filter_code": "000000000000000100000.00000001000000.00.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 383, "start_aa": "Ser", "end_pos": 383, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser383", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 383, "start_aa": "Ser", "end_pos": 383, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser383", "evidence": [ { "id": "P11831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11831#ptm_processing" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" } ], "filter_code": "000000000000000100000.00000001000000.00.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 384, "start_aa": "Ser", "end_pos": 384, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser384", "evidence": [ { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 385, "start_aa": "Ser", "end_pos": 385, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser385", "evidence": [ { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 402, "start_aa": "Thr", "end_pos": 402, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr402", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 460, "start_aa": "Thr", "end_pos": 460, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr460", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 462, "start_aa": "Ser", "end_pos": 462, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser462", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 463, "start_aa": "Ser", "end_pos": 463, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser463", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 465, "start_aa": "Thr", "end_pos": 465, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr465", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 471, "start_aa": "Ser", "end_pos": 471, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser471", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P11831", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11831" }, { "id": "12684542", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12684542" }, { "id": "1512232", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1512232" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11831", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11831" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.1512232", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 18 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 18 }, { "field": "exact_o_linked_sites", "count": 18 }, { "field": "exact_o_linked_glycan_sites", "count": 18 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 18 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 18 }, { "field": "exact_o_linked_sites", "count": 18 }, { "field": "exact_o_linked_glycan_sites", "count": 18 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase C delta blocks immediate-early gene expression in senescent cells by inactivating serum response factor.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Wheaton K, Riabowol K", "reference": { "type": "PubMed", "id": "15282327", "url": "https://pubmed.ncbi.nlm.nih.gov/15282327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "Q05655-1", "kinase_gene_name": "PRKCD", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "15282327", "url": "https://pubmed.ncbi.nlm.nih.gov/15282327" } ], "site_lbl": "Thr160", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "15282327", "url": "https://pubmed.ncbi.nlm.nih.gov/15282327" } ], "site_lbl": "Thr160", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.15282327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of multiple SRF N-terminal phosphorylation sites affecting DNA binding properties.", "journal": "The EMBO journal", "date": "1992", "authors": "Janknecht R, Hipskind RA, Houthaeve T, Nordheim A, Stunnenberg HG", "reference": { "type": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 79, "end_pos": 79, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser79", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" } ], "site_lbl": "Ser83", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" } ], "site_lbl": "Ser85", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.1547771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Casein kinase II phosphorylation increases the rate of serum response factor-binding site exchange.", "journal": "The EMBO journal", "date": "1992", "authors": "Marais RM, Hsuan JJ, McGuigan C, Wynne J, Treisman R", "reference": { "type": "PubMed", "id": "1740119", "url": "https://pubmed.ncbi.nlm.nih.gov/1740119" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "1740119", "url": "https://pubmed.ncbi.nlm.nih.gov/1740119" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" } ], "site_lbl": "Ser83", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.1740119", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The LIM protein leupaxin is enriched in smooth muscle and functions as an serum response factor cofactor to induce smooth muscle cell gene transcription.", "journal": "Circ. Res.", "date": "2008", "authors": "Sundberg-Smith LJ, DiMichele LA, Sayers RL, Mack CP, Taylor JM", "reference": { "type": "PubMed", "id": "18497331", "url": "https://pubmed.ncbi.nlm.nih.gov/18497331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60711-1", "protein_name": "Leupaxin", "gene_name": "LPXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99N69-1", "protein_name": "Leupaxin", "gene_name": "Lpxn", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18497331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PKA-dependent phosphorylation of serum response factor inhibits smooth muscle-specific gene expression.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "Blaker AL, Taylor JM, Mack CP", "reference": { "type": "PubMed", "id": "19778940", "url": "https://pubmed.ncbi.nlm.nih.gov/19778940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "19778940", "url": "https://pubmed.ncbi.nlm.nih.gov/19778940" } ], "site_lbl": "Thr159", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.19778940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation of serum response factor phosphorylation sites and the mechanism by which its DNA-binding activity is increased by casein kinase II.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Manak JR, Prywes R", "reference": { "type": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "1740119", "url": "https://pubmed.ncbi.nlm.nih.gov/1740119" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" } ], "site_lbl": "Ser83", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" } ], "site_lbl": "Ser83", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "2046671", "url": "https://pubmed.ncbi.nlm.nih.gov/2046671" } ], "site_lbl": "Ser85", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.2046671", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NADPH oxidase 4 mediates TGF-beta-induced smooth muscle alpha-actin via p38MAPK and serum response factor.", "journal": "Free radical biology & medicine", "date": "2011", "authors": "Martin-Garrido A, Brown DI, Lyle AN, Dikalova A, Seidel-Rogol B, Lassegue B, San Martin A, Griendling KK", "reference": { "type": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.21074607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Olfactomedin 2, a novel regulator for transforming growth factor-beta-induced smooth muscle differentiation of human embryonic stem cell-derived mesenchymal cells.", "journal": "Mol. Biol. Cell", "date": "2014", "authors": "Shi N, Guo X, Chen SY", "reference": { "type": "PubMed", "id": "25298399", "url": "https://pubmed.ncbi.nlm.nih.gov/25298399" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95897-1", "protein_name": "Noelin-2", "gene_name": "OLFM2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25298399", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and properties of cDNA clones encoding SRF, a transcription factor that binds to the c-fos serum response element.", "journal": "Cell", "date": "1988", "authors": "Norman C, Runswick M, Pollock R, Treisman R", "reference": { "type": "PubMed", "id": "3203386", "url": "https://pubmed.ncbi.nlm.nih.gov/3203386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3203386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signalosome-Regulated Serum Response Factor Phosphorylation Determining Myocyte Growth in Width Versus Length as a Therapeutic Target for Heart Failure.", "journal": "Circulation", "date": "2020", "authors": "Li J, Tan Y, Passariello CL, Martinez EC, Kritzer MD, Li X, Li X, Li Y, Yu Q, Ohgi K, Thakur H, MacArthur JW Jr, Ivey JR, Woo YJ, Emter CA, Dodge-Kafka K, Rosenfeld MG, Kapiloff MS", "reference": { "type": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WVC7-1", "protein_name": "A-kinase anchor protein 6", "gene_name": "Akap6", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.32933333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A GSK3-SRF Axis Mediates Angiotensin II Induced Endothelin Transcription in Vascular Endothelial Cells.", "journal": "Frontiers in cell and developmental biology", "date": "2021", "authors": "Yang Yuyu, Wang Huidi, Zhao Hongwei, Miao Xiulian, Guo Yan, Zhuo Lili, Xu Yong", "reference": { "type": "PubMed", "id": "34381779", "url": "https://pubmed.ncbi.nlm.nih.gov/34381779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "34381779", "url": "https://pubmed.ncbi.nlm.nih.gov/34381779" } ], "site_lbl": "Ser224", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.34381779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SRF/MRTF-A and liver cirrhosis: Pathologic associations.", "journal": "Journal of digestive diseases", "date": "2022-11", "authors": "Al-Hetty Hussein Riyadh Abdul Kareem, Ismaeel Ghufran Lutfi, Mohammad Walid Theib, Toama Mariam Alaa, Kandeel Mahmoud, Saleh Marwan Mahmood, Turki Jalil Abduladheem", "reference": { "type": "PubMed", "id": "36601855", "url": "https://pubmed.ncbi.nlm.nih.gov/36601855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969V6-1", "protein_name": "Myocardin-related transcription factor A", "gene_name": "MRTFA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36601855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MRTF-A/SRF signaling suppresses invasion of oral squamous cell carcinoma.", "journal": "Oral diseases", "date": "2024-05", "authors": "Yang Dan, Yang Dan, He Yuqing, Liu Jiaxin, Song Yansong, Zhou Yu, Jiang Lu, Zeng Xin, Xu Xiaoping, Xu Hao, Li Jing, Dan Hongxia", "reference": { "type": "PubMed", "id": "37154247", "url": "https://pubmed.ncbi.nlm.nih.gov/37154247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969V6-1", "protein_name": "Myocardin-related transcription factor A", "gene_name": "MRTFA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37154247", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cellular myofibromas with SRF fusions: clinicopathological and molecular study of 3 cases of a rare entity and a potential mimic of sarcoma.", "journal": "Human pathology", "date": "2023-08", "authors": "Papa Brigitte, Nguyen Minh Anh, Kumar Amit, Song Liyan, Dorwal Pranav, Cheah Alison L", "reference": { "type": "PubMed", "id": "37245628", "url": "https://pubmed.ncbi.nlm.nih.gov/37245628" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37245628", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of serum response factor core bound to DNA.", "journal": "Nature", "date": "1995", "authors": "Pellegrini L, Tan S, Richmond T J", "reference": { "type": "PubMed", "id": "7637780", "url": "https://pubmed.ncbi.nlm.nih.gov/7637780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7637780", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-type voltage-sensitive calcium channel activation stimulates gene expression by a serum response factor-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Misra RP, Bonni A, Miranti CK, Rivera VM, Sheng M, Greenberg ME", "reference": { "type": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.7929249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C-terminal phosphorylation of the serum-response factor.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Janknecht R, Ernst WH, Houthaeve T, Nordheim A", "reference": { "type": "PubMed", "id": "8375385", "url": "https://pubmed.ncbi.nlm.nih.gov/8375385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 253, "end_pos": 253, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "8375385", "url": "https://pubmed.ncbi.nlm.nih.gov/8375385" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" } ], "site_lbl": "Ser253", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.8375385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The carboxyl-terminal transactivation domain of human serum response factor contains DNA-activated protein kinase phosphorylation sites.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Liu SH, Ma JT, Yueh AY, Lees-Miller SP, Anderson CW, Ng SY", "reference": { "type": "PubMed", "id": "8407951", "url": "https://pubmed.ncbi.nlm.nih.gov/8407951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78527-1", "protein_name": "DNA-dependent protein kinase catalytic subunit", "gene_name": "PRKDC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 435, "end_pos": 435, "kinase_uniprot_canonical_ac": "P78527-1", "kinase_gene_name": "PRKDC", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "8407951", "url": "https://pubmed.ncbi.nlm.nih.gov/8407951" } ], "site_lbl": "Ser435", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 435, "end_pos": 435, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by dsDNA kinase", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "8407951", "url": "https://pubmed.ncbi.nlm.nih.gov/8407951" } ], "site_lbl": "Ser435", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 446, "end_pos": 446, "kinase_uniprot_canonical_ac": "P78527-1", "kinase_gene_name": "PRKDC", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "8407951", "url": "https://pubmed.ncbi.nlm.nih.gov/8407951" } ], "site_lbl": "Ser446", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 446, "end_pos": 446, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by dsDNA kinase", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "8407951", "url": "https://pubmed.ncbi.nlm.nih.gov/8407951" } ], "site_lbl": "Ser446", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.8407951", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A growth factor-induced kinase phosphorylates the serum response factor at a site that regulates its DNA-binding activity.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Rivera VM, Miranti CK, Misra RP, Ginty DD, Chen RH, Blenis J, Greenberg ME", "reference": { "type": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11831-1", "protein_name": "Serum response factor", "gene_name": "SRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "12171911", "url": "https://pubmed.ncbi.nlm.nih.gov/12171911" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "10753652", "url": "https://pubmed.ncbi.nlm.nih.gov/10753652" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" }, { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11831", "url": "https://www.uniprot.org/uniprotkb/P11831" }, { "database": "PubMed", "id": "1547771", "url": "https://pubmed.ncbi.nlm.nih.gov/1547771" }, { "database": "iPTMnet", "id": "P11831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11831" }, { "database": "PubMed", "id": "10318869", "url": "https://pubmed.ncbi.nlm.nih.gov/10318869" }, { "database": "PubMed", "id": "11859076", "url": "https://pubmed.ncbi.nlm.nih.gov/11859076" }, { "database": "PubMed", "id": "21074607", "url": "https://pubmed.ncbi.nlm.nih.gov/21074607" }, { "database": "PubMed", "id": "32933333", "url": "https://pubmed.ncbi.nlm.nih.gov/32933333" }, { "database": "PubMed", "id": "7929249", "url": "https://pubmed.ncbi.nlm.nih.gov/7929249" }, { "database": "PubMed", "id": "8413226", "url": "https://pubmed.ncbi.nlm.nih.gov/8413226" } ], "site_lbl": "Ser103", "uniprot_canonical_ac": "P11831-1" } ], "record_id": "pubmed.8413226", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LST1: a gene with extensive alternative splicing and immunomodulatory function.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000-03-15", "authors": "Rollinger-Holzinger I, Eibl B, Pauly M, Griesser U, Hentges F, Auer B, Pall G, Schratzberger P, Niederwieser D, Weiss E H, Zwierzina H", "reference": { "type": "PubMed", "id": "10706707", "url": "https://pubmed.ncbi.nlm.nih.gov/10706707" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10706707", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of B144/LST1: a gene in the tumor necrosis factor cluster that induces formation of long filopodia in eukaryotic cells.", "journal": "Experimental cell research", "date": "2001", "authors": "Raghunathan A, Sivakamasundari R, Wolenski J, Poddar R, Weissman SM", "reference": { "type": "PubMed", "id": "11478849", "url": "https://pubmed.ncbi.nlm.nih.gov/11478849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O08843-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "Lst1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11478849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LST1 and NCR3 expression in autoimmune inflammation and in response to IFN-gamma, LPS and microbial infection.", "journal": "Immunogenetics", "date": "2006", "authors": "Mulcahy H, O'Rourke K P, Adams C, Molloy M G, O'Gara F", "reference": { "type": "PubMed", "id": "16362817", "url": "https://pubmed.ncbi.nlm.nih.gov/16362817" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16362817", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of functional haplotypes in the promoter region of the LST1 gene.", "journal": "Biochemical genetics", "date": "2014", "authors": "Woo J, Lee C", "reference": { "type": "PubMed", "id": "24803336", "url": "https://pubmed.ncbi.nlm.nih.gov/24803336" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24803336", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An upstream open reading frame regulates LST1 expression during monocyte differentiation.", "journal": "PloS one", "date": "2014", "authors": "Schiller C, Nowak C, Diakopoulos KN, Weidle UH, Weiss EH", "reference": { "type": "PubMed", "id": "24816991", "url": "https://pubmed.ncbi.nlm.nih.gov/24816991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24816991", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of ERAP2 and LST1 is increased before start of therapy in rheumatoid arthritis patients with good clinical response to glucocorticoids.", "journal": "Clinical and experimental rheumatology", "date": "2016", "authors": "Fritsch-Stork RD, Silva-Cardoso SC, Groot Koerkamp MJ, Broen JC, Lafeber FF, Bijlsma JW", "reference": { "type": "PubMed", "id": "27384923", "url": "https://pubmed.ncbi.nlm.nih.gov/27384923" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27384923", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LST1: A multifunctional gene encoded in the MHC class III region.", "journal": "Immunobiology", "date": "2018", "authors": "Weidle UH, Rohwedder I, Birzele F, Weiss EH, Schiller C", "reference": { "type": "PubMed", "id": "30055863", "url": "https://pubmed.ncbi.nlm.nih.gov/30055863" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30055863", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Significance of leukocyte-specific transcript 1 levels in nasal mucosal tissue to predict recurrence of nasal polyps.", "journal": "Brazilian journal of otorhinolaryngology", "date": "2023", "authors": "Zhang Junyi, Cheng Shenghao, Xie Shaobing, Xie Zhihai, Zhang Hua, Wang Fengjun, Gao Kelei, Jiang Weihong", "reference": { "type": "PubMed", "id": "36754676", "url": "https://pubmed.ncbi.nlm.nih.gov/36754676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00453-1", "protein_name": "Leukocyte-specific transcript 1 protein", "gene_name": "LST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00453", "url": "https://www.uniprot.org/uniprotkb/O00453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36754676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of phosphoserine residues in the alpha subunit of rabbit skeletal muscle phosphorylase kinase.", "journal": "European journal of biochemistry", "date": "1990", "authors": "Meyer HE, Meyer GF, Dirks H, Heilmeyer LM Jr", "reference": { "type": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46020-1", "protein_name": "Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform", "gene_name": "PHKA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46020", "url": "https://www.uniprot.org/uniprotkb/P46020" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1007, "end_pos": 1007, "kinase_uniprot_canonical_ac": "P46020-1", "kinase_gene_name": "PHKA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46020" }, { "database": "PubMed", "id": "10487978", "url": "https://pubmed.ncbi.nlm.nih.gov/10487978" }, { "database": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" } ], "site_lbl": "Ser1007", "uniprot_canonical_ac": "P46020-1" }, { "start_pos": 1018, "end_pos": 1018, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46020" }, { "database": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" } ], "site_lbl": "Ser1018", "uniprot_canonical_ac": "P46020-1" }, { "start_pos": 1020, "end_pos": 1020, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46020", "url": "https://www.uniprot.org/uniprotkb/P46020" }, { "database": "iPTMnet", "id": "P46020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46020" }, { "database": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" } ], "site_lbl": "Ser1020", "uniprot_canonical_ac": "P46020-1" }, { "start_pos": 1023, "end_pos": 1023, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46020", "url": "https://www.uniprot.org/uniprotkb/P46020" }, { "database": "iPTMnet", "id": "P46020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46020" }, { "database": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" } ], "site_lbl": "Ser1023", "uniprot_canonical_ac": "P46020-1" }, { "start_pos": 972, "end_pos": 972, "kinase_uniprot_canonical_ac": "P46020-1", "kinase_gene_name": "PHKA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46020" }, { "database": "PubMed", "id": "10487978", "url": "https://pubmed.ncbi.nlm.nih.gov/10487978" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" } ], "site_lbl": "Ser972", "uniprot_canonical_ac": "P46020-1" }, { "start_pos": 985, "end_pos": 985, "kinase_uniprot_canonical_ac": "P46020-1", "kinase_gene_name": "PHKA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46020" }, { "database": "PubMed", "id": "10487978", "url": "https://pubmed.ncbi.nlm.nih.gov/10487978" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "2108025", "url": "https://pubmed.ncbi.nlm.nih.gov/2108025" } ], "site_lbl": "Ser985", "uniprot_canonical_ac": "P46020-1" } ], "record_id": "pubmed.2108025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Muscle phosphorylase kinase deficiency: a neutral metabolic variant or a disease?", "journal": "Neurology", "date": "2012", "authors": "Preisler N, Orngreen MC, Echaniz-Laguna A, Laforet P, Lonsdorfer-Wolf E, Doutreleau S, Geny B, Akman HO, Dimauro S, Vissing J", "reference": { "type": "PubMed", "id": "22238410", "url": "https://pubmed.ncbi.nlm.nih.gov/22238410" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46020-1", "protein_name": "Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform", "gene_name": "PHKA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46020", "url": "https://www.uniprot.org/uniprotkb/P46020" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22238410", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel PHKA1 mutation associating myopathy and cognitive impairment: Expanding the spectrum of phosphorylase kinase b (PhK) deficiency.", "journal": "Journal of the neurological sciences", "date": "2021", "authors": "Bisciglia M, Froissart R, Bedat-Millet AL, Romero NB, Pettazzoni M, Hogrel JY, Petit FM, Stojkovic T", "reference": { "type": "PubMed", "id": "33799212", "url": "https://pubmed.ncbi.nlm.nih.gov/33799212" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46020-1", "protein_name": "Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform", "gene_name": "PHKA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46020", "url": "https://www.uniprot.org/uniprotkb/P46020" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33799212", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The multiphosphorylation domain of the phosphorylase kinase alpha M and alpha L subunits is a hotspot of differential mRNA processing and of molecular evolution.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "W\u00fcllrich A, Hamacher C, Schneider A, Kilimann M W", "reference": { "type": "PubMed", "id": "8226841", "url": "https://pubmed.ncbi.nlm.nih.gov/8226841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46020-1", "protein_name": "Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform", "gene_name": "PHKA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46019-1", "protein_name": "Phosphorylase b kinase regulatory subunit alpha, liver isoform", "gene_name": "PHKA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46020", "url": "https://www.uniprot.org/uniprotkb/P46020" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8226841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kv3.3 potassium channels in lens epithelium and corneal endothelium.", "journal": "Experimental eye research", "date": "2000-03", "authors": "Rae J L, Shepard A R", "reference": { "type": "PubMed", "id": "10712820", "url": "https://pubmed.ncbi.nlm.nih.gov/10712820" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10712820", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in voltage-gated potassium channel KCNC3 cause degenerative and developmental central nervous system phenotypes.", "journal": "Nature genetics", "date": "2006", "authors": "Waters MF, Minassian NA, Stevanin G, Figueroa KP, Bannister JP, Nolte D, Mock AF, Evidente VG, Fee DB, Muller U, Durr A, Brice A, Papazian DM, Pulst SM", "reference": { "type": "PubMed", "id": "16501573", "url": "https://pubmed.ncbi.nlm.nih.gov/16501573" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16501573", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase C modulates inactivation of Kv3.3 channels.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Desai R, Kronengold J, Mei J, Forman SA, Kaczmarek LK", "reference": { "type": "PubMed", "id": "18539595", "url": "https://pubmed.ncbi.nlm.nih.gov/18539595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63959-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "Kcnc3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14003", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14003" }, { "database": "PubMed", "id": "18539595", "url": "https://pubmed.ncbi.nlm.nih.gov/18539595" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14003", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14003" }, { "database": "PubMed", "id": "18539595", "url": "https://pubmed.ncbi.nlm.nih.gov/18539595" } ], "site_lbl": "Ser9", "uniprot_canonical_ac": "Q14003-1" } ], "record_id": "pubmed.18539595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KCNC3: phenotype, mutations, channel biophysics-a study of 260 familial ataxia patients.", "journal": "Human mutation", "date": "2010", "authors": "Figueroa KP, Minassian NA, Stevanin G, Waters M, Garibyan V, Forlani S, Strzelczyk A, Burk K, Brice A, Durr A, Papazian DM, Pulst SM", "reference": { "type": "PubMed", "id": "19953606", "url": "https://pubmed.ncbi.nlm.nih.gov/19953606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19953606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Frequency of KCNC3 DNA variants as causes of spinocerebellar ataxia 13 (SCA13).", "journal": "PloS one", "date": "2011", "authors": "Figueroa KP, Waters MF, Garibyan V, Bird TD, Gomez CM, Ranum LP, Minassian NA, Papazian DM, Pulst SM", "reference": { "type": "PubMed", "id": "21479265", "url": "https://pubmed.ncbi.nlm.nih.gov/21479265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21479265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altered Kv3.3 channel gating in early-onset spinocerebellar ataxia type 13.", "journal": "The Journal of physiology", "date": "2012", "authors": "Minassian NA, Lin MC, Papazian DM", "reference": { "type": "PubMed", "id": "22289912", "url": "https://pubmed.ncbi.nlm.nih.gov/22289912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22289912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spinocerebellar ataxia-13 Kv3.3 potassium channels: arginine-to-histidine mutations affect both functional and protein expression on the cell surface.", "journal": "The Biochemical journal", "date": "2013", "authors": "Zhao J, Zhu J, Thornhill WB", "reference": { "type": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48547-1", "protein_name": "Voltage-gated potassium channel KCNC1", "gene_name": "KCNC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 366, "end_pos": 366, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreases protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 366, "end_pos": 366, "sequence_org": "R", "sequence_mut": "K", "comment": "Decreases protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 420, "end_pos": 420, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreases protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 420, "end_pos": 420, "sequence_org": "R", "sequence_mut": "K", "comment": "Decreases protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 423, "end_pos": 423, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreases protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 423, "end_pos": 423, "sequence_org": "R", "sequence_mut": "K", "comment": "Decreases protein abundance.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "23734863", "url": "https://pubmed.ncbi.nlm.nih.gov/23734863" } ], "uniprot_canonical_ac": "Q14003-1" } ], "record_id": "pubmed.23734863", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KCNC3(R420H), a K(+) channel mutation causative in spinocerebellar ataxia 13 displays aberrant intracellular trafficking.", "journal": "Neurobiology of disease", "date": "2014", "authors": "Gallego-Iradi C, Bickford JS, Khare S, Hall A, Nick JA, Salmasinia D, Wawrowsky K, Bannykh S, Huynh DP, Rincon-Limas DE, Pulst SM, Nick HS, Fernandez-Funez P, Waters MF", "reference": { "type": "PubMed", "id": "25152487", "url": "https://pubmed.ncbi.nlm.nih.gov/25152487" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25152487", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis helps to define KCNC3 mutational spectrum in Dutch ataxia cases.", "journal": "PloS one", "date": "2015", "authors": "Duarri A, Nibbeling EA, Fokkens MR, Meijer M, Boerrigter M, Verschuuren-Bemelmans CC, Kremer BP, van de Warrenburg BP, Dooijes D, Boddeke E, Sinke RJ, Verbeek DS", "reference": { "type": "PubMed", "id": "25756792", "url": "https://pubmed.ncbi.nlm.nih.gov/25756792" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25756792", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kv3.3 potassium channels and spinocerebellar ataxia.", "journal": "The Journal of physiology", "date": "2016", "authors": "Zhang Y, Kaczmarek LK", "reference": { "type": "PubMed", "id": "26442672", "url": "https://pubmed.ncbi.nlm.nih.gov/26442672" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26442672", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Voltage-Gated K+ Channel, Kv3.3 Is Involved in Hemin-Induced K562 Differentiation.", "journal": "PloS one", "date": "2016", "authors": "Song MS, Choi SY, Ryu PD, Lee SY", "reference": { "type": "PubMed", "id": "26849432", "url": "https://pubmed.ncbi.nlm.nih.gov/26849432" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26849432", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kv3.3 Channels Bind Hax-1 and Arp2/3 to Assemble a Stable Local Actin Network that Regulates Channel Gating.", "journal": "Cell", "date": "2016", "authors": "Zhang Y, Zhang XF, Fleming MR, Amiri A, El-Hassar L, Surguchev AA, Hyland C, Jenkins DP, Desai R, Brown MR, Gazula VR, Waters MF, Large CH, Horvath TL, Navaratnam D, Vaccarino FM, Forscher P, Kaczmarek LK", "reference": { "type": "PubMed", "id": "26997484", "url": "https://pubmed.ncbi.nlm.nih.gov/26997484" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63959-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "Kcnc3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35387-1", "protein_name": "HCLS1-associated protein X-1", "gene_name": "Hax1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00165-1", "protein_name": "HCLS1-associated protein X-1", "gene_name": "HAX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 78, "sequence_org": "MLSSVCVSSFRGRQGASKQQPAPPPQPPESPPPPPLPPQQQQPAQPGPAASPAGPPAPRGPGDRRAEPCPGLPAAAMG", "sequence_mut": "", "comment": "Loss of N-type inactivation.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "26997484", "url": "https://pubmed.ncbi.nlm.nih.gov/26997484" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 592, "end_pos": 592, "sequence_org": "G", "sequence_mut": "R", "comment": "Loss of interaction with ACTR3. No effect on voltage-dependent channel opening or current amplitude, but decreased rate of inactivation during prolonged depolarization.", "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" }, { "database": "PubMed", "id": "26997484", "url": "https://pubmed.ncbi.nlm.nih.gov/26997484" } ], "uniprot_canonical_ac": "Q14003-1" }, { "start_pos": 593, "end_pos": 593, "sequence_org": "G", "sequence_mut": "R", "comment": "No effect on voltage-dependent channel opening or current amplitude, but decreased rate of inactivation during prolonged depolarization.", "evidence": [ { "database": "UniProtKB", "id": "Q63959", "url": "https://www.uniprot.org/uniprotkb/Q63959" }, { "database": "PubMed", "id": "26997484", "url": "https://pubmed.ncbi.nlm.nih.gov/26997484" } ], "uniprot_canonical_ac": "Q63959-1" } ], "record_id": "pubmed.26997484", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A KCNC3 mutation causes a neurodevelopmental, non-progressive SCA13 subtype associated with dominant negative effects and aberrant EGFR trafficking.", "journal": "PloS one", "date": "2017", "authors": "Khare S, Nick JA, Zhang Y, Galeano K, Butler B, Khoshbouei H, Rayaprolu S, Hathorn T, Ranum LPW, Smithson L, Golde TE, Paucar M, Morse R, Raff M, Simon J, Nordenskjold M, Wirdefeldt K, Rincon-Limas DE, Lewis J, Kaczmarek LK, Fernandez-Funez P, Nick HS, Waters MF", "reference": { "type": "PubMed", "id": "28467418", "url": "https://pubmed.ncbi.nlm.nih.gov/28467418" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28467418", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C-terminal proline deletions in KCNC3 cause delayed channel inactivation and an adult-onset progressive SCA13 with spasticity.", "journal": "Cerebellum (London, England)", "date": "2018", "authors": "Khare S, Galeano K, Zhang Y, Nick JA, Nick HS, Subramony SH, Sampson J, Kaczmarek LK, Waters MF", "reference": { "type": "PubMed", "id": "29949095", "url": "https://pubmed.ncbi.nlm.nih.gov/29949095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14003-1", "protein_name": "Voltage-gated potassium channel KCNC3", "gene_name": "KCNC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14003", "url": "https://www.uniprot.org/uniprotkb/Q14003" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29949095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of S6K2, a novel kinase homologous to S6K1.", "journal": "Oncogene", "date": "1999", "authors": "Lee-Fruman KK, Kuo CJ, Lippincott J, Terada N, Blenis J", "reference": { "type": "PubMed", "id": "10490847", "url": "https://pubmed.ncbi.nlm.nih.gov/10490847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10490847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct regulatory mechanism for p70 S6 kinase beta from that for p70 S6 kinase alpha.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2001", "authors": "Minami T, Hara K, Oshiro N, Ueoku S, Yoshino K, Tokunaga C, Shirai Y, Saito N, Gout I, Yonezawa K", "reference": { "type": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" }, { "database": "PubMed", "id": "15209375", "url": "https://pubmed.ncbi.nlm.nih.gov/15209375" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "site_lbl": "Thr228", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "P42345-1", "kinase_gene_name": "MTOR", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" } ], "site_lbl": "Thr228", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 370, "end_pos": 370, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" } ], "site_lbl": "Ser370", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 370, "end_pos": 370, "kinase_uniprot_canonical_ac": "P42345-1", "kinase_gene_name": "MTOR", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" } ], "site_lbl": "Ser370", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 388, "end_pos": 388, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" } ], "site_lbl": "Thr388", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 388, "end_pos": 388, "kinase_uniprot_canonical_ac": "P42345-1", "kinase_gene_name": "MTOR", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" } ], "site_lbl": "Thr388", "uniprot_canonical_ac": "Q9UBS0-1" } ], "record_id": "pubmed.11733037", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of ribosomal S6 kinase 2 by mammalian target of rapamycin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Park IH, Bachmann R, Shirazi H, Chen J", "reference": { "type": "PubMed", "id": "12087098", "url": "https://pubmed.ncbi.nlm.nih.gov/12087098" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42345-1", "protein_name": "Serine/threonine-protein kinase mTOR", "gene_name": "MTOR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12087098", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase C phosphorylates ribosomal protein S6 kinase betaII and regulates its subcellular localization.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Valovka T, Verdier F, Cramer R, Zhyvoloup A, Fenton T, Rebholz H, Wang ML, Gzhegotsky M, Lutsyk A, Matsuka G, Filonenko V, Wang L, Proud CG, Parker PJ, Gout IT", "reference": { "type": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "P05129-1", "kinase_gene_name": "PRKCG", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "Q02156-1", "kinase_gene_name": "PRKCE", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "Q05655-1", "kinase_gene_name": "PRKCD", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" }, { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12529391", "url": "https://pubmed.ncbi.nlm.nih.gov/12529391" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "Q9UBS0-1" } ], "record_id": "pubmed.12529391", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutational analysis of ribosomal S6 kinase 2 shows differential regulation of its kinase activity from that of ribosomal S6 kinase 1.", "journal": "The Biochemical journal", "date": "2003", "authors": "Phin S, Kupferwasser D, Lam J, Lee-Fruman KK", "reference": { "type": "PubMed", "id": "12713446", "url": "https://pubmed.ncbi.nlm.nih.gov/12713446" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "12713446", "url": "https://pubmed.ncbi.nlm.nih.gov/12713446" } ], "site_lbl": "Thr228", "uniprot_canonical_ac": "Q9UBS0-1" } ], "record_id": "pubmed.12713446", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor association and tyrosine phosphorylation of S6 kinases.", "journal": "The FEBS journal", "date": "2006", "authors": "Rebholz H, Panasyuk G, Fenton T, Nemazanyy I, Valovka T, Flajolet M, Ronnstrand L, Stephens L, West A, Gout IT", "reference": { "type": "PubMed", "id": "16640565", "url": "https://pubmed.ncbi.nlm.nih.gov/16640565" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "16640565", "url": "https://pubmed.ncbi.nlm.nih.gov/16640565" } ], "site_lbl": "Tyr45", "uniprot_canonical_ac": "Q9UBS0-1" } ], "record_id": "pubmed.16640565", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian EAK-7 activates alternative mTOR signaling to regulate cell proliferation and migration.", "journal": "Science advances", "date": "2018", "authors": "Nguyen JT, Ray C, Fox AL, Mendonca DB, Kim JK, Krebsbach PH", "reference": { "type": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC4-1", "protein_name": "Target of rapamycin complex subunit LST8", "gene_name": "MLST8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13541-1", "protein_name": "Eukaryotic translation initiation factor 4E-binding protein 1", "gene_name": "EIF4EBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42345-1", "protein_name": "Serine/threonine-protein kinase mTOR", "gene_name": "MTOR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9B6-1", "protein_name": "MTOR-associated protein MEAK7", "gene_name": "MEAK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23443-1", "protein_name": "Ribosomal protein S6 kinase beta-1", "gene_name": "RPS6KB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q13541", "url": "https://www.uniprot.org/uniprotkb/Q13541" }, { "database": "iPTMnet", "id": "Q13541", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13541" }, { "database": "PubMed", "id": "19487463", "url": "https://pubmed.ncbi.nlm.nih.gov/19487463" }, { "database": "PubMed", "id": "9465032", "url": "https://pubmed.ncbi.nlm.nih.gov/9465032" }, { "database": "PRO", "id": "Q13541", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13541" }, { "database": "PubMed", "id": "10364159", "url": "https://pubmed.ncbi.nlm.nih.gov/10364159" }, { "database": "PubMed", "id": "11691836", "url": "https://pubmed.ncbi.nlm.nih.gov/11691836" }, { "database": "PubMed", "id": "16825247", "url": "https://pubmed.ncbi.nlm.nih.gov/16825247" }, { "database": "PubMed", "id": "16873412", "url": "https://pubmed.ncbi.nlm.nih.gov/16873412" }, { "database": "PubMed", "id": "18365020", "url": "https://pubmed.ncbi.nlm.nih.gov/18365020" }, { "database": "PubMed", "id": "18577697", "url": "https://pubmed.ncbi.nlm.nih.gov/18577697" }, { "database": "PubMed", "id": "19036825", "url": "https://pubmed.ncbi.nlm.nih.gov/19036825" }, { "database": "PubMed", "id": "19331694", "url": "https://pubmed.ncbi.nlm.nih.gov/19331694" }, { "database": "PubMed", "id": "19367274", "url": "https://pubmed.ncbi.nlm.nih.gov/19367274" }, { "database": "PubMed", "id": "20616057", "url": "https://pubmed.ncbi.nlm.nih.gov/20616057" }, { "database": "PubMed", "id": "20711498", "url": "https://pubmed.ncbi.nlm.nih.gov/20711498" }, { "database": "PubMed", "id": "21132000", "url": "https://pubmed.ncbi.nlm.nih.gov/21132000" }, { "database": "PubMed", "id": "21320304", "url": "https://pubmed.ncbi.nlm.nih.gov/21320304" }, { "database": "PubMed", "id": "21837706", "url": "https://pubmed.ncbi.nlm.nih.gov/21837706" }, { "database": "PubMed", "id": "22039466", "url": "https://pubmed.ncbi.nlm.nih.gov/22039466" }, { "database": "PubMed", "id": "22253983", "url": "https://pubmed.ncbi.nlm.nih.gov/22253983" }, { "database": "PubMed", "id": "22421144", "url": "https://pubmed.ncbi.nlm.nih.gov/22421144" }, { "database": "PubMed", "id": "23814053", "url": "https://pubmed.ncbi.nlm.nih.gov/23814053" }, { "database": "PubMed", "id": "24159375", "url": "https://pubmed.ncbi.nlm.nih.gov/24159375" }, { "database": "PubMed", "id": "24358826", "url": "https://pubmed.ncbi.nlm.nih.gov/24358826" }, { "database": "PubMed", "id": "24384983", "url": "https://pubmed.ncbi.nlm.nih.gov/24384983" }, { "database": "PubMed", "id": "24586775", "url": "https://pubmed.ncbi.nlm.nih.gov/24586775" }, { "database": "PubMed", "id": "24923301", "url": "https://pubmed.ncbi.nlm.nih.gov/24923301" }, { "database": "PubMed", "id": "24970798", "url": "https://pubmed.ncbi.nlm.nih.gov/24970798" }, { "database": "PubMed", "id": "25486193", "url": "https://pubmed.ncbi.nlm.nih.gov/25486193" }, { "database": "PubMed", "id": "25673820", "url": "https://pubmed.ncbi.nlm.nih.gov/25673820" }, { "database": "PubMed", "id": "25961827", "url": "https://pubmed.ncbi.nlm.nih.gov/25961827" }, { "database": "PubMed", "id": "26472029", "url": "https://pubmed.ncbi.nlm.nih.gov/26472029" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "27048233", "url": "https://pubmed.ncbi.nlm.nih.gov/27048233" }, { "database": "PubMed", "id": "27387559", "url": "https://pubmed.ncbi.nlm.nih.gov/27387559" }, { "database": "PubMed", "id": "28252104", "url": "https://pubmed.ncbi.nlm.nih.gov/28252104" }, { "database": "PubMed", "id": "28272965", "url": "https://pubmed.ncbi.nlm.nih.gov/28272965" }, { "database": "PubMed", "id": "28539821", "url": "https://pubmed.ncbi.nlm.nih.gov/28539821" }, { "database": "PubMed", "id": "28915586", "url": "https://pubmed.ncbi.nlm.nih.gov/28915586" }, { "database": "PubMed", "id": "29233971", "url": "https://pubmed.ncbi.nlm.nih.gov/29233971" }, { "database": "PubMed", "id": "29357370", "url": "https://pubmed.ncbi.nlm.nih.gov/29357370" }, { "database": "PubMed", "id": "29423932", "url": "https://pubmed.ncbi.nlm.nih.gov/29423932" }, { "database": "PubMed", "id": "29472733", "url": "https://pubmed.ncbi.nlm.nih.gov/29472733" }, { "database": "PubMed", "id": "29795412", "url": "https://pubmed.ncbi.nlm.nih.gov/29795412" }, { "database": "PubMed", "id": "30397197", "url": "https://pubmed.ncbi.nlm.nih.gov/30397197" }, { "database": "PubMed", "id": "30602778", "url": "https://pubmed.ncbi.nlm.nih.gov/30602778" }, { "database": "PubMed", "id": "30698812", "url": "https://pubmed.ncbi.nlm.nih.gov/30698812" }, { "database": "PubMed", "id": "30931929", "url": "https://pubmed.ncbi.nlm.nih.gov/30931929" }, { "database": "PubMed", "id": "31046771", "url": "https://pubmed.ncbi.nlm.nih.gov/31046771" }, { "database": "PubMed", "id": "31073371", "url": "https://pubmed.ncbi.nlm.nih.gov/31073371" }, { "database": "PubMed", "id": "31122207", "url": "https://pubmed.ncbi.nlm.nih.gov/31122207" }, { "database": "PubMed", "id": "31138781", "url": "https://pubmed.ncbi.nlm.nih.gov/31138781" }, { "database": "PubMed", "id": "31201269", "url": "https://pubmed.ncbi.nlm.nih.gov/31201269" }, { "database": "PubMed", "id": "31641103", "url": "https://pubmed.ncbi.nlm.nih.gov/31641103" }, { "database": "PubMed", "id": "31717924", "url": "https://pubmed.ncbi.nlm.nih.gov/31717924" }, { "database": "PubMed", "id": "32075852", "url": "https://pubmed.ncbi.nlm.nih.gov/32075852" }, { "database": "PubMed", "id": "33038921", "url": "https://pubmed.ncbi.nlm.nih.gov/33038921" }, { "database": "PubMed", "id": "33191406", "url": "https://pubmed.ncbi.nlm.nih.gov/33191406" }, { "database": "PubMed", "id": "33742064", "url": "https://pubmed.ncbi.nlm.nih.gov/33742064" }, { "database": "PubMed", "id": "35697076", "url": "https://pubmed.ncbi.nlm.nih.gov/35697076" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "22578813", "url": "https://pubmed.ncbi.nlm.nih.gov/22578813" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "29236692", "url": "https://pubmed.ncbi.nlm.nih.gov/29236692" }, { "database": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" }, { "database": "PubMed", "id": "12747827", "url": "https://pubmed.ncbi.nlm.nih.gov/12747827" } ], "site_lbl": "Thr37", "uniprot_canonical_ac": "Q13541-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q13541", "url": "https://www.uniprot.org/uniprotkb/Q13541" }, { "database": "iPTMnet", "id": "Q13541", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13541" }, { "database": "PubMed", "id": "19487463", "url": "https://pubmed.ncbi.nlm.nih.gov/19487463" }, { "database": "PubMed", "id": "9465032", "url": "https://pubmed.ncbi.nlm.nih.gov/9465032" }, { "database": "PRO", "id": "Q13541", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13541" }, { "database": "PubMed", "id": "10364159", "url": "https://pubmed.ncbi.nlm.nih.gov/10364159" }, { "database": "PubMed", "id": "11691836", "url": "https://pubmed.ncbi.nlm.nih.gov/11691836" }, { "database": "PubMed", "id": "16249273", "url": "https://pubmed.ncbi.nlm.nih.gov/16249273" }, { "database": "PubMed", "id": "16873412", "url": "https://pubmed.ncbi.nlm.nih.gov/16873412" }, { "database": "PubMed", "id": "18365020", "url": "https://pubmed.ncbi.nlm.nih.gov/18365020" }, { "database": "PubMed", "id": "18577697", "url": "https://pubmed.ncbi.nlm.nih.gov/18577697" }, { "database": "PubMed", "id": "19036825", "url": "https://pubmed.ncbi.nlm.nih.gov/19036825" }, { "database": "PubMed", "id": "19331694", "url": "https://pubmed.ncbi.nlm.nih.gov/19331694" }, { "database": "PubMed", "id": "19367274", "url": "https://pubmed.ncbi.nlm.nih.gov/19367274" }, { "database": "PubMed", "id": "20616057", "url": "https://pubmed.ncbi.nlm.nih.gov/20616057" }, { "database": "PubMed", "id": "20711498", "url": "https://pubmed.ncbi.nlm.nih.gov/20711498" }, { "database": "PubMed", "id": "21132000", "url": "https://pubmed.ncbi.nlm.nih.gov/21132000" }, { "database": "PubMed", "id": "21320304", "url": "https://pubmed.ncbi.nlm.nih.gov/21320304" }, { "database": "PubMed", "id": "21837706", "url": "https://pubmed.ncbi.nlm.nih.gov/21837706" }, { "database": "PubMed", "id": "22039466", "url": "https://pubmed.ncbi.nlm.nih.gov/22039466" }, { "database": "PubMed", "id": "22253983", "url": "https://pubmed.ncbi.nlm.nih.gov/22253983" }, { "database": "PubMed", "id": "22421144", "url": "https://pubmed.ncbi.nlm.nih.gov/22421144" }, { "database": "PubMed", "id": "23814053", "url": "https://pubmed.ncbi.nlm.nih.gov/23814053" }, { "database": "PubMed", "id": "24159375", "url": "https://pubmed.ncbi.nlm.nih.gov/24159375" }, { "database": "PubMed", "id": "24358826", "url": "https://pubmed.ncbi.nlm.nih.gov/24358826" }, { "database": "PubMed", "id": "24384983", "url": "https://pubmed.ncbi.nlm.nih.gov/24384983" }, { "database": "PubMed", "id": "24586775", "url": "https://pubmed.ncbi.nlm.nih.gov/24586775" }, { "database": "PubMed", "id": "24923301", "url": "https://pubmed.ncbi.nlm.nih.gov/24923301" }, { "database": "PubMed", "id": "24970798", "url": "https://pubmed.ncbi.nlm.nih.gov/24970798" }, { "database": "PubMed", "id": "25020061", "url": "https://pubmed.ncbi.nlm.nih.gov/25020061" }, { "database": "PubMed", "id": "25486193", "url": "https://pubmed.ncbi.nlm.nih.gov/25486193" }, { "database": "PubMed", "id": "25673820", "url": "https://pubmed.ncbi.nlm.nih.gov/25673820" }, { "database": "PubMed", "id": "25961827", "url": "https://pubmed.ncbi.nlm.nih.gov/25961827" }, { "database": "PubMed", "id": "26472029", "url": "https://pubmed.ncbi.nlm.nih.gov/26472029" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "27048233", "url": "https://pubmed.ncbi.nlm.nih.gov/27048233" }, { "database": "PubMed", "id": "27387559", "url": "https://pubmed.ncbi.nlm.nih.gov/27387559" }, { "database": "PubMed", "id": "28252104", "url": "https://pubmed.ncbi.nlm.nih.gov/28252104" }, { "database": "PubMed", "id": "28272965", "url": "https://pubmed.ncbi.nlm.nih.gov/28272965" }, { "database": "PubMed", "id": "28539821", "url": "https://pubmed.ncbi.nlm.nih.gov/28539821" }, { "database": "PubMed", "id": "28915586", "url": "https://pubmed.ncbi.nlm.nih.gov/28915586" }, { "database": "PubMed", "id": "29233971", "url": "https://pubmed.ncbi.nlm.nih.gov/29233971" }, { "database": "PubMed", "id": "29357370", "url": "https://pubmed.ncbi.nlm.nih.gov/29357370" }, { "database": "PubMed", "id": "29423932", "url": "https://pubmed.ncbi.nlm.nih.gov/29423932" }, { "database": "PubMed", "id": "29472733", "url": "https://pubmed.ncbi.nlm.nih.gov/29472733" }, { "database": "PubMed", "id": "29795412", "url": "https://pubmed.ncbi.nlm.nih.gov/29795412" }, { "database": "PubMed", "id": "30397197", "url": "https://pubmed.ncbi.nlm.nih.gov/30397197" }, { "database": "PubMed", "id": "30602778", "url": "https://pubmed.ncbi.nlm.nih.gov/30602778" }, { "database": "PubMed", "id": "30698812", "url": "https://pubmed.ncbi.nlm.nih.gov/30698812" }, { "database": "PubMed", "id": "30931929", "url": "https://pubmed.ncbi.nlm.nih.gov/30931929" }, { "database": "PubMed", "id": "31046771", "url": "https://pubmed.ncbi.nlm.nih.gov/31046771" }, { "database": "PubMed", "id": "31073371", "url": "https://pubmed.ncbi.nlm.nih.gov/31073371" }, { "database": "PubMed", "id": "31138781", "url": "https://pubmed.ncbi.nlm.nih.gov/31138781" }, { "database": "PubMed", "id": "31201269", "url": "https://pubmed.ncbi.nlm.nih.gov/31201269" }, { "database": "PubMed", "id": "31641103", "url": "https://pubmed.ncbi.nlm.nih.gov/31641103" }, { "database": "PubMed", "id": "31717924", "url": "https://pubmed.ncbi.nlm.nih.gov/31717924" }, { "database": "PubMed", "id": "32021427", "url": "https://pubmed.ncbi.nlm.nih.gov/32021427" }, { "database": "PubMed", "id": "32075852", "url": "https://pubmed.ncbi.nlm.nih.gov/32075852" }, { "database": "PubMed", "id": "33038921", "url": "https://pubmed.ncbi.nlm.nih.gov/33038921" }, { "database": "PubMed", "id": "33191406", "url": "https://pubmed.ncbi.nlm.nih.gov/33191406" }, { "database": "PubMed", "id": "33742064", "url": "https://pubmed.ncbi.nlm.nih.gov/33742064" }, { "database": "PubMed", "id": "35697076", "url": "https://pubmed.ncbi.nlm.nih.gov/35697076" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "22578813", "url": "https://pubmed.ncbi.nlm.nih.gov/22578813" }, { "database": "PubMed", "id": "29236692", "url": "https://pubmed.ncbi.nlm.nih.gov/29236692" }, { "database": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" }, { "database": "PubMed", "id": "12747827", "url": "https://pubmed.ncbi.nlm.nih.gov/12747827" } ], "site_lbl": "Thr46", "uniprot_canonical_ac": "Q13541-1" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by DYRK2, MAPK1, MAPK3 and MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q13541", "url": "https://www.uniprot.org/uniprotkb/Q13541" }, { "database": "iPTMnet", "id": "Q13541", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13541" }, { "database": "PubMed", "id": "11777913", "url": "https://pubmed.ncbi.nlm.nih.gov/11777913" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "19487463", "url": "https://pubmed.ncbi.nlm.nih.gov/19487463" }, { "database": "PubMed", "id": "11278829", "url": "https://pubmed.ncbi.nlm.nih.gov/11278829" }, { "database": "PubMed", "id": "11553333", "url": "https://pubmed.ncbi.nlm.nih.gov/11553333" }, { "database": "PubMed", "id": "12054859", "url": "https://pubmed.ncbi.nlm.nih.gov/12054859" }, { "database": "PubMed", "id": "12105188", "url": "https://pubmed.ncbi.nlm.nih.gov/12105188" }, { "database": "PubMed", "id": "12588975", "url": "https://pubmed.ncbi.nlm.nih.gov/12588975" }, { "database": "PubMed", "id": "12860993", "url": "https://pubmed.ncbi.nlm.nih.gov/12860993" }, { "database": "PubMed", "id": "16825247", "url": "https://pubmed.ncbi.nlm.nih.gov/16825247" }, { "database": "PubMed", "id": "19331694", "url": "https://pubmed.ncbi.nlm.nih.gov/19331694" }, { "database": "PubMed", "id": "20170512", "url": "https://pubmed.ncbi.nlm.nih.gov/20170512" }, { "database": "PubMed", "id": "20616057", "url": "https://pubmed.ncbi.nlm.nih.gov/20616057" }, { "database": "PubMed", "id": "20880835", "url": "https://pubmed.ncbi.nlm.nih.gov/20880835" }, { "database": "PubMed", "id": "22267338", "url": "https://pubmed.ncbi.nlm.nih.gov/22267338" }, { "database": "PubMed", "id": "22421144", "url": "https://pubmed.ncbi.nlm.nih.gov/22421144" }, { "database": "PubMed", "id": "22657251", "url": "https://pubmed.ncbi.nlm.nih.gov/22657251" }, { "database": "PubMed", "id": "22808163", "url": "https://pubmed.ncbi.nlm.nih.gov/22808163" }, { "database": "PubMed", "id": "23814053", "url": "https://pubmed.ncbi.nlm.nih.gov/23814053" }, { "database": "PubMed", "id": "24205284", "url": "https://pubmed.ncbi.nlm.nih.gov/24205284" }, { "database": "PubMed", "id": "24316235", "url": "https://pubmed.ncbi.nlm.nih.gov/24316235" }, { "database": "PubMed", "id": "24466059", "url": "https://pubmed.ncbi.nlm.nih.gov/24466059" }, { "database": "PubMed", "id": "24562770", "url": "https://pubmed.ncbi.nlm.nih.gov/24562770" }, { "database": "PubMed", "id": "24923301", "url": "https://pubmed.ncbi.nlm.nih.gov/24923301" }, { "database": "PubMed", "id": "24931163", "url": "https://pubmed.ncbi.nlm.nih.gov/24931163" }, { "database": "PubMed", "id": "24970798", "url": "https://pubmed.ncbi.nlm.nih.gov/24970798" }, { "database": "PubMed", "id": "25486193", "url": "https://pubmed.ncbi.nlm.nih.gov/25486193" }, { "database": "PubMed", "id": "25880415", "url": "https://pubmed.ncbi.nlm.nih.gov/25880415" }, { "database": "PubMed", "id": "25961827", "url": "https://pubmed.ncbi.nlm.nih.gov/25961827" }, { "database": "PubMed", "id": "25999352", "url": "https://pubmed.ncbi.nlm.nih.gov/25999352" }, { "database": "PubMed", "id": "26434594", "url": "https://pubmed.ncbi.nlm.nih.gov/26434594" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "27055259", "url": "https://pubmed.ncbi.nlm.nih.gov/27055259" }, { "database": "PubMed", "id": "27056897", "url": "https://pubmed.ncbi.nlm.nih.gov/27056897" }, { "database": "PubMed", "id": "27065332", "url": "https://pubmed.ncbi.nlm.nih.gov/27065332" }, { "database": "PubMed", "id": "27387559", "url": "https://pubmed.ncbi.nlm.nih.gov/27387559" }, { "database": "PubMed", "id": "28272965", "url": "https://pubmed.ncbi.nlm.nih.gov/28272965" }, { "database": "PubMed", "id": "28903425", "url": "https://pubmed.ncbi.nlm.nih.gov/28903425" }, { "database": "PubMed", "id": "28915586", "url": "https://pubmed.ncbi.nlm.nih.gov/28915586" }, { "database": "PubMed", "id": "29233971", "url": "https://pubmed.ncbi.nlm.nih.gov/29233971" }, { "database": "PubMed", "id": "29357370", "url": "https://pubmed.ncbi.nlm.nih.gov/29357370" }, { "database": "PubMed", "id": "29507660", "url": "https://pubmed.ncbi.nlm.nih.gov/29507660" }, { "database": "PubMed", "id": "29795412", "url": "https://pubmed.ncbi.nlm.nih.gov/29795412" }, { "database": "PubMed", "id": "30602778", "url": "https://pubmed.ncbi.nlm.nih.gov/30602778" }, { "database": "PubMed", "id": "30931929", "url": "https://pubmed.ncbi.nlm.nih.gov/30931929" }, { "database": "PubMed", "id": "31073371", "url": "https://pubmed.ncbi.nlm.nih.gov/31073371" }, { "database": "PubMed", "id": "31122207", "url": "https://pubmed.ncbi.nlm.nih.gov/31122207" }, { "database": "PubMed", "id": "31138781", "url": "https://pubmed.ncbi.nlm.nih.gov/31138781" }, { "database": "PubMed", "id": "31201269", "url": "https://pubmed.ncbi.nlm.nih.gov/31201269" }, { "database": "PubMed", "id": "31284427", "url": "https://pubmed.ncbi.nlm.nih.gov/31284427" }, { "database": "PubMed", "id": "32075852", "url": "https://pubmed.ncbi.nlm.nih.gov/32075852" }, { "database": "PubMed", "id": "33038921", "url": "https://pubmed.ncbi.nlm.nih.gov/33038921" }, { "database": "PubMed", "id": "33130472", "url": "https://pubmed.ncbi.nlm.nih.gov/33130472" }, { "database": "PubMed", "id": "33191406", "url": "https://pubmed.ncbi.nlm.nih.gov/33191406" }, { "database": "PubMed", "id": "33658483", "url": "https://pubmed.ncbi.nlm.nih.gov/33658483" }, { "database": "PubMed", "id": "35697076", "url": "https://pubmed.ncbi.nlm.nih.gov/35697076" }, { "database": "PubMed", "id": "12747827", "url": "https://pubmed.ncbi.nlm.nih.gov/12747827" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "22578813", "url": "https://pubmed.ncbi.nlm.nih.gov/22578813" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25702871", "url": "https://pubmed.ncbi.nlm.nih.gov/25702871" }, { "database": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" } ], "site_lbl": "Ser65", "uniprot_canonical_ac": "Q13541-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "Q13541", "url": "https://www.uniprot.org/uniprotkb/Q13541" }, { "database": "iPTMnet", "id": "Q13541", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13541" }, { "database": "PubMed", "id": "12747827", "url": "https://pubmed.ncbi.nlm.nih.gov/12747827" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "19487463", "url": "https://pubmed.ncbi.nlm.nih.gov/19487463" }, { "database": "PubMed", "id": "11410517", "url": "https://pubmed.ncbi.nlm.nih.gov/11410517" }, { "database": "PubMed", "id": "11553333", "url": "https://pubmed.ncbi.nlm.nih.gov/11553333" }, { "database": "PubMed", "id": "12054859", "url": "https://pubmed.ncbi.nlm.nih.gov/12054859" }, { "database": "PubMed", "id": "12860993", "url": "https://pubmed.ncbi.nlm.nih.gov/12860993" }, { "database": "PubMed", "id": "16825247", "url": "https://pubmed.ncbi.nlm.nih.gov/16825247" }, { "database": "PubMed", "id": "19331694", "url": "https://pubmed.ncbi.nlm.nih.gov/19331694" }, { "database": "PubMed", "id": "20142804", "url": "https://pubmed.ncbi.nlm.nih.gov/20142804" }, { "database": "PubMed", "id": "21132000", "url": "https://pubmed.ncbi.nlm.nih.gov/21132000" }, { "database": "PubMed", "id": "22421144", "url": "https://pubmed.ncbi.nlm.nih.gov/22421144" }, { "database": "PubMed", "id": "22808163", "url": "https://pubmed.ncbi.nlm.nih.gov/22808163" }, { "database": "PubMed", "id": "23340172", "url": "https://pubmed.ncbi.nlm.nih.gov/23340172" }, { "database": "PubMed", "id": "24358826", "url": "https://pubmed.ncbi.nlm.nih.gov/24358826" }, { "database": "PubMed", "id": "24605337", "url": "https://pubmed.ncbi.nlm.nih.gov/24605337" }, { "database": "PubMed", "id": "24970798", "url": "https://pubmed.ncbi.nlm.nih.gov/24970798" }, { "database": "PubMed", "id": "25486193", "url": "https://pubmed.ncbi.nlm.nih.gov/25486193" }, { "database": "PubMed", "id": "25527453", "url": "https://pubmed.ncbi.nlm.nih.gov/25527453" }, { "database": "PubMed", "id": "25762619", "url": "https://pubmed.ncbi.nlm.nih.gov/25762619" }, { "database": "PubMed", "id": "25961827", "url": "https://pubmed.ncbi.nlm.nih.gov/25961827" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "27065332", "url": "https://pubmed.ncbi.nlm.nih.gov/27065332" }, { "database": "PubMed", "id": "27387559", "url": "https://pubmed.ncbi.nlm.nih.gov/27387559" }, { "database": "PubMed", "id": "28213783", "url": "https://pubmed.ncbi.nlm.nih.gov/28213783" }, { "database": "PubMed", "id": "28272965", "url": "https://pubmed.ncbi.nlm.nih.gov/28272965" }, { "database": "PubMed", "id": "28475412", "url": "https://pubmed.ncbi.nlm.nih.gov/28475412" }, { "database": "PubMed", "id": "28915586", "url": "https://pubmed.ncbi.nlm.nih.gov/28915586" }, { "database": "PubMed", "id": "29233971", "url": "https://pubmed.ncbi.nlm.nih.gov/29233971" }, { "database": "PubMed", "id": "29795412", "url": "https://pubmed.ncbi.nlm.nih.gov/29795412" }, { "database": "PubMed", "id": "29845289", "url": "https://pubmed.ncbi.nlm.nih.gov/29845289" }, { "database": "PubMed", "id": "30397197", "url": "https://pubmed.ncbi.nlm.nih.gov/30397197" }, { "database": "PubMed", "id": "30602778", "url": "https://pubmed.ncbi.nlm.nih.gov/30602778" }, { "database": "PubMed", "id": "30931929", "url": "https://pubmed.ncbi.nlm.nih.gov/30931929" }, { "database": "PubMed", "id": "31122207", "url": "https://pubmed.ncbi.nlm.nih.gov/31122207" }, { "database": "PubMed", "id": "31201269", "url": "https://pubmed.ncbi.nlm.nih.gov/31201269" }, { "database": "PubMed", "id": "31867267", "url": "https://pubmed.ncbi.nlm.nih.gov/31867267" }, { "database": "PubMed", "id": "32075852", "url": "https://pubmed.ncbi.nlm.nih.gov/32075852" }, { "database": "PubMed", "id": "33038921", "url": "https://pubmed.ncbi.nlm.nih.gov/33038921" }, { "database": "PubMed", "id": "33191406", "url": "https://pubmed.ncbi.nlm.nih.gov/33191406" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "22578813", "url": "https://pubmed.ncbi.nlm.nih.gov/22578813" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "25702871", "url": "https://pubmed.ncbi.nlm.nih.gov/25702871" }, { "database": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" } ], "site_lbl": "Thr70", "uniprot_canonical_ac": "Q13541-1" }, { "start_pos": 412, "end_pos": 412, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MTOR, NEK6 and NEK7", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "iPTMnet", "id": "P23443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23443" }, { "database": "PubMed", "id": "16899564", "url": "https://pubmed.ncbi.nlm.nih.gov/16899564" }, { "database": "PubMed", "id": "19487463", "url": "https://pubmed.ncbi.nlm.nih.gov/19487463" }, { "database": "PubMed", "id": "9465032", "url": "https://pubmed.ncbi.nlm.nih.gov/9465032" }, { "database": "PRO", "id": "P23443", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P23443" }, { "database": "PubMed", "id": "10567431", "url": "https://pubmed.ncbi.nlm.nih.gov/10567431" }, { "database": "PubMed", "id": "10601311", "url": "https://pubmed.ncbi.nlm.nih.gov/10601311" }, { "database": "PubMed", "id": "12558800", "url": "https://pubmed.ncbi.nlm.nih.gov/12558800" }, { "database": "PubMed", "id": "23830390", "url": "https://pubmed.ncbi.nlm.nih.gov/23830390" }, { "database": "PubMed", "id": "24605337", "url": "https://pubmed.ncbi.nlm.nih.gov/24605337" }, { "database": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" }, { "database": "PubMed", "id": "29236692", "url": "https://pubmed.ncbi.nlm.nih.gov/29236692" } ], "site_lbl": "Thr412", "uniprot_canonical_ac": "P23443-1" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 2, "sequence_org": "G", "sequence_mut": "A", "comment": "Abolishes lysosomal location.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9B6", "url": "https://www.uniprot.org/uniprotkb/Q6P9B6" }, { "database": "PubMed", "id": "29750193", "url": "https://pubmed.ncbi.nlm.nih.gov/29750193" } ], "uniprot_canonical_ac": "Q6P9B6-1" } ], "record_id": "pubmed.29750193", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Circ-GLI1 promotes metastasis in melanoma through interacting with p70S6K2 to activate Hedgehog/GLI1 and Wnt/beta-catenin pathways and upregulate Cyr61.", "journal": "Cell death & disease", "date": "2020", "authors": "Chen J, Zhou X, Yang J, Sun Q, Liu Y, Li N, Zhang Z, Xu H", "reference": { "type": "PubMed", "id": "32732916", "url": "https://pubmed.ncbi.nlm.nih.gov/32732916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32732916", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of Mechanistic Target of Rapamycin (mTOR) in Human Endothelial Cells Infected with Pathogenic Spotted Fever Group Rickettsiae.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "Sahni A, Narra HP, Sahni SK", "reference": { "type": "PubMed", "id": "33003310", "url": "https://pubmed.ncbi.nlm.nih.gov/33003310" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42345-1", "protein_name": "Serine/threonine-protein kinase mTOR", "gene_name": "MTOR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 2448, "end_pos": 2448, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KB1", "evidence": [ { "database": "UniProtKB", "id": "P42345", "url": "https://www.uniprot.org/uniprotkb/P42345" }, { "database": "iPTMnet", "id": "P42345", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42345" }, { "database": "PubMed", "id": "10910062", "url": "https://pubmed.ncbi.nlm.nih.gov/10910062" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "10567225", "url": "https://pubmed.ncbi.nlm.nih.gov/10567225" }, { "database": "PubMed", "id": "11884412", "url": "https://pubmed.ncbi.nlm.nih.gov/11884412" }, { "database": "PubMed", "id": "12937293", "url": "https://pubmed.ncbi.nlm.nih.gov/12937293" }, { "database": "PubMed", "id": "14560963", "url": "https://pubmed.ncbi.nlm.nih.gov/14560963" }, { "database": "PubMed", "id": "14970221", "url": "https://pubmed.ncbi.nlm.nih.gov/14970221" }, { "database": "PubMed", "id": "15208671", "url": "https://pubmed.ncbi.nlm.nih.gov/15208671" }, { "database": "PubMed", "id": "15292249", "url": "https://pubmed.ncbi.nlm.nih.gov/15292249" }, { "database": "PubMed", "id": "15388509", "url": "https://pubmed.ncbi.nlm.nih.gov/15388509" }, { "database": "PubMed", "id": "15388791", "url": "https://pubmed.ncbi.nlm.nih.gov/15388791" }, { "database": "PubMed", "id": "15625077", "url": "https://pubmed.ncbi.nlm.nih.gov/15625077" }, { "database": "PubMed", "id": "15899889", "url": "https://pubmed.ncbi.nlm.nih.gov/15899889" }, { "database": "PubMed", "id": "15905173", "url": "https://pubmed.ncbi.nlm.nih.gov/15905173" }, { "database": "PubMed", "id": "15963500", "url": "https://pubmed.ncbi.nlm.nih.gov/15963500" }, { "database": "PubMed", "id": "16263769", "url": "https://pubmed.ncbi.nlm.nih.gov/16263769" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16584539", "url": "https://pubmed.ncbi.nlm.nih.gov/16584539" }, { "database": "PubMed", "id": "16886599", "url": "https://pubmed.ncbi.nlm.nih.gov/16886599" }, { "database": "PubMed", "id": "16920842", "url": "https://pubmed.ncbi.nlm.nih.gov/16920842" }, { "database": "PubMed", "id": "16934436", "url": "https://pubmed.ncbi.nlm.nih.gov/16934436" }, { "database": "PubMed", "id": "16952420", "url": "https://pubmed.ncbi.nlm.nih.gov/16952420" }, { "database": "PubMed", "id": "17110594", "url": "https://pubmed.ncbi.nlm.nih.gov/17110594" }, { "database": "PubMed", "id": "17142137", "url": "https://pubmed.ncbi.nlm.nih.gov/17142137" }, { "database": "PubMed", "id": "17162089", "url": "https://pubmed.ncbi.nlm.nih.gov/17162089" }, { "database": "PubMed", "id": "17178807", "url": "https://pubmed.ncbi.nlm.nih.gov/17178807" }, { "database": "PubMed", "id": "17646396", "url": "https://pubmed.ncbi.nlm.nih.gov/17646396" }, { "database": "PubMed", "id": "17721885", "url": "https://pubmed.ncbi.nlm.nih.gov/17721885" }, { "database": "PubMed", "id": "17971512", "url": "https://pubmed.ncbi.nlm.nih.gov/17971512" }, { "database": "PubMed", "id": "17976640", "url": "https://pubmed.ncbi.nlm.nih.gov/17976640" }, { "database": "PubMed", "id": "18033679", "url": "https://pubmed.ncbi.nlm.nih.gov/18033679" }, { "database": "PubMed", "id": "18276949", "url": "https://pubmed.ncbi.nlm.nih.gov/18276949" }, { "database": "PubMed", "id": "18466352", "url": "https://pubmed.ncbi.nlm.nih.gov/18466352" }, { "database": "PubMed", "id": "18577697", "url": "https://pubmed.ncbi.nlm.nih.gov/18577697" }, { "database": "PubMed", "id": "18668345", "url": "https://pubmed.ncbi.nlm.nih.gov/18668345" }, { "database": "PubMed", "id": "19019920", "url": "https://pubmed.ncbi.nlm.nih.gov/19019920" }, { "database": "PubMed", "id": "19055754", "url": "https://pubmed.ncbi.nlm.nih.gov/19055754" }, { "database": "PubMed", "id": "19079619", "url": "https://pubmed.ncbi.nlm.nih.gov/19079619" }, { "database": "PubMed", "id": "19125612", "url": "https://pubmed.ncbi.nlm.nih.gov/19125612" }, { "database": "PubMed", "id": "19145465", "url": "https://pubmed.ncbi.nlm.nih.gov/19145465" }, { "database": "PubMed", "id": "19153210", "url": "https://pubmed.ncbi.nlm.nih.gov/19153210" }, { "database": "PubMed", "id": "19244117", "url": "https://pubmed.ncbi.nlm.nih.gov/19244117" }, { "database": "PubMed", "id": "19293927", "url": "https://pubmed.ncbi.nlm.nih.gov/19293927" }, { "database": "PubMed", "id": "19439614", "url": "https://pubmed.ncbi.nlm.nih.gov/19439614" }, { "database": "PubMed", "id": "19540199", "url": "https://pubmed.ncbi.nlm.nih.gov/19540199" }, { "database": "PubMed", "id": "19549760", "url": "https://pubmed.ncbi.nlm.nih.gov/19549760" }, { "database": "PubMed", "id": "19576515", "url": "https://pubmed.ncbi.nlm.nih.gov/19576515" }, { "database": "PubMed", "id": "19587783", "url": "https://pubmed.ncbi.nlm.nih.gov/19587783" }, { "database": "PubMed", "id": "19641606", "url": "https://pubmed.ncbi.nlm.nih.gov/19641606" }, { "database": "PubMed", "id": "19644030", "url": "https://pubmed.ncbi.nlm.nih.gov/19644030" }, { "database": "PubMed", "id": "19834494", "url": "https://pubmed.ncbi.nlm.nih.gov/19834494" }, { "database": "PubMed", "id": "19943972", "url": "https://pubmed.ncbi.nlm.nih.gov/19943972" }, { "database": "PubMed", "id": "19956876", "url": "https://pubmed.ncbi.nlm.nih.gov/19956876" }, { "database": "PubMed", "id": "19959541", "url": "https://pubmed.ncbi.nlm.nih.gov/19959541" }, { "database": "PubMed", "id": "20144629", "url": "https://pubmed.ncbi.nlm.nih.gov/20144629" }, { "database": "PubMed", "id": "20152809", "url": "https://pubmed.ncbi.nlm.nih.gov/20152809" }, { "database": "PubMed", "id": "20216949", "url": "https://pubmed.ncbi.nlm.nih.gov/20216949" }, { "database": "PubMed", "id": "20459645", "url": "https://pubmed.ncbi.nlm.nih.gov/20459645" }, { "database": "PubMed", "id": "20484036", "url": "https://pubmed.ncbi.nlm.nih.gov/20484036" }, { "database": "PubMed", "id": "20736160", "url": "https://pubmed.ncbi.nlm.nih.gov/20736160" }, { "database": "PubMed", "id": "21132000", "url": "https://pubmed.ncbi.nlm.nih.gov/21132000" }, { "database": "PubMed", "id": "21208419", "url": "https://pubmed.ncbi.nlm.nih.gov/21208419" }, { "database": "PubMed", "id": "21289204", "url": "https://pubmed.ncbi.nlm.nih.gov/21289204" }, { "database": "PubMed", "id": "21430254", "url": "https://pubmed.ncbi.nlm.nih.gov/21430254" }, { "database": "PubMed", "id": "21501117", "url": "https://pubmed.ncbi.nlm.nih.gov/21501117" }, { "database": "PubMed", "id": "21702994", "url": "https://pubmed.ncbi.nlm.nih.gov/21702994" }, { "database": "PubMed", "id": "21763421", "url": "https://pubmed.ncbi.nlm.nih.gov/21763421" }, { "database": "PubMed", "id": "21798089", "url": "https://pubmed.ncbi.nlm.nih.gov/21798089" }, { "database": "PubMed", "id": "21840189", "url": "https://pubmed.ncbi.nlm.nih.gov/21840189" }, { "database": "PubMed", "id": "21937645", "url": "https://pubmed.ncbi.nlm.nih.gov/21937645" }, { "database": "PubMed", "id": "22028912", "url": "https://pubmed.ncbi.nlm.nih.gov/22028912" }, { "database": "PubMed", "id": "22039466", "url": "https://pubmed.ncbi.nlm.nih.gov/22039466" }, { "database": "PubMed", "id": "22230498", "url": "https://pubmed.ncbi.nlm.nih.gov/22230498" }, { "database": "PubMed", "id": "22253983", "url": "https://pubmed.ncbi.nlm.nih.gov/22253983" }, { "database": "PubMed", "id": "22347457", "url": "https://pubmed.ncbi.nlm.nih.gov/22347457" }, { "database": "PubMed", "id": "22357971", "url": "https://pubmed.ncbi.nlm.nih.gov/22357971" }, { "database": "PubMed", "id": "22383503", "url": "https://pubmed.ncbi.nlm.nih.gov/22383503" }, { "database": "PubMed", "id": "22421143", "url": "https://pubmed.ncbi.nlm.nih.gov/22421143" }, { "database": "PubMed", "id": "22422828", "url": "https://pubmed.ncbi.nlm.nih.gov/22422828" }, { "database": "PubMed", "id": "22452803", "url": "https://pubmed.ncbi.nlm.nih.gov/22452803" }, { "database": "PubMed", "id": "22460505", "url": "https://pubmed.ncbi.nlm.nih.gov/22460505" }, { "database": "PubMed", "id": "22567115", "url": "https://pubmed.ncbi.nlm.nih.gov/22567115" }, { "database": "PubMed", "id": "22817638", "url": "https://pubmed.ncbi.nlm.nih.gov/22817638" }, { "database": "PubMed", "id": "22886792", "url": "https://pubmed.ncbi.nlm.nih.gov/22886792" }, { "database": "PubMed", "id": "22969779", "url": "https://pubmed.ncbi.nlm.nih.gov/22969779" }, { "database": "PubMed", "id": "23027611", "url": "https://pubmed.ncbi.nlm.nih.gov/23027611" }, { "database": "PubMed", "id": "23094058", "url": "https://pubmed.ncbi.nlm.nih.gov/23094058" }, { "database": "PubMed", "id": "23095638", "url": "https://pubmed.ncbi.nlm.nih.gov/23095638" }, { "database": "PubMed", "id": "23185989", "url": "https://pubmed.ncbi.nlm.nih.gov/23185989" }, { "database": "PubMed", "id": "23272152", "url": "https://pubmed.ncbi.nlm.nih.gov/23272152" }, { "database": "PubMed", "id": "23348097", "url": "https://pubmed.ncbi.nlm.nih.gov/23348097" }, { "database": "PubMed", "id": "23349989", "url": "https://pubmed.ncbi.nlm.nih.gov/23349989" }, { "database": "PubMed", "id": "23383195", "url": "https://pubmed.ncbi.nlm.nih.gov/23383195" }, { "database": "PubMed", "id": "23415012", "url": "https://pubmed.ncbi.nlm.nih.gov/23415012" }, { "database": "PubMed", "id": "23471000", "url": "https://pubmed.ncbi.nlm.nih.gov/23471000" }, { "database": "PubMed", "id": "23537100", "url": "https://pubmed.ncbi.nlm.nih.gov/23537100" }, { "database": "PubMed", "id": "23557706", "url": "https://pubmed.ncbi.nlm.nih.gov/23557706" }, { "database": "PubMed", "id": "23563240", "url": "https://pubmed.ncbi.nlm.nih.gov/23563240" }, { "database": "PubMed", "id": "23569215", "url": "https://pubmed.ncbi.nlm.nih.gov/23569215" }, { "database": "PubMed", "id": "23632629", "url": "https://pubmed.ncbi.nlm.nih.gov/23632629" }, { "database": "PubMed", "id": "23691056", "url": "https://pubmed.ncbi.nlm.nih.gov/23691056" }, { "database": "PubMed", "id": "23724051", "url": "https://pubmed.ncbi.nlm.nih.gov/23724051" }, { "database": "PubMed", "id": "23861877", "url": "https://pubmed.ncbi.nlm.nih.gov/23861877" }, { "database": "PubMed", "id": "24023012", "url": "https://pubmed.ncbi.nlm.nih.gov/24023012" }, { "database": "PubMed", "id": "24057571", "url": "https://pubmed.ncbi.nlm.nih.gov/24057571" }, { "database": "PubMed", "id": "24073922", "url": "https://pubmed.ncbi.nlm.nih.gov/24073922" }, { "database": "PubMed", "id": "24098154", "url": "https://pubmed.ncbi.nlm.nih.gov/24098154" }, { "database": "PubMed", "id": "24133625", "url": "https://pubmed.ncbi.nlm.nih.gov/24133625" }, { "database": "PubMed", "id": "24180592", "url": "https://pubmed.ncbi.nlm.nih.gov/24180592" }, { "database": "PubMed", "id": "24201812", "url": "https://pubmed.ncbi.nlm.nih.gov/24201812" }, { "database": "PubMed", "id": "24245980", "url": "https://pubmed.ncbi.nlm.nih.gov/24245980" }, { "database": "PubMed", "id": "24262949", "url": "https://pubmed.ncbi.nlm.nih.gov/24262949" }, { "database": "PubMed", "id": "24273605", "url": "https://pubmed.ncbi.nlm.nih.gov/24273605" }, { "database": "PubMed", "id": "24287900", "url": "https://pubmed.ncbi.nlm.nih.gov/24287900" }, { "database": "PubMed", "id": "24303161", "url": "https://pubmed.ncbi.nlm.nih.gov/24303161" }, { "database": "PubMed", "id": "24376606", "url": "https://pubmed.ncbi.nlm.nih.gov/24376606" }, { "database": "PubMed", "id": "24384983", "url": "https://pubmed.ncbi.nlm.nih.gov/24384983" }, { "database": "PubMed", "id": "24416349", "url": "https://pubmed.ncbi.nlm.nih.gov/24416349" }, { "database": "PubMed", "id": "24496460", "url": "https://pubmed.ncbi.nlm.nih.gov/24496460" }, { "database": "PubMed", "id": "24527093", "url": "https://pubmed.ncbi.nlm.nih.gov/24527093" }, { "database": "PubMed", "id": "24587596", "url": "https://pubmed.ncbi.nlm.nih.gov/24587596" }, { "database": "PubMed", "id": "24590896", "url": "https://pubmed.ncbi.nlm.nih.gov/24590896" }, { "database": "PubMed", "id": "24606695", "url": "https://pubmed.ncbi.nlm.nih.gov/24606695" }, { "database": "PubMed", "id": "24691032", "url": "https://pubmed.ncbi.nlm.nih.gov/24691032" }, { "database": "PubMed", "id": "24810758", "url": "https://pubmed.ncbi.nlm.nih.gov/24810758" }, { "database": "PubMed", "id": "24887419", "url": "https://pubmed.ncbi.nlm.nih.gov/24887419" }, { "database": "PubMed", "id": "24932295", "url": "https://pubmed.ncbi.nlm.nih.gov/24932295" }, { "database": "PubMed", "id": "24952732", "url": "https://pubmed.ncbi.nlm.nih.gov/24952732" }, { "database": "PubMed", "id": "24984001", "url": "https://pubmed.ncbi.nlm.nih.gov/24984001" }, { "database": "PubMed", "id": "24995775", "url": "https://pubmed.ncbi.nlm.nih.gov/24995775" }, { "database": "PubMed", "id": "25005758", "url": "https://pubmed.ncbi.nlm.nih.gov/25005758" }, { "database": "PubMed", "id": "25020061", "url": "https://pubmed.ncbi.nlm.nih.gov/25020061" }, { "database": "PubMed", "id": "25026292", "url": "https://pubmed.ncbi.nlm.nih.gov/25026292" }, { "database": "PubMed", "id": "25028121", "url": "https://pubmed.ncbi.nlm.nih.gov/25028121" }, { "database": "PubMed", "id": "25035961", "url": "https://pubmed.ncbi.nlm.nih.gov/25035961" }, { "database": "PubMed", "id": "25051975", "url": "https://pubmed.ncbi.nlm.nih.gov/25051975" }, { "database": "PubMed", "id": "25088800", "url": "https://pubmed.ncbi.nlm.nih.gov/25088800" }, { "database": "PubMed", "id": "25153728", "url": "https://pubmed.ncbi.nlm.nih.gov/25153728" }, { "database": "PubMed", "id": "25183163", "url": "https://pubmed.ncbi.nlm.nih.gov/25183163" }, { "database": "PubMed", "id": "25200751", "url": "https://pubmed.ncbi.nlm.nih.gov/25200751" }, { "database": "PubMed", "id": "25221647", "url": "https://pubmed.ncbi.nlm.nih.gov/25221647" }, { "database": "PubMed", "id": "25283550", "url": "https://pubmed.ncbi.nlm.nih.gov/25283550" }, { "database": "PubMed", "id": "25296981", "url": "https://pubmed.ncbi.nlm.nih.gov/25296981" }, { "database": "PubMed", "id": "25302072", "url": "https://pubmed.ncbi.nlm.nih.gov/25302072" }, { "database": "PubMed", "id": "25356866", "url": "https://pubmed.ncbi.nlm.nih.gov/25356866" }, { "database": "PubMed", "id": "25385184", "url": "https://pubmed.ncbi.nlm.nih.gov/25385184" }, { "database": "PubMed", "id": "25460505", "url": "https://pubmed.ncbi.nlm.nih.gov/25460505" }, { "database": "PubMed", "id": "25592318", "url": "https://pubmed.ncbi.nlm.nih.gov/25592318" }, { "database": "PubMed", "id": "25596749", "url": "https://pubmed.ncbi.nlm.nih.gov/25596749" }, { "database": "PubMed", "id": "25609923", "url": "https://pubmed.ncbi.nlm.nih.gov/25609923" }, { "database": "PubMed", "id": "25624750", "url": "https://pubmed.ncbi.nlm.nih.gov/25624750" }, { "database": "PubMed", "id": "25721419", "url": "https://pubmed.ncbi.nlm.nih.gov/25721419" }, { "database": "PubMed", "id": "25724269", "url": "https://pubmed.ncbi.nlm.nih.gov/25724269" }, { "database": "PubMed", "id": "25738356", "url": "https://pubmed.ncbi.nlm.nih.gov/25738356" }, { "database": "PubMed", "id": "25775774", "url": "https://pubmed.ncbi.nlm.nih.gov/25775774" }, { "database": "PubMed", "id": "25792811", "url": "https://pubmed.ncbi.nlm.nih.gov/25792811" }, { "database": "PubMed", "id": "25793983", "url": "https://pubmed.ncbi.nlm.nih.gov/25793983" }, { "database": "PubMed", "id": "25815363", "url": "https://pubmed.ncbi.nlm.nih.gov/25815363" }, { "database": "PubMed", "id": "25834399", "url": "https://pubmed.ncbi.nlm.nih.gov/25834399" }, { "database": "PubMed", "id": "25849580", "url": "https://pubmed.ncbi.nlm.nih.gov/25849580" }, { "database": "PubMed", "id": "25884331", "url": "https://pubmed.ncbi.nlm.nih.gov/25884331" }, { "database": "PubMed", "id": "25902785", "url": "https://pubmed.ncbi.nlm.nih.gov/25902785" }, { "database": "PubMed", "id": "25909895", "url": "https://pubmed.ncbi.nlm.nih.gov/25909895" }, { "database": "PubMed", "id": "25926716", "url": "https://pubmed.ncbi.nlm.nih.gov/25926716" }, { "database": "PubMed", "id": "25945839", "url": "https://pubmed.ncbi.nlm.nih.gov/25945839" }, { "database": "PubMed", "id": "25978653", "url": "https://pubmed.ncbi.nlm.nih.gov/25978653" }, { "database": "PubMed", "id": "26071201", "url": "https://pubmed.ncbi.nlm.nih.gov/26071201" }, { "database": "PubMed", "id": "26114294", "url": "https://pubmed.ncbi.nlm.nih.gov/26114294" }, { "database": "PubMed", "id": "26151180", "url": "https://pubmed.ncbi.nlm.nih.gov/26151180" }, { "database": "PubMed", "id": "26158518", "url": "https://pubmed.ncbi.nlm.nih.gov/26158518" }, { "database": "PubMed", "id": "26291325", "url": "https://pubmed.ncbi.nlm.nih.gov/26291325" }, { "database": "PubMed", "id": "26313911", "url": "https://pubmed.ncbi.nlm.nih.gov/26313911" }, { "database": "PubMed", "id": "26317515", "url": "https://pubmed.ncbi.nlm.nih.gov/26317515" }, { "database": "PubMed", "id": "26329846", "url": "https://pubmed.ncbi.nlm.nih.gov/26329846" }, { "database": "PubMed", "id": "26367276", "url": "https://pubmed.ncbi.nlm.nih.gov/26367276" }, { "database": "PubMed", "id": "26369790", "url": "https://pubmed.ncbi.nlm.nih.gov/26369790" }, { "database": "PubMed", "id": "26384306", "url": "https://pubmed.ncbi.nlm.nih.gov/26384306" }, { "database": "PubMed", "id": "26397133", "url": "https://pubmed.ncbi.nlm.nih.gov/26397133" }, { "database": "PubMed", "id": "26397365", "url": "https://pubmed.ncbi.nlm.nih.gov/26397365" }, { "database": "PubMed", "id": "26413815", "url": "https://pubmed.ncbi.nlm.nih.gov/26413815" }, { "database": "PubMed", "id": "26416965", "url": "https://pubmed.ncbi.nlm.nih.gov/26416965" }, { "database": "PubMed", "id": "26417067", "url": "https://pubmed.ncbi.nlm.nih.gov/26417067" }, { "database": "PubMed", "id": "26437614", "url": "https://pubmed.ncbi.nlm.nih.gov/26437614" }, { "database": "PubMed", "id": "26447757", "url": "https://pubmed.ncbi.nlm.nih.gov/26447757" }, { "database": "PubMed", "id": "26496360", "url": "https://pubmed.ncbi.nlm.nih.gov/26496360" }, { "database": "PubMed", "id": "26536660", "url": "https://pubmed.ncbi.nlm.nih.gov/26536660" }, { "database": "PubMed", "id": "26557719", "url": "https://pubmed.ncbi.nlm.nih.gov/26557719" }, { "database": "PubMed", "id": "26580601", "url": "https://pubmed.ncbi.nlm.nih.gov/26580601" }, { "database": "PubMed", "id": "26641458", "url": "https://pubmed.ncbi.nlm.nih.gov/26641458" }, { "database": "PubMed", "id": "26657290", "url": "https://pubmed.ncbi.nlm.nih.gov/26657290" }, { "database": "PubMed", "id": "26674543", "url": "https://pubmed.ncbi.nlm.nih.gov/26674543" }, { "database": "PubMed", "id": "26698679", "url": "https://pubmed.ncbi.nlm.nih.gov/26698679" }, { "database": "PubMed", "id": "26734992", "url": "https://pubmed.ncbi.nlm.nih.gov/26734992" }, { "database": "PubMed", "id": "26775697", "url": "https://pubmed.ncbi.nlm.nih.gov/26775697" }, { "database": "PubMed", "id": "26775708", "url": "https://pubmed.ncbi.nlm.nih.gov/26775708" }, { "database": "PubMed", "id": "26791827", "url": "https://pubmed.ncbi.nlm.nih.gov/26791827" }, { "database": "PubMed", "id": "26879868", "url": "https://pubmed.ncbi.nlm.nih.gov/26879868" }, { "database": "PubMed", "id": "26887051", "url": "https://pubmed.ncbi.nlm.nih.gov/26887051" }, { "database": "PubMed", "id": "26909611", "url": "https://pubmed.ncbi.nlm.nih.gov/26909611" }, { "database": "PubMed", "id": "26919097", "url": "https://pubmed.ncbi.nlm.nih.gov/26919097" }, { "database": "PubMed", "id": "26934000", "url": "https://pubmed.ncbi.nlm.nih.gov/26934000" }, { "database": "PubMed", "id": "26940018", "url": "https://pubmed.ncbi.nlm.nih.gov/26940018" }, { "database": "PubMed", "id": "26985829", "url": "https://pubmed.ncbi.nlm.nih.gov/26985829" }, { "database": "PubMed", "id": "27009203", "url": "https://pubmed.ncbi.nlm.nih.gov/27009203" }, { "database": "PubMed", "id": "27031247", "url": "https://pubmed.ncbi.nlm.nih.gov/27031247" }, { "database": "PubMed", "id": "27048233", "url": "https://pubmed.ncbi.nlm.nih.gov/27048233" }, { "database": "PubMed", "id": "27070592", "url": "https://pubmed.ncbi.nlm.nih.gov/27070592" }, { "database": "PubMed", "id": "27096957", "url": "https://pubmed.ncbi.nlm.nih.gov/27096957" }, { "database": "PubMed", "id": "27098617", "url": "https://pubmed.ncbi.nlm.nih.gov/27098617" }, { "database": "PubMed", "id": "27147579", "url": "https://pubmed.ncbi.nlm.nih.gov/27147579" }, { "database": "PubMed", "id": "27223432", "url": "https://pubmed.ncbi.nlm.nih.gov/27223432" }, { "database": "PubMed", "id": "27227776", "url": "https://pubmed.ncbi.nlm.nih.gov/27227776" }, { "database": "PubMed", "id": "27239959", "url": "https://pubmed.ncbi.nlm.nih.gov/27239959" }, { "database": "PubMed", "id": "27259258", "url": "https://pubmed.ncbi.nlm.nih.gov/27259258" }, { "database": "PubMed", "id": "27264178", "url": "https://pubmed.ncbi.nlm.nih.gov/27264178" }, { "database": "PubMed", "id": "27304189", "url": "https://pubmed.ncbi.nlm.nih.gov/27304189" }, { "database": "PubMed", "id": "27322212", "url": "https://pubmed.ncbi.nlm.nih.gov/27322212" }, { "database": "PubMed", "id": "27329724", "url": "https://pubmed.ncbi.nlm.nih.gov/27329724" }, { "database": "PubMed", "id": "27379204", "url": "https://pubmed.ncbi.nlm.nih.gov/27379204" }, { "database": "PubMed", "id": "27467530", "url": "https://pubmed.ncbi.nlm.nih.gov/27467530" }, { "database": "PubMed", "id": "27486771", "url": "https://pubmed.ncbi.nlm.nih.gov/27486771" }, { "database": "PubMed", "id": "27494886", "url": "https://pubmed.ncbi.nlm.nih.gov/27494886" }, { "database": "PubMed", "id": "27506466", "url": "https://pubmed.ncbi.nlm.nih.gov/27506466" }, { "database": "PubMed", "id": "27517315", "url": "https://pubmed.ncbi.nlm.nih.gov/27517315" }, { "database": "PubMed", "id": "27551516", "url": "https://pubmed.ncbi.nlm.nih.gov/27551516" }, { "database": "PubMed", "id": "27611696", "url": "https://pubmed.ncbi.nlm.nih.gov/27611696" }, { "database": "PubMed", "id": "27654866", "url": "https://pubmed.ncbi.nlm.nih.gov/27654866" }, { "database": "PubMed", "id": "27656263", "url": "https://pubmed.ncbi.nlm.nih.gov/27656263" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27680387", "url": "https://pubmed.ncbi.nlm.nih.gov/27680387" }, { "database": "PubMed", "id": "27769069", "url": "https://pubmed.ncbi.nlm.nih.gov/27769069" }, { "database": "PubMed", "id": "27863387", "url": "https://pubmed.ncbi.nlm.nih.gov/27863387" }, { "database": "PubMed", "id": "27903908", "url": "https://pubmed.ncbi.nlm.nih.gov/27903908" }, { "database": "PubMed", "id": "27903966", "url": "https://pubmed.ncbi.nlm.nih.gov/27903966" }, { "database": "PubMed", "id": "27935582", "url": "https://pubmed.ncbi.nlm.nih.gov/27935582" }, { "database": "PubMed", "id": "27957793", "url": "https://pubmed.ncbi.nlm.nih.gov/27957793" }, { "database": "PubMed", "id": "28061443", "url": "https://pubmed.ncbi.nlm.nih.gov/28061443" }, { "database": "PubMed", "id": "28102849", "url": "https://pubmed.ncbi.nlm.nih.gov/28102849" }, { "database": "PubMed", "id": "28146421", "url": "https://pubmed.ncbi.nlm.nih.gov/28146421" }, { "database": "PubMed", "id": "28152510", "url": "https://pubmed.ncbi.nlm.nih.gov/28152510" }, { "database": "PubMed", "id": "28191279", "url": "https://pubmed.ncbi.nlm.nih.gov/28191279" }, { "database": "PubMed", "id": "28252104", "url": "https://pubmed.ncbi.nlm.nih.gov/28252104" }, { "database": "PubMed", "id": "28272965", "url": "https://pubmed.ncbi.nlm.nih.gov/28272965" }, { "database": "PubMed", "id": "28400912", "url": "https://pubmed.ncbi.nlm.nih.gov/28400912" }, { "database": "PubMed", "id": "28475412", "url": "https://pubmed.ncbi.nlm.nih.gov/28475412" }, { "database": "PubMed", "id": "28481292", "url": "https://pubmed.ncbi.nlm.nih.gov/28481292" }, { "database": "PubMed", "id": "28569781", "url": "https://pubmed.ncbi.nlm.nih.gov/28569781" }, { "database": "PubMed", "id": "28591197", "url": "https://pubmed.ncbi.nlm.nih.gov/28591197" }, { "database": "PubMed", "id": "28592812", "url": "https://pubmed.ncbi.nlm.nih.gov/28592812" }, { "database": "PubMed", "id": "28652768", "url": "https://pubmed.ncbi.nlm.nih.gov/28652768" }, { "database": "PubMed", "id": "28675026", "url": "https://pubmed.ncbi.nlm.nih.gov/28675026" }, { "database": "PubMed", "id": "28675785", "url": "https://pubmed.ncbi.nlm.nih.gov/28675785" }, { "database": "PubMed", "id": "28710431", "url": "https://pubmed.ncbi.nlm.nih.gov/28710431" }, { "database": "PubMed", "id": "28750861", "url": "https://pubmed.ncbi.nlm.nih.gov/28750861" }, { "database": "PubMed", "id": "28808322", "url": "https://pubmed.ncbi.nlm.nih.gov/28808322" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28857517", "url": "https://pubmed.ncbi.nlm.nih.gov/28857517" }, { "database": "PubMed", "id": "28860574", "url": "https://pubmed.ncbi.nlm.nih.gov/28860574" }, { "database": "PubMed", "id": "28881606", "url": "https://pubmed.ncbi.nlm.nih.gov/28881606" }, { "database": "PubMed", "id": "28903328", "url": "https://pubmed.ncbi.nlm.nih.gov/28903328" }, { "database": "PubMed", "id": "28923059", "url": "https://pubmed.ncbi.nlm.nih.gov/28923059" }, { "database": "PubMed", "id": "28962438", "url": "https://pubmed.ncbi.nlm.nih.gov/28962438" }, { "database": "PubMed", "id": "28963552", "url": "https://pubmed.ncbi.nlm.nih.gov/28963552" }, { "database": "PubMed", "id": "28974016", "url": "https://pubmed.ncbi.nlm.nih.gov/28974016" }, { "database": "PubMed", "id": "29072696", "url": "https://pubmed.ncbi.nlm.nih.gov/29072696" }, { "database": "PubMed", "id": "29156703", "url": "https://pubmed.ncbi.nlm.nih.gov/29156703" }, { "database": "PubMed", "id": "29162840", "url": "https://pubmed.ncbi.nlm.nih.gov/29162840" }, { "database": "PubMed", "id": "29167516", "url": "https://pubmed.ncbi.nlm.nih.gov/29167516" }, { "database": "PubMed", "id": "29175420", "url": "https://pubmed.ncbi.nlm.nih.gov/29175420" }, { "database": "PubMed", "id": "29190940", "url": "https://pubmed.ncbi.nlm.nih.gov/29190940" }, { "database": "PubMed", "id": "29233971", "url": "https://pubmed.ncbi.nlm.nih.gov/29233971" }, { "database": "PubMed", "id": "29331082", "url": "https://pubmed.ncbi.nlm.nih.gov/29331082" }, { "database": "PubMed", "id": "29379304", "url": "https://pubmed.ncbi.nlm.nih.gov/29379304" }, { "database": "PubMed", "id": "29396411", "url": "https://pubmed.ncbi.nlm.nih.gov/29396411" }, { "database": "PubMed", "id": "29396506", "url": "https://pubmed.ncbi.nlm.nih.gov/29396506" }, { "database": "PubMed", "id": "29423932", "url": "https://pubmed.ncbi.nlm.nih.gov/29423932" }, { "database": "PubMed", "id": "29434840", "url": "https://pubmed.ncbi.nlm.nih.gov/29434840" }, { "database": "PubMed", "id": "29448085", "url": "https://pubmed.ncbi.nlm.nih.gov/29448085" }, { "database": "PubMed", "id": "29463831", "url": "https://pubmed.ncbi.nlm.nih.gov/29463831" }, { "database": "PubMed", "id": "29472585", "url": "https://pubmed.ncbi.nlm.nih.gov/29472585" }, { "database": "PubMed", "id": "29472733", "url": "https://pubmed.ncbi.nlm.nih.gov/29472733" }, { "database": "PubMed", "id": "29476223", "url": "https://pubmed.ncbi.nlm.nih.gov/29476223" }, { "database": "PubMed", "id": "29484131", "url": "https://pubmed.ncbi.nlm.nih.gov/29484131" }, { "database": "PubMed", "id": "29533017", "url": "https://pubmed.ncbi.nlm.nih.gov/29533017" }, { "database": "PubMed", "id": "29552187", "url": "https://pubmed.ncbi.nlm.nih.gov/29552187" }, { "database": "PubMed", "id": "29662627", "url": "https://pubmed.ncbi.nlm.nih.gov/29662627" }, { "database": "PubMed", "id": "29665227", "url": "https://pubmed.ncbi.nlm.nih.gov/29665227" }, { "database": "PubMed", "id": "29692710", "url": "https://pubmed.ncbi.nlm.nih.gov/29692710" }, { "database": "PubMed", "id": "29712904", "url": "https://pubmed.ncbi.nlm.nih.gov/29712904" }, { "database": "PubMed", "id": "29716528", "url": "https://pubmed.ncbi.nlm.nih.gov/29716528" }, { "database": "PubMed", "id": "29719593", "url": "https://pubmed.ncbi.nlm.nih.gov/29719593" }, { "database": "PubMed", "id": "29731844", "url": "https://pubmed.ncbi.nlm.nih.gov/29731844" }, { "database": "PubMed", "id": "29749377", "url": "https://pubmed.ncbi.nlm.nih.gov/29749377" }, { "database": "PubMed", "id": "29755672", "url": "https://pubmed.ncbi.nlm.nih.gov/29755672" }, { "database": "PubMed", "id": "29774133", "url": "https://pubmed.ncbi.nlm.nih.gov/29774133" }, { "database": "PubMed", "id": "29780826", "url": "https://pubmed.ncbi.nlm.nih.gov/29780826" }, { "database": "PubMed", "id": "29876006", "url": "https://pubmed.ncbi.nlm.nih.gov/29876006" }, { "database": "PubMed", "id": "29933163", "url": "https://pubmed.ncbi.nlm.nih.gov/29933163" }, { "database": "PubMed", "id": "30036188", "url": "https://pubmed.ncbi.nlm.nih.gov/30036188" }, { "database": "PubMed", "id": "30067827", "url": "https://pubmed.ncbi.nlm.nih.gov/30067827" }, { "database": "PubMed", "id": "30073169", "url": "https://pubmed.ncbi.nlm.nih.gov/30073169" }, { "database": "PubMed", "id": "30108651", "url": "https://pubmed.ncbi.nlm.nih.gov/30108651" }, { "database": "PubMed", "id": "30132043", "url": "https://pubmed.ncbi.nlm.nih.gov/30132043" }, { "database": "PubMed", "id": "30154572", "url": "https://pubmed.ncbi.nlm.nih.gov/30154572" }, { "database": "PubMed", "id": "30208604", "url": "https://pubmed.ncbi.nlm.nih.gov/30208604" }, { "database": "PubMed", "id": "30250025", "url": "https://pubmed.ncbi.nlm.nih.gov/30250025" }, { "database": "PubMed", "id": "30258945", "url": "https://pubmed.ncbi.nlm.nih.gov/30258945" }, { "database": "PubMed", "id": "30274346", "url": "https://pubmed.ncbi.nlm.nih.gov/30274346" }, { "database": "PubMed", "id": "30282964", "url": "https://pubmed.ncbi.nlm.nih.gov/30282964" }, { "database": "PubMed", "id": "30285764", "url": "https://pubmed.ncbi.nlm.nih.gov/30285764" }, { "database": "PubMed", "id": "30326670", "url": "https://pubmed.ncbi.nlm.nih.gov/30326670" }, { "database": "PubMed", "id": "30341283", "url": "https://pubmed.ncbi.nlm.nih.gov/30341283" }, { "database": "PubMed", "id": "30359321", "url": "https://pubmed.ncbi.nlm.nih.gov/30359321" }, { "database": "PubMed", "id": "30373220", "url": "https://pubmed.ncbi.nlm.nih.gov/30373220" }, { "database": "PubMed", "id": "30473630", "url": "https://pubmed.ncbi.nlm.nih.gov/30473630" }, { "database": "PubMed", "id": "30514289", "url": "https://pubmed.ncbi.nlm.nih.gov/30514289" }, { "database": "PubMed", "id": "30599894", "url": "https://pubmed.ncbi.nlm.nih.gov/30599894" }, { "database": "PubMed", "id": "30619462", "url": "https://pubmed.ncbi.nlm.nih.gov/30619462" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30633777", "url": "https://pubmed.ncbi.nlm.nih.gov/30633777" }, { "database": "PubMed", "id": "30654190", "url": "https://pubmed.ncbi.nlm.nih.gov/30654190" }, { "database": "PubMed", "id": "30675291", "url": "https://pubmed.ncbi.nlm.nih.gov/30675291" }, { "database": "PubMed", "id": "30699367", "url": "https://pubmed.ncbi.nlm.nih.gov/30699367" }, { "database": "PubMed", "id": "30716115", "url": "https://pubmed.ncbi.nlm.nih.gov/30716115" }, { "database": "PubMed", "id": "30753671", "url": "https://pubmed.ncbi.nlm.nih.gov/30753671" }, { "database": "PubMed", "id": "30755581", "url": "https://pubmed.ncbi.nlm.nih.gov/30755581" }, { "database": "PubMed", "id": "30758811", "url": "https://pubmed.ncbi.nlm.nih.gov/30758811" }, { "database": "PubMed", "id": "30761524", "url": "https://pubmed.ncbi.nlm.nih.gov/30761524" }, { "database": "PubMed", "id": "30771309", "url": "https://pubmed.ncbi.nlm.nih.gov/30771309" }, { "database": "PubMed", "id": "30813295", "url": "https://pubmed.ncbi.nlm.nih.gov/30813295" }, { "database": "PubMed", "id": "30816192", "url": "https://pubmed.ncbi.nlm.nih.gov/30816192" }, { "database": "PubMed", "id": "30816216", "url": "https://pubmed.ncbi.nlm.nih.gov/30816216" }, { "database": "PubMed", "id": "30864709", "url": "https://pubmed.ncbi.nlm.nih.gov/30864709" }, { "database": "PubMed", "id": "30959969", "url": "https://pubmed.ncbi.nlm.nih.gov/30959969" }, { "database": "PubMed", "id": "30965356", "url": "https://pubmed.ncbi.nlm.nih.gov/30965356" }, { "database": "PubMed", "id": "30986276", "url": "https://pubmed.ncbi.nlm.nih.gov/30986276" }, { "database": "PubMed", "id": "31031856", "url": "https://pubmed.ncbi.nlm.nih.gov/31031856" }, { "database": "PubMed", "id": "31032225", "url": "https://pubmed.ncbi.nlm.nih.gov/31032225" }, { "database": "PubMed", "id": "31037139", "url": "https://pubmed.ncbi.nlm.nih.gov/31037139" }, { "database": "PubMed", "id": "31046771", "url": "https://pubmed.ncbi.nlm.nih.gov/31046771" }, { "database": "PubMed", "id": "31083403", "url": "https://pubmed.ncbi.nlm.nih.gov/31083403" }, { "database": "PubMed", "id": "31089421", "url": "https://pubmed.ncbi.nlm.nih.gov/31089421" }, { "database": "PubMed", "id": "31160490", "url": "https://pubmed.ncbi.nlm.nih.gov/31160490" }, { "database": "PubMed", "id": "31195027", "url": "https://pubmed.ncbi.nlm.nih.gov/31195027" }, { "database": "PubMed", "id": "31197106", "url": "https://pubmed.ncbi.nlm.nih.gov/31197106" }, { "database": "PubMed", "id": "31247000", "url": "https://pubmed.ncbi.nlm.nih.gov/31247000" }, { "database": "PubMed", "id": "31284427", "url": "https://pubmed.ncbi.nlm.nih.gov/31284427" }, { "database": "PubMed", "id": "31294029", "url": "https://pubmed.ncbi.nlm.nih.gov/31294029" }, { "database": "PubMed", "id": "31332166", "url": "https://pubmed.ncbi.nlm.nih.gov/31332166" }, { "database": "PubMed", "id": "31383843", "url": "https://pubmed.ncbi.nlm.nih.gov/31383843" }, { "database": "PubMed", "id": "31383875", "url": "https://pubmed.ncbi.nlm.nih.gov/31383875" }, { "database": "PubMed", "id": "31388935", "url": "https://pubmed.ncbi.nlm.nih.gov/31388935" }, { "database": "PubMed", "id": "31404320", "url": "https://pubmed.ncbi.nlm.nih.gov/31404320" }, { "database": "PubMed", "id": "31428575", "url": "https://pubmed.ncbi.nlm.nih.gov/31428575" }, { "database": "PubMed", "id": "31546610", "url": "https://pubmed.ncbi.nlm.nih.gov/31546610" }, { "database": "PubMed", "id": "31572212", "url": "https://pubmed.ncbi.nlm.nih.gov/31572212" }, { "database": "PubMed", "id": "31586300", "url": "https://pubmed.ncbi.nlm.nih.gov/31586300" }, { "database": "PubMed", "id": "31601269", "url": "https://pubmed.ncbi.nlm.nih.gov/31601269" }, { "database": "PubMed", "id": "31710966", "url": "https://pubmed.ncbi.nlm.nih.gov/31710966" }, { "database": "PubMed", "id": "31889970", "url": "https://pubmed.ncbi.nlm.nih.gov/31889970" }, { "database": "PubMed", "id": "32012648", "url": "https://pubmed.ncbi.nlm.nih.gov/32012648" }, { "database": "PubMed", "id": "32019055", "url": "https://pubmed.ncbi.nlm.nih.gov/32019055" }, { "database": "PubMed", "id": "32051464", "url": "https://pubmed.ncbi.nlm.nih.gov/32051464" }, { "database": "PubMed", "id": "32066788", "url": "https://pubmed.ncbi.nlm.nih.gov/32066788" }, { "database": "PubMed", "id": "32103999", "url": "https://pubmed.ncbi.nlm.nih.gov/32103999" }, { "database": "PubMed", "id": "32363163", "url": "https://pubmed.ncbi.nlm.nih.gov/32363163" }, { "database": "PubMed", "id": "32444674", "url": "https://pubmed.ncbi.nlm.nih.gov/32444674" }, { "database": "PubMed", "id": "32460884", "url": "https://pubmed.ncbi.nlm.nih.gov/32460884" }, { "database": "PubMed", "id": "32563986", "url": "https://pubmed.ncbi.nlm.nih.gov/32563986" }, { "database": "PubMed", "id": "32575925", "url": "https://pubmed.ncbi.nlm.nih.gov/32575925" }, { "database": "PubMed", "id": "32576196", "url": "https://pubmed.ncbi.nlm.nih.gov/32576196" }, { "database": "PubMed", "id": "32642725", "url": "https://pubmed.ncbi.nlm.nih.gov/32642725" }, { "database": "PubMed", "id": "32676067", "url": "https://pubmed.ncbi.nlm.nih.gov/32676067" }, { "database": "PubMed", "id": "32707827", "url": "https://pubmed.ncbi.nlm.nih.gov/32707827" }, { "database": "PubMed", "id": "32753891", "url": "https://pubmed.ncbi.nlm.nih.gov/32753891" }, { "database": "PubMed", "id": "32765083", "url": "https://pubmed.ncbi.nlm.nih.gov/32765083" }, { "database": "PubMed", "id": "32766308", "url": "https://pubmed.ncbi.nlm.nih.gov/32766308" }, { "database": "PubMed", "id": "32863214", "url": "https://pubmed.ncbi.nlm.nih.gov/32863214" }, { "database": "PubMed", "id": "32943998", "url": "https://pubmed.ncbi.nlm.nih.gov/32943998" }, { "database": "PubMed", "id": "32958058", "url": "https://pubmed.ncbi.nlm.nih.gov/32958058" }, { "database": "PubMed", "id": "33003310", "url": "https://pubmed.ncbi.nlm.nih.gov/33003310" }, { "database": "PubMed", "id": "33071789", "url": "https://pubmed.ncbi.nlm.nih.gov/33071789" }, { "database": "PubMed", "id": "33101031", "url": "https://pubmed.ncbi.nlm.nih.gov/33101031" }, { "database": "PubMed", "id": "33116125", "url": "https://pubmed.ncbi.nlm.nih.gov/33116125" }, { "database": "PubMed", "id": "33219302", "url": "https://pubmed.ncbi.nlm.nih.gov/33219302" }, { "database": "PubMed", "id": "33226960", "url": "https://pubmed.ncbi.nlm.nih.gov/33226960" }, { "database": "PubMed", "id": "33249469", "url": "https://pubmed.ncbi.nlm.nih.gov/33249469" }, { "database": "PubMed", "id": "33411714", "url": "https://pubmed.ncbi.nlm.nih.gov/33411714" }, { "database": "PubMed", "id": "33414447", "url": "https://pubmed.ncbi.nlm.nih.gov/33414447" }, { "database": "PubMed", "id": "33456359", "url": "https://pubmed.ncbi.nlm.nih.gov/33456359" }, { "database": "PubMed", "id": "33473107", "url": "https://pubmed.ncbi.nlm.nih.gov/33473107" }, { "database": "PubMed", "id": "33509041", "url": "https://pubmed.ncbi.nlm.nih.gov/33509041" }, { "database": "PubMed", "id": "33523588", "url": "https://pubmed.ncbi.nlm.nih.gov/33523588" }, { "database": "PubMed", "id": "33526785", "url": "https://pubmed.ncbi.nlm.nih.gov/33526785" }, { "database": "PubMed", "id": "33549048", "url": "https://pubmed.ncbi.nlm.nih.gov/33549048" }, { "database": "PubMed", "id": "33609078", "url": "https://pubmed.ncbi.nlm.nih.gov/33609078" }, { "database": "PubMed", "id": "33658929", "url": "https://pubmed.ncbi.nlm.nih.gov/33658929" }, { "database": "PubMed", "id": "33664437", "url": "https://pubmed.ncbi.nlm.nih.gov/33664437" }, { "database": "PubMed", "id": "33679734", "url": "https://pubmed.ncbi.nlm.nih.gov/33679734" }, { "database": "PubMed", "id": "33718332", "url": "https://pubmed.ncbi.nlm.nih.gov/33718332" }, { "database": "PubMed", "id": "33723215", "url": "https://pubmed.ncbi.nlm.nih.gov/33723215" }, { "database": "PubMed", "id": "33731670", "url": "https://pubmed.ncbi.nlm.nih.gov/33731670" }, { "database": "PubMed", "id": "33806593", "url": "https://pubmed.ncbi.nlm.nih.gov/33806593" }, { "database": "PubMed", "id": "33833996", "url": "https://pubmed.ncbi.nlm.nih.gov/33833996" }, { "database": "PubMed", "id": "33845796", "url": "https://pubmed.ncbi.nlm.nih.gov/33845796" }, { "database": "PubMed", "id": "33849427", "url": "https://pubmed.ncbi.nlm.nih.gov/33849427" }, { "database": "PubMed", "id": "33893278", "url": "https://pubmed.ncbi.nlm.nih.gov/33893278" }, { "database": "PubMed", "id": "33907223", "url": "https://pubmed.ncbi.nlm.nih.gov/33907223" }, { "database": "PubMed", "id": "33912163", "url": "https://pubmed.ncbi.nlm.nih.gov/33912163" }, { "database": "PubMed", "id": "33920031", "url": "https://pubmed.ncbi.nlm.nih.gov/33920031" }, { "database": "PubMed", "id": "33920772", "url": "https://pubmed.ncbi.nlm.nih.gov/33920772" }, { "database": "PubMed", "id": "33923895", "url": "https://pubmed.ncbi.nlm.nih.gov/33923895" }, { "database": "PubMed", "id": "33967735", "url": "https://pubmed.ncbi.nlm.nih.gov/33967735" }, { "database": "PubMed", "id": "35783523", "url": "https://pubmed.ncbi.nlm.nih.gov/35783523" }, { "database": "PubMed", "id": "35912992", "url": "https://pubmed.ncbi.nlm.nih.gov/35912992" }, { "database": "PubMed", "id": "36386326", "url": "https://pubmed.ncbi.nlm.nih.gov/36386326" }, { "database": "PubMed", "id": "36471885", "url": "https://pubmed.ncbi.nlm.nih.gov/36471885" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" } ], "site_lbl": "Ser2448", "uniprot_canonical_ac": "P42345-1" } ], "record_id": "pubmed.33003310", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NSUN6, an RNA methyltransferase of 5-mC controls glioblastoma response to temozolomide (TMZ) via NELFB and RPS6KB2 interaction.", "journal": "Cancer biology & therapy", "date": "2021", "authors": "Awah CU, Winter J, Mazdoom CM, Ogunwobi OO", "reference": { "type": "PubMed", "id": "34705606", "url": "https://pubmed.ncbi.nlm.nih.gov/34705606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WX92-2", "protein_name": "Negative elongation factor B", "gene_name": "NELFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEA1-1", "protein_name": "tRNA (cytosine(72)-C(5))-methyltransferase NSUN6", "gene_name": "NSUN6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34705606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ribosomal protein S6 kinase 2 (RPS6KB2) is a potential immunotherapeutic target for cancer that upregulates proinflammatory cytokines.", "journal": "Molecular biology reports", "date": "2024-01-28", "authors": "Ma Qiang, Yang Yipin, Chen Shuwen, Cheng Hao, Gong Peng, Hao Jiqing", "reference": { "type": "PubMed", "id": "38281249", "url": "https://pubmed.ncbi.nlm.nih.gov/38281249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38281249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation and activation of p70s6k by PDK1.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Pullen N, Dennis PB, Andjelkovic M, Dufner A, Kozma SC, Hemmings BA, Thomas G", "reference": { "type": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23443-1", "protein_name": "Ribosomal protein S6 kinase beta-1", "gene_name": "RPS6KB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15530-1", "protein_name": "3-phosphoinositide-dependent protein kinase 1", "gene_name": "PDPK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UBS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UBS0" }, { "database": "PubMed", "id": "11733037", "url": "https://pubmed.ncbi.nlm.nih.gov/11733037" }, { "database": "PubMed", "id": "15209375", "url": "https://pubmed.ncbi.nlm.nih.gov/15209375" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "site_lbl": "Thr228", "uniprot_canonical_ac": "Q9UBS0-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P23443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23443" }, { "database": "PubMed", "id": "10601311", "url": "https://pubmed.ncbi.nlm.nih.gov/10601311" }, { "database": "PubMed", "id": "9271440", "url": "https://pubmed.ncbi.nlm.nih.gov/9271440" }, { "database": "PubMed", "id": "9427642", "url": "https://pubmed.ncbi.nlm.nih.gov/9427642" }, { "database": "PubMed", "id": "19864428", "url": "https://pubmed.ncbi.nlm.nih.gov/19864428" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P23443-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "iPTMnet", "id": "P23443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23443" }, { "database": "PubMed", "id": "23119004", "url": "https://pubmed.ncbi.nlm.nih.gov/23119004" }, { "database": "PubMed", "id": "23830390", "url": "https://pubmed.ncbi.nlm.nih.gov/23830390" }, { "database": "PubMed", "id": "24605337", "url": "https://pubmed.ncbi.nlm.nih.gov/24605337" }, { "database": "PubMed", "id": "25486532", "url": "https://pubmed.ncbi.nlm.nih.gov/25486532" }, { "database": "PubMed", "id": "26698305", "url": "https://pubmed.ncbi.nlm.nih.gov/26698305" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" }, { "database": "PubMed", "id": "19864428", "url": "https://pubmed.ncbi.nlm.nih.gov/19864428" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P23443-1" }, { "start_pos": 412, "end_pos": 412, "kinase_uniprot_canonical_ac": "O15530-1", "kinase_gene_name": "PDPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P23443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23443" }, { "database": "PubMed", "id": "10601311", "url": "https://pubmed.ncbi.nlm.nih.gov/10601311" }, { "database": "PubMed", "id": "9271440", "url": "https://pubmed.ncbi.nlm.nih.gov/9271440" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "site_lbl": "Thr412", "uniprot_canonical_ac": "P23443-1" } ], "mutagenesis": [ { "start_pos": 412, "end_pos": 412, "sequence_org": "T", "sequence_mut": "E", "comment": "Mimics phosphorylation. Facilitates phosphorylation of T-252 by PDPK1; when associated with E-434; E-441; E-444 and E-447. Mimics phosphorylation. No effect on interaction with PDPK1 and phosphorylation of T-252. Impairs association with the eIF3 complex.", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "PubMed", "id": "16286006", "url": "https://pubmed.ncbi.nlm.nih.gov/16286006" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" }, { "database": "PubMed", "id": "19570988", "url": "https://pubmed.ncbi.nlm.nih.gov/19570988" } ], "uniprot_canonical_ac": "P23443-1" }, { "start_pos": 434, "end_pos": 434, "sequence_org": "S", "sequence_mut": "E", "comment": "Facilitates phosphorylation of T-252 by PDPK1; when associated with E-412; E-441; E-444 and E-447.", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "uniprot_canonical_ac": "P23443-1" }, { "start_pos": 441, "end_pos": 441, "sequence_org": "S", "sequence_mut": "E", "comment": "Facilitates phosphorylation of T-252 by PDPK1; when associated with E-412; E-434; E-444 and E-447.", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "uniprot_canonical_ac": "P23443-1" }, { "start_pos": 444, "end_pos": 444, "sequence_org": "T", "sequence_mut": "E", "comment": "Facilitates phosphorylation of T-252 by PDPK1; when associated with E-412; E-434; E-441 and E-447.", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "uniprot_canonical_ac": "P23443-1" }, { "start_pos": 447, "end_pos": 447, "sequence_org": "S", "sequence_mut": "E", "comment": "Facilitates phosphorylation of T-252 by PDPK1; when associated with E-412; E-434; E-441 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "P23443", "url": "https://www.uniprot.org/uniprotkb/P23443" }, { "database": "PubMed", "id": "9445476", "url": "https://pubmed.ncbi.nlm.nih.gov/9445476" } ], "uniprot_canonical_ac": "P23443-1" } ], "record_id": "pubmed.9445476", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of a novel p70 S6 kinase, p70 S6 kinase beta containing a proline-rich region.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Gout I, Minami T, Hara K, Tsujishita Y, Filonenko V, Waterfield M D, Yonezawa K", "reference": { "type": "PubMed", "id": "9804755", "url": "https://pubmed.ncbi.nlm.nih.gov/9804755" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23443-1", "protein_name": "Ribosomal protein S6 kinase beta-1", "gene_name": "RPS6KB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9804755", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of p70 S6Kbeta defines a novel family of p70 S6 kinases.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Saitoh M, ten Dijke P, Miyazono K, Ichijo H", "reference": { "type": "PubMed", "id": "9878560", "url": "https://pubmed.ncbi.nlm.nih.gov/9878560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBS0-1", "protein_name": "Ribosomal protein S6 kinase beta-2", "gene_name": "RPS6KB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBS0", "url": "https://www.uniprot.org/uniprotkb/Q9UBS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9878560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, characterization, and chromosome mapping of RPS6KC1, a novel putative member of the ribosome protein S6 kinase family, to chromosome 12q12-q13.1.", "journal": "Genomics", "date": "1999", "authors": "Zhang H, Yu L, Mao N, Fu Q, Tu Q, Gao J, Zhao S", "reference": { "type": "PubMed", "id": "10552933", "url": "https://pubmed.ncbi.nlm.nih.gov/10552933" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S38-1", "protein_name": "Inactive ribosomal protein S6 kinase delta-1", "gene_name": "RPS6KC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S38", "url": "https://www.uniprot.org/uniprotkb/Q96S38" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10552933", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of RPK118, a novel sphingosine kinase-1-binding protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hayashi S, Okada T, Igarashi N, Fujita T, Jahangeer S, Nakamura S", "reference": { "type": "PubMed", "id": "12077123", "url": "https://pubmed.ncbi.nlm.nih.gov/12077123" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S38-1", "protein_name": "Inactive ribosomal protein S6 kinase delta-1", "gene_name": "RPS6KC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CI15-1", "protein_name": "Sphingosine kinase 1", "gene_name": "Sphk1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S38", "url": "https://www.uniprot.org/uniprotkb/Q96S38" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12077123", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RPK118, a PX domain-containing protein, interacts with peroxiredoxin-3 through pseudo-kinase domains.", "journal": "Molecules and cells", "date": "2005", "authors": "Liu L, Yang C, Yuan J, Chen X, Xu J, Wei Y, Yang J, Lin G, Yu L", "reference": { "type": "PubMed", "id": "15750338", "url": "https://pubmed.ncbi.nlm.nih.gov/15750338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S38-1", "protein_name": "Inactive ribosomal protein S6 kinase delta-1", "gene_name": "RPS6KC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30048-1", "protein_name": "Thioredoxin-dependent peroxide reductase, mitochondrial", "gene_name": "PRDX3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S38", "url": "https://www.uniprot.org/uniprotkb/Q96S38" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15750338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bi-allelic variants in the ribosomal protein RPS6KC1 cause a complex neurodevelopmental disorder.", "journal": "American journal of human genetics", "date": "2025-11-06", "authors": "Planas-Serra Laura, Rodr\u00edguez-Ruiz Mar, Anderson Eric Nathaniel, Rodr\u00edguez-Palmero Agust\u00ed, V\u00e9lez-Santamaria Valentina, Schl\u00fcter Agatha, Verdura Edgard, Gere\u00f1u Gorka, Jim\u00e9nez-Z\u00fa\u00f1iga Andr\u00e9s, I\u00f1a\u00f1ez Alejandro, Casas Josefina, Bech Joan Josep, De La Torre Carolina, Mart\u00ednez Juan Jos\u00e9, Ruiz Montserrat, Fourcade St\u00e9phane, Iascone Maria, Tenconi Romano, Meier Kolja, Diegmann Susann, Lee Reagan H C, Beland Bakht, Mir Asif, Darvish Hossein, Chung Wendy, Karimiani Ehsan Ghayoor, Leal Suzanne M, Schrauwen Isabelle, \u00d6hman Susanna, J\u00e4rvel\u00e4 Irma, Granvik Johanna, Reinson Karit, Kurvinen Elvira, \u00d5unap Katrin, Schwan Annemarie, Platzer Konrad, Kalayci Tu\u011fba, Sharifi Shahrashoub, Korenke G Christoph, Houlden Henry, Maroofian Reza, L\u00f3pez de Muna\u00edn Adolfo, Casasnovas Carlos, Pandey Udai Bhan, Pujol Aurora", "reference": { "type": "PubMed", "id": "41130203", "url": "https://pubmed.ncbi.nlm.nih.gov/41130203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S38-1", "protein_name": "Inactive ribosomal protein S6 kinase delta-1", "gene_name": "RPS6KC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S38", "url": "https://www.uniprot.org/uniprotkb/Q96S38" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.41130203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel mutations in Rsk-2, the gene for Coffin-Lowry syndrome (CLS).", "journal": "European journal of human genetics : EJHG", "date": "1999", "authors": "Abidi F, Jacquot S, Lassiter C, Trivier E, Hanauer A, Schwartz CE", "reference": { "type": "PubMed", "id": "10094187", "url": "https://pubmed.ncbi.nlm.nih.gov/10094187" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10094187", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A missense mutation in RPS6KA3 (RSK2) responsible for non-specific mental retardation.", "journal": "Nature genetics", "date": "1999", "authors": "Merienne K, Jacquot S, Pannetier S, Zeniou M, Bankier A, Gecz J, Mandel JL, Mulley J, Sassone-Corsi P, Hanauer A", "reference": { "type": "PubMed", "id": "10319851", "url": "https://pubmed.ncbi.nlm.nih.gov/10319851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10319851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement of Rsk-2 for epidermal growth factor-activated phosphorylation of histone H3.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Sassone-Corsi P, Mizzen CA, Cheung P, Crosio C, Monaco L, Jacquot S, Hanauer A, Allis CD", "reference": { "type": "PubMed", "id": "10436156", "url": "https://pubmed.ncbi.nlm.nih.gov/10436156" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "P84243", "url": "https://www.uniprot.org/uniprotkb/P84243" }, { "database": "iPTMnet", "id": "P84243", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P84243" }, { "database": "PubMed", "id": "10911986", "url": "https://pubmed.ncbi.nlm.nih.gov/10911986" }, { "database": "PubMed", "id": "11562345", "url": "https://pubmed.ncbi.nlm.nih.gov/11562345" }, { "database": "PubMed", "id": "12529330", "url": "https://pubmed.ncbi.nlm.nih.gov/12529330" }, { "database": "PubMed", "id": "12773393", "url": "https://pubmed.ncbi.nlm.nih.gov/12773393" }, { "database": "PRO", "id": "P84243", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P84243" }, { "database": "PubMed", "id": "10436156", "url": "https://pubmed.ncbi.nlm.nih.gov/10436156" }, { "database": "PubMed", "id": "12677454", "url": "https://pubmed.ncbi.nlm.nih.gov/12677454" }, { "database": "PubMed", "id": "14583461", "url": "https://pubmed.ncbi.nlm.nih.gov/14583461" }, { "database": "PubMed", "id": "16651411", "url": "https://pubmed.ncbi.nlm.nih.gov/16651411" }, { "database": "PubMed", "id": "18256527", "url": "https://pubmed.ncbi.nlm.nih.gov/18256527" }, { "database": "PubMed", "id": "10464286", "url": "https://pubmed.ncbi.nlm.nih.gov/10464286" }, { "database": "PubMed", "id": "11856369", "url": "https://pubmed.ncbi.nlm.nih.gov/11856369" }, { "database": "PubMed", "id": "12560483", "url": "https://pubmed.ncbi.nlm.nih.gov/12560483" }, { "database": "PubMed", "id": "15681610", "url": "https://pubmed.ncbi.nlm.nih.gov/15681610" }, { "database": "PubMed", "id": "15851689", "url": "https://pubmed.ncbi.nlm.nih.gov/15851689" }, { "database": "PubMed", "id": "16185088", "url": "https://pubmed.ncbi.nlm.nih.gov/16185088" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "P84243-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q16695", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q16695" }, { "database": "PubMed", "id": "10436156", "url": "https://pubmed.ncbi.nlm.nih.gov/10436156" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "Q16695-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "P68431", "url": "https://www.uniprot.org/uniprotkb/P68431" }, { "database": "PRO", "id": "P68431", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P68431" }, { "database": "iPTMnet", "id": "P68431", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P68431" }, { "database": "PubMed", "id": "10436156", "url": "https://pubmed.ncbi.nlm.nih.gov/10436156" }, { "database": "PubMed", "id": "12677454", "url": "https://pubmed.ncbi.nlm.nih.gov/12677454" }, { "database": "PubMed", "id": "14583461", "url": "https://pubmed.ncbi.nlm.nih.gov/14583461" }, { "database": "PubMed", "id": "16651411", "url": "https://pubmed.ncbi.nlm.nih.gov/16651411" }, { "database": "PubMed", "id": "18256527", "url": "https://pubmed.ncbi.nlm.nih.gov/18256527" }, { "database": "PubMed", "id": "10464286", "url": "https://pubmed.ncbi.nlm.nih.gov/10464286" }, { "database": "PubMed", "id": "11856369", "url": "https://pubmed.ncbi.nlm.nih.gov/11856369" }, { "database": "PubMed", "id": "12560483", "url": "https://pubmed.ncbi.nlm.nih.gov/12560483" }, { "database": "PubMed", "id": "15681610", "url": "https://pubmed.ncbi.nlm.nih.gov/15681610" }, { "database": "PubMed", "id": "16185088", "url": "https://pubmed.ncbi.nlm.nih.gov/16185088" }, { "database": "PubMed", "id": "16457588", "url": "https://pubmed.ncbi.nlm.nih.gov/16457588" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "P68431-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "Q71DI3", "url": "https://www.uniprot.org/uniprotkb/Q71DI3" }, { "database": "PRO", "id": "Q71DI3", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q71DI3" }, { "database": "iPTMnet", "id": "Q71DI3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q71DI3" }, { "database": "PubMed", "id": "10436156", "url": "https://pubmed.ncbi.nlm.nih.gov/10436156" }, { "database": "PubMed", "id": "12677454", "url": "https://pubmed.ncbi.nlm.nih.gov/12677454" }, { "database": "PubMed", "id": "14583461", "url": "https://pubmed.ncbi.nlm.nih.gov/14583461" }, { "database": "PubMed", "id": "16651411", "url": "https://pubmed.ncbi.nlm.nih.gov/16651411" }, { "database": "PubMed", "id": "18256527", "url": "https://pubmed.ncbi.nlm.nih.gov/18256527" }, { "database": "PubMed", "id": "10464286", "url": "https://pubmed.ncbi.nlm.nih.gov/10464286" }, { "database": "PubMed", "id": "11856369", "url": "https://pubmed.ncbi.nlm.nih.gov/11856369" }, { "database": "PubMed", "id": "12560483", "url": "https://pubmed.ncbi.nlm.nih.gov/12560483" }, { "database": "PubMed", "id": "15681610", "url": "https://pubmed.ncbi.nlm.nih.gov/15681610" }, { "database": "PubMed", "id": "16185088", "url": "https://pubmed.ncbi.nlm.nih.gov/16185088" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "Q71DI3-1" } ], "record_id": "pubmed.10436156", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unreported RSK2 missense mutation in two male sibs with an unusually mild form of Coffin-Lowry syndrome.", "journal": "Journal of medical genetics", "date": "1999", "authors": "Manouvrier-Hanu S, Amiel J, Jacquot S, Merienne K, Moerman A, Coeslier A, Labarriere F, Vallee L, Croquette MF, Hanauer A", "reference": { "type": "PubMed", "id": "10528858", "url": "https://pubmed.ncbi.nlm.nih.gov/10528858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10528858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of RSK by UV-light: phosphorylation dynamics and involvement of the MAPK pathway.", "journal": "Oncogene", "date": "2000", "authors": "Merienne K, Jacquot S, Zeniou M, Pannetier S, Sassone-Corsi P, Hanauer A", "reference": { "type": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "IEDB", "id": "P51812", "url": "https://www.iedb.org/epitope/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "29493099", "url": "https://pubmed.ncbi.nlm.nih.gov/29493099" }, { "database": "PRO", "id": "P51812", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P51812" }, { "database": "PubMed", "id": "10856237", "url": "https://pubmed.ncbi.nlm.nih.gov/10856237" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, { "database": "PubMed", "id": "11564891", "url": "https://pubmed.ncbi.nlm.nih.gov/11564891" }, { "database": "PubMed", "id": "17225856", "url": "https://pubmed.ncbi.nlm.nih.gov/17225856" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "31382504", "url": "https://pubmed.ncbi.nlm.nih.gov/31382504" }, { "database": "PubMed", "id": "31953410", "url": "https://pubmed.ncbi.nlm.nih.gov/31953410" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 577, "end_pos": 577, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" } ], "site_lbl": "Thr577", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 577, "end_pos": 577, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "PRO", "id": "P51812", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "29279389", "url": "https://pubmed.ncbi.nlm.nih.gov/29279389" } ], "site_lbl": "Thr577", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.10980595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cognitive impairment in Coffin-Lowry syndrome correlates with reduced RSK2 activation.", "journal": "Neurology", "date": "2001", "authors": "Harum KH, Alemi L, Johnston MV", "reference": { "type": "PubMed", "id": "11160957", "url": "https://pubmed.ncbi.nlm.nih.gov/11160957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15349-1", "protein_name": "Ribosomal protein S6 kinase alpha-2", "gene_name": "RPS6KA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK32-1", "protein_name": "Ribosomal protein S6 kinase alpha-6", "gene_name": "RPS6KA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11160957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitogen-regulated RSK2-CBP interaction controls their kinase and acetylase activities.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Merienne K, Pannetier S, Harel-Bellan A, Sassone-Corsi P", "reference": { "type": "PubMed", "id": "11564891", "url": "https://pubmed.ncbi.nlm.nih.gov/11564891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "IEDB", "id": "P51812", "url": "https://www.iedb.org/epitope/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "29493099", "url": "https://pubmed.ncbi.nlm.nih.gov/29493099" }, { "database": "PRO", "id": "P51812", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P51812" }, { "database": "PubMed", "id": "10856237", "url": "https://pubmed.ncbi.nlm.nih.gov/10856237" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, { "database": "PubMed", "id": "11564891", "url": "https://pubmed.ncbi.nlm.nih.gov/11564891" }, { "database": "PubMed", "id": "17225856", "url": "https://pubmed.ncbi.nlm.nih.gov/17225856" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "31382504", "url": "https://pubmed.ncbi.nlm.nih.gov/31382504" }, { "database": "PubMed", "id": "31953410", "url": "https://pubmed.ncbi.nlm.nih.gov/31953410" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.11564891", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stimulation of endothelin B receptors in astrocytes induces cAMP response element-binding protein phosphorylation and c-fos expression via multiple mitogen-activated protein kinase signaling pathways.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2001", "authors": "Schinelli S, Zanassi P, Paolillo M, Wang H, Feliciello A, Gallo V", "reference": { "type": "PubMed", "id": "11698596", "url": "https://pubmed.ncbi.nlm.nih.gov/11698596" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15349-1", "protein_name": "Ribosomal protein S6 kinase alpha-2", "gene_name": "RPS6KA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK32-1", "protein_name": "Ribosomal protein S6 kinase alpha-6", "gene_name": "RPS6KA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11698596", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of MUC8 gene expression by interleukin-1 beta is mediated by a sequential ERK MAPK/RSK1/CREB cascade pathway in human airway epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Song KS, Seong JK, Chung KC, Lee WJ, Kim CH, Cho KN, Kang CD, Koo JS, Yoon JH", "reference": { "type": "PubMed", "id": "12842905", "url": "https://pubmed.ncbi.nlm.nih.gov/12842905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15349-1", "protein_name": "Ribosomal protein S6 kinase alpha-2", "gene_name": "RPS6KA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK32-1", "protein_name": "Ribosomal protein S6 kinase alpha-6", "gene_name": "RPS6KA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12842905", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intronic L1 insertion and F268S, novel mutations in RPS6KA3 (RSK2) causing Coffin-Lowry syndrome.", "journal": "Clinical genetics", "date": "2003", "authors": "Martinez-Garay I, Ballesta MJ, Oltra S, Orellana C, Palomeque A, Molto MD, Prieto F, Martinez F", "reference": { "type": "PubMed", "id": "14986828", "url": "https://pubmed.ncbi.nlm.nih.gov/14986828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14986828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cardiomyopathy in Coffin-Lowry syndrome.", "journal": "American journal of medical genetics. Part A", "date": "2004", "authors": "Facher JJ, Regier EJ, Jacobs GH, Siwik E, Delaunoy JP, Robin NH", "reference": { "type": "PubMed", "id": "15214012", "url": "https://pubmed.ncbi.nlm.nih.gov/15214012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15214012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tumor suppressor DAP kinase is a target of RSK-mediated survival signaling.", "journal": "Current biology : CB", "date": "2005", "authors": "Anjum R, Roux PP, Ballif BA, Gygi SP, Blenis J", "reference": { "type": "PubMed", "id": "16213824", "url": "https://pubmed.ncbi.nlm.nih.gov/16213824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53355-1", "protein_name": "Death-associated protein kinase 1", "gene_name": "DAPK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53355" }, { "database": "PubMed", "id": "16213824", "url": "https://pubmed.ncbi.nlm.nih.gov/16213824" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "P53355-1" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53355" }, { "database": "PubMed", "id": "16213824", "url": "https://pubmed.ncbi.nlm.nih.gov/16213824" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "P53355-1" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1 and RPS6KA3", "evidence": [ { "database": "UniProtKB", "id": "P53355", "url": "https://www.uniprot.org/uniprotkb/P53355" }, { "database": "iPTMnet", "id": "P53355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53355" }, { "database": "PubMed", "id": "16213824", "url": "https://pubmed.ncbi.nlm.nih.gov/16213824" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "P53355-1" } ], "record_id": "pubmed.16213824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nur77 is phosphorylated in cells by RSK in response to mitogenic stimulation.", "journal": "The Biochemical journal", "date": "2006", "authors": "Wingate AD, Campbell DG, Peggie M, Arthur JS", "reference": { "type": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92570-1", "protein_name": "Nuclear receptor subfamily 4 group A member 3", "gene_name": "NR4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22736-1", "protein_name": "Nuclear receptor subfamily 4immunitygroup A member 1", "gene_name": "NR4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43354-1", "protein_name": "Nuclear receptor subfamily 4 group A member 2", "gene_name": "NR4A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92570", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92570" }, { "database": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" } ], "site_lbl": "Ser354", "uniprot_canonical_ac": "Q92570-1" }, { "start_pos": 376, "end_pos": 376, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92570", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92570" }, { "database": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" } ], "site_lbl": "Ser376", "uniprot_canonical_ac": "Q92570-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "O75582-1", "kinase_gene_name": "RPS6KA5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22736" }, { "database": "PubMed", "id": "11274386", "url": "https://pubmed.ncbi.nlm.nih.gov/11274386" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P22736-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22736" }, { "database": "PubMed", "id": "11274386", "url": "https://pubmed.ncbi.nlm.nih.gov/11274386" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P22736-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22736" }, { "database": "PubMed", "id": "11274386", "url": "https://pubmed.ncbi.nlm.nih.gov/11274386" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P22736-1" }, { "start_pos": 347, "end_pos": 347, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43354", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43354" }, { "database": "PubMed", "id": "16223362", "url": "https://pubmed.ncbi.nlm.nih.gov/16223362" } ], "site_lbl": "Ser347", "uniprot_canonical_ac": "P43354-1" } ], "record_id": "pubmed.16223362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the RSK2(RPS6KA3) gene cause Coffin-Lowry syndrome and nonsyndromic X-linked mental retardation.", "journal": "Clinical genetics", "date": "2006", "authors": "Field M, Tarpey P, Boyle J, Edkins S, Goodship J, Luo Y, Moon J, Teague J, Stratton MR, Futreal PA, Wooster R, Raymond FL, Turner G", "reference": { "type": "PubMed", "id": "17100996", "url": "https://pubmed.ncbi.nlm.nih.gov/17100996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17100996", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RSK2 mediates muscle cell differentiation through regulation of NFAT3.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Cho YY, Yao K, Bode AM, Bergen HR 3rd, Madden BJ, Oh SM, Ermakova S, Kang BS, Choi HS, Shim JH, Dong Z", "reference": { "type": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14934-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 4", "gene_name": "NFATC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K120-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 4", "gene_name": "Nfatc4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA3", "evidence": [ { "database": "UniProtKB", "id": "Q14934", "url": "https://www.uniprot.org/uniprotkb/Q14934" }, { "database": "iPTMnet", "id": "Q14934", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14934" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "Q14934-1" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA3", "evidence": [ { "database": "UniProtKB", "id": "Q14934", "url": "https://www.uniprot.org/uniprotkb/Q14934" }, { "database": "iPTMnet", "id": "Q14934", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14934" }, { "database": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" } ], "site_lbl": "Ser344", "uniprot_canonical_ac": "Q14934-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "P18654-1", "kinase_gene_name": "Rps6ka3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8K120", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8K120" }, { "database": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" } ], "site_lbl": "Ser281", "uniprot_canonical_ac": "Q8K120-1" }, { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "P18654-1", "kinase_gene_name": "Rps6ka3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8K120", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8K120" }, { "database": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" } ], "site_lbl": "Ser285", "uniprot_canonical_ac": "Q8K120-1" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "P18654-1", "kinase_gene_name": "Rps6ka3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8K120", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8K120" }, { "database": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "Q8K120-1" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "P18654-1", "kinase_gene_name": "Rps6ka3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8K120", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8K120" }, { "database": "PubMed", "id": "17213202", "url": "https://pubmed.ncbi.nlm.nih.gov/17213202" } ], "site_lbl": "Ser344", "uniprot_canonical_ac": "Q8K120-1" } ], "record_id": "pubmed.17213202", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recruitment and activation of RSK2 by HIV-1 Tat.", "journal": "PloS one", "date": "2007", "authors": "Hetzer C, Bisgrove D, Cohen MS, Pedal A, Kaehlcke K, Speyerer A, Bartscherer K, Taunton J, Ott M", "reference": { "type": "PubMed", "id": "17225856", "url": "https://pubmed.ncbi.nlm.nih.gov/17225856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "IEDB", "id": "P51812", "url": "https://www.iedb.org/epitope/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "29493099", "url": "https://pubmed.ncbi.nlm.nih.gov/29493099" }, { "database": "PRO", "id": "P51812", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P51812" }, { "database": "PubMed", "id": "10856237", "url": "https://pubmed.ncbi.nlm.nih.gov/10856237" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, { "database": "PubMed", "id": "11564891", "url": "https://pubmed.ncbi.nlm.nih.gov/11564891" }, { "database": "PubMed", "id": "17225856", "url": "https://pubmed.ncbi.nlm.nih.gov/17225856" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "31382504", "url": "https://pubmed.ncbi.nlm.nih.gov/31382504" }, { "database": "PubMed", "id": "31953410", "url": "https://pubmed.ncbi.nlm.nih.gov/31953410" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.17225856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RAS/ERK signaling promotes site-specific ribosomal protein S6 phosphorylation via RSK and stimulates cap-dependent translation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Roux PP, Shahbazian D, Vu H, Holz MK, Cohen MS, Taunton J, Sonenberg N, Blenis J", "reference": { "type": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22736-1", "protein_name": "Nuclear receptor subfamily 4immunitygroup A member 1", "gene_name": "NR4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62753-1", "protein_name": "Small ribosomal subunit protein eS6", "gene_name": "RPS6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P22736", "url": "https://www.uniprot.org/uniprotkb/P22736" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "iPTMnet", "id": "P22736", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22736" }, { "database": "PubMed", "id": "14525795", "url": "https://pubmed.ncbi.nlm.nih.gov/14525795" }, { "database": "PubMed", "id": "16434970", "url": "https://pubmed.ncbi.nlm.nih.gov/16434970" }, { "database": "PubMed", "id": "33235235", "url": "https://pubmed.ncbi.nlm.nih.gov/33235235" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P22736-1" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62753", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62753" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" } ], "site_lbl": "Ser235", "uniprot_canonical_ac": "P62753-1" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62753", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62753" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" } ], "site_lbl": "Ser235", "uniprot_canonical_ac": "P62753-1" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1, RPS6KA3, DAPK1 and PASK", "evidence": [ { "database": "UniProtKB", "id": "P62753", "url": "https://www.uniprot.org/uniprotkb/P62753" }, { "database": "iPTMnet", "id": "P62753", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62753" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "17322306", "url": "https://pubmed.ncbi.nlm.nih.gov/17322306" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "IntAct", "id": "P62753", "url": "https://www.ebi.ac.uk/intact/interactors/id:P62753*" }, { "database": "PubMed", "id": "21418524", "url": "https://pubmed.ncbi.nlm.nih.gov/21418524" }, { "database": "PRO", "id": "P62753", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P62753" }, { "database": "PubMed", "id": "15956968", "url": "https://pubmed.ncbi.nlm.nih.gov/15956968" }, { "database": "PubMed", "id": "19376132", "url": "https://pubmed.ncbi.nlm.nih.gov/19376132" }, { "database": "PubMed", "id": "20460585", "url": "https://pubmed.ncbi.nlm.nih.gov/20460585" }, { "database": "PubMed", "id": "21437771", "url": "https://pubmed.ncbi.nlm.nih.gov/21437771" }, { "database": "PubMed", "id": "23974852", "url": "https://pubmed.ncbi.nlm.nih.gov/23974852" }, { "database": "PubMed", "id": "24072592", "url": "https://pubmed.ncbi.nlm.nih.gov/24072592" }, { "database": "PubMed", "id": "25993328", "url": "https://pubmed.ncbi.nlm.nih.gov/25993328" }, { "database": "PubMed", "id": "26490682", "url": "https://pubmed.ncbi.nlm.nih.gov/26490682" }, { "database": "PubMed", "id": "27487136", "url": "https://pubmed.ncbi.nlm.nih.gov/27487136" }, { "database": "PubMed", "id": "28247844", "url": "https://pubmed.ncbi.nlm.nih.gov/28247844" }, { "database": "PubMed", "id": "28603468", "url": "https://pubmed.ncbi.nlm.nih.gov/28603468" }, { "database": "PubMed", "id": "29487290", "url": "https://pubmed.ncbi.nlm.nih.gov/29487290" }, { "database": "PubMed", "id": "30698812", "url": "https://pubmed.ncbi.nlm.nih.gov/30698812" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "33149163", "url": "https://pubmed.ncbi.nlm.nih.gov/33149163" }, { "database": "PubMed", "id": "33371356", "url": "https://pubmed.ncbi.nlm.nih.gov/33371356" }, { "database": "PubMed", "id": "18974095", "url": "https://pubmed.ncbi.nlm.nih.gov/18974095" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" } ], "site_lbl": "Ser235", "uniprot_canonical_ac": "P62753-1" }, { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62753", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62753" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" } ], "site_lbl": "Ser236", "uniprot_canonical_ac": "P62753-1" }, { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62753", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62753" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" } ], "site_lbl": "Ser236", "uniprot_canonical_ac": "P62753-1" }, { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1, RPS6KA3, DAPK1 and PASK", "evidence": [ { "database": "UniProtKB", "id": "P62753", "url": "https://www.uniprot.org/uniprotkb/P62753" }, { "database": "iPTMnet", "id": "P62753", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62753" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "17322306", "url": "https://pubmed.ncbi.nlm.nih.gov/17322306" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "IntAct", "id": "P62753", "url": "https://www.ebi.ac.uk/intact/interactors/id:P62753*" }, { "database": "PubMed", "id": "21418524", "url": "https://pubmed.ncbi.nlm.nih.gov/21418524" }, { "database": "PRO", "id": "P62753", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P62753" }, { "database": "PubMed", "id": "15956968", "url": "https://pubmed.ncbi.nlm.nih.gov/15956968" }, { "database": "PubMed", "id": "19376132", "url": "https://pubmed.ncbi.nlm.nih.gov/19376132" }, { "database": "PubMed", "id": "20460585", "url": "https://pubmed.ncbi.nlm.nih.gov/20460585" }, { "database": "PubMed", "id": "21437771", "url": "https://pubmed.ncbi.nlm.nih.gov/21437771" }, { "database": "PubMed", "id": "23974852", "url": "https://pubmed.ncbi.nlm.nih.gov/23974852" }, { "database": "PubMed", "id": "24072592", "url": "https://pubmed.ncbi.nlm.nih.gov/24072592" }, { "database": "PubMed", "id": "25993328", "url": "https://pubmed.ncbi.nlm.nih.gov/25993328" }, { "database": "PubMed", "id": "26490682", "url": "https://pubmed.ncbi.nlm.nih.gov/26490682" }, { "database": "PubMed", "id": "27487136", "url": "https://pubmed.ncbi.nlm.nih.gov/27487136" }, { "database": "PubMed", "id": "28247844", "url": "https://pubmed.ncbi.nlm.nih.gov/28247844" }, { "database": "PubMed", "id": "28603468", "url": "https://pubmed.ncbi.nlm.nih.gov/28603468" }, { "database": "PubMed", "id": "29487290", "url": "https://pubmed.ncbi.nlm.nih.gov/29487290" }, { "database": "PubMed", "id": "30698812", "url": "https://pubmed.ncbi.nlm.nih.gov/30698812" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "33149163", "url": "https://pubmed.ncbi.nlm.nih.gov/33149163" }, { "database": "PubMed", "id": "33371356", "url": "https://pubmed.ncbi.nlm.nih.gov/33371356" }, { "database": "PubMed", "id": "18974095", "url": "https://pubmed.ncbi.nlm.nih.gov/18974095" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "17360704", "url": "https://pubmed.ncbi.nlm.nih.gov/17360704" } ], "site_lbl": "Ser236", "uniprot_canonical_ac": "P62753-1" } ], "record_id": "pubmed.17360704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New insights into RSK activation and hematopoietic cancer.", "journal": "Cancer cell", "date": "2007", "authors": "Cuadrado A, Nebreda AR", "reference": { "type": "PubMed", "id": "17785199", "url": "https://pubmed.ncbi.nlm.nih.gov/17785199" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FGFR3", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "17785199", "url": "https://pubmed.ncbi.nlm.nih.gov/17785199" }, { "database": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" }, { "database": "PubMed", "id": "25014166", "url": "https://pubmed.ncbi.nlm.nih.gov/25014166" } ], "site_lbl": "Tyr529", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.17785199", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epidermal growth factor stimulates RSK2 activation through activation of the MEK/ERK pathway and src-dependent tyrosine phosphorylation of RSK2 at Tyr-529.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kang S, Dong S, Guo A, Ruan H, Lonial S, Khoury HJ, Gu TL, Chen J", "reference": { "type": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 488, "end_pos": 488, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" } ], "site_lbl": "Tyr488", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" } ], "site_lbl": "Tyr529", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" } ], "site_lbl": "Tyr529", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FGFR3", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "17785199", "url": "https://pubmed.ncbi.nlm.nih.gov/17785199" }, { "database": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" }, { "database": "PubMed", "id": "25014166", "url": "https://pubmed.ncbi.nlm.nih.gov/25014166" } ], "site_lbl": "Tyr529", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.18156174", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RSK factors of activating the Ras/MAPK signaling cascade.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2008-05-01", "authors": "Carriere Audrey, Ray Hind, Blenis John, Roux Philippe P", "reference": { "type": "PubMed", "id": "18508509", "url": "https://pubmed.ncbi.nlm.nih.gov/18508509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18508509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncogenic MAPK signaling stimulates mTORC1 activity by promoting RSK-mediated raptor phosphorylation.", "journal": "Current biology : CB", "date": "2008", "authors": "Carriere A, Cargnello M, Julien LA, Gao H, Bonneil E, Thibault P, Roux PP", "reference": { "type": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N122-1", "protein_name": "Regulatory-associated protein of mTOR", "gene_name": "RPTOR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 719, "end_pos": 719, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser719", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 719, "end_pos": 719, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser719", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 719, "end_pos": 719, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1", "evidence": [ { "database": "UniProtKB", "id": "Q8N122", "url": "https://www.uniprot.org/uniprotkb/Q8N122" }, { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser719", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 721, "end_pos": 721, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser721", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 721, "end_pos": 721, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser721", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 721, "end_pos": 721, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1", "evidence": [ { "database": "UniProtKB", "id": "Q8N122", "url": "https://www.uniprot.org/uniprotkb/Q8N122" }, { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser721", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 722, "end_pos": 722, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser722", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 722, "end_pos": 722, "kinase_uniprot_canonical_ac": "Q15418-1", "kinase_gene_name": "RPS6KA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" } ], "site_lbl": "Ser722", "uniprot_canonical_ac": "Q8N122-1" }, { "start_pos": 722, "end_pos": 722, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK and RPS6KA1", "evidence": [ { "database": "UniProtKB", "id": "Q8N122", "url": "https://www.uniprot.org/uniprotkb/Q8N122" }, { "database": "iPTMnet", "id": "Q8N122", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8N122" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "IEDB", "id": "Q8N122", "url": "https://www.iedb.org/epitope/Q8N122" }, { "database": "PubMed", "id": "27920218", "url": "https://pubmed.ncbi.nlm.nih.gov/27920218" }, { "database": "PubMed", "id": "18439900", "url": "https://pubmed.ncbi.nlm.nih.gov/18439900" }, { "database": "PRO", "id": "Q8N122", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q8N122" }, { "database": "PubMed", "id": "21325048", "url": "https://pubmed.ncbi.nlm.nih.gov/21325048" }, { "database": "PubMed", "id": "34604061", "url": "https://pubmed.ncbi.nlm.nih.gov/34604061" }, { "database": "PubMed", "id": "18722121", "url": "https://pubmed.ncbi.nlm.nih.gov/18722121" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "37541260", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" } ], "site_lbl": "Ser722", "uniprot_canonical_ac": "Q8N122-1" } ], "record_id": "pubmed.18722121", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fibroblast growth factor receptor 3 associates with and tyrosine phosphorylates p90 RSK2, leading to RSK2 activation that mediates hematopoietic transformation.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Kang S, Elf S, Dong S, Hitosugi T, Lythgoe K, Guo A, Ruan H, Lonial S, Khoury HJ, Williams IR, Lee BH, Roesel JL, Karsenty G, Hanauer A, Taunton J, Boggon TJ, Gu TL, Chen J", "reference": { "type": "PubMed", "id": "19223461", "url": "https://pubmed.ncbi.nlm.nih.gov/19223461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "17785202", "url": "https://pubmed.ncbi.nlm.nih.gov/17785202" }, { "database": "PubMed", "id": "19223461", "url": "https://pubmed.ncbi.nlm.nih.gov/19223461" } ], "site_lbl": "Tyr529", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 707, "end_pos": 707, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "19223461", "url": "https://pubmed.ncbi.nlm.nih.gov/19223461" } ], "site_lbl": "Tyr707", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.19223461", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ribosomal S6 Kinase 2 (RSK2) maintains genomic stability by activating the Atm/p53-dependent DNA damage pathway.", "journal": "PloS one", "date": "2013", "authors": "Lim HC, Xie L, Zhang W, Li R, Chen ZC, Wu GZ, Cui SS, Tan EK, Zeng L", "reference": { "type": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PDPK1", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "IEDB", "id": "P51812", "url": "https://www.iedb.org/epitope/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "29493099", "url": "https://pubmed.ncbi.nlm.nih.gov/29493099" }, { "database": "PRO", "id": "P51812", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P51812" }, { "database": "PubMed", "id": "10856237", "url": "https://pubmed.ncbi.nlm.nih.gov/10856237" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, { "database": "PubMed", "id": "11564891", "url": "https://pubmed.ncbi.nlm.nih.gov/11564891" }, { "database": "PubMed", "id": "17225856", "url": "https://pubmed.ncbi.nlm.nih.gov/17225856" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "31382504", "url": "https://pubmed.ncbi.nlm.nih.gov/31382504" }, { "database": "PubMed", "id": "31953410", "url": "https://pubmed.ncbi.nlm.nih.gov/31953410" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 577, "end_pos": 577, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "PRO", "id": "P51812", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "10980595", "url": "https://pubmed.ncbi.nlm.nih.gov/10980595" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "29279389", "url": "https://pubmed.ncbi.nlm.nih.gov/29279389" } ], "site_lbl": "Thr577", "uniprot_canonical_ac": "P51812-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 1981, "end_pos": 1981, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q13315", "url": "https://www.uniprot.org/uniprotkb/Q13315" }, { "database": "IntAct", "id": "Q13315", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13315*" }, { "database": "iPTMnet", "id": "Q13315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13315" }, { "database": "PubMed", "id": "19851285", "url": "https://pubmed.ncbi.nlm.nih.gov/19851285" }, { "database": "PubMed", "id": "16858402", "url": "https://pubmed.ncbi.nlm.nih.gov/16858402" }, { "database": "PRO", "id": "Q13315", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13315" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "12556884", "url": "https://pubmed.ncbi.nlm.nih.gov/12556884" }, { "database": "PubMed", "id": "14695167", "url": "https://pubmed.ncbi.nlm.nih.gov/14695167" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "15048089", "url": "https://pubmed.ncbi.nlm.nih.gov/15048089" }, { "database": "PubMed", "id": "15140942", "url": "https://pubmed.ncbi.nlm.nih.gov/15140942" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15177184", "url": "https://pubmed.ncbi.nlm.nih.gov/15177184" }, { "database": "PubMed", "id": "15269203", "url": "https://pubmed.ncbi.nlm.nih.gov/15269203" }, { "database": "PubMed", "id": "15313175", "url": "https://pubmed.ncbi.nlm.nih.gov/15313175" }, { "database": "PubMed", "id": "15314656", "url": "https://pubmed.ncbi.nlm.nih.gov/15314656" }, { "database": "PubMed", "id": "15489221", "url": "https://pubmed.ncbi.nlm.nih.gov/15489221" }, { "database": "PubMed", "id": "15510216", "url": "https://pubmed.ncbi.nlm.nih.gov/15510216" }, { "database": "PubMed", "id": "15846060", "url": "https://pubmed.ncbi.nlm.nih.gov/15846060" }, { "database": "PubMed", "id": "16293623", "url": "https://pubmed.ncbi.nlm.nih.gov/16293623" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16452482", "url": "https://pubmed.ncbi.nlm.nih.gov/16452482" }, { "database": "PubMed", "id": "16528719", "url": "https://pubmed.ncbi.nlm.nih.gov/16528719" }, { "database": "PubMed", "id": "16533058", "url": "https://pubmed.ncbi.nlm.nih.gov/16533058" }, { "database": "PubMed", "id": "16556909", "url": "https://pubmed.ncbi.nlm.nih.gov/16556909" }, { "database": "PubMed", "id": "16628011", "url": "https://pubmed.ncbi.nlm.nih.gov/16628011" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16861926", "url": "https://pubmed.ncbi.nlm.nih.gov/16861926" }, { "database": "PubMed", "id": "16906133", "url": "https://pubmed.ncbi.nlm.nih.gov/16906133" }, { "database": "PubMed", "id": "16940754", "url": "https://pubmed.ncbi.nlm.nih.gov/16940754" }, { "database": "PubMed", "id": "16997395", "url": "https://pubmed.ncbi.nlm.nih.gov/16997395" }, { "database": "PubMed", "id": "17016017", "url": "https://pubmed.ncbi.nlm.nih.gov/17016017" }, { "database": "PubMed", "id": "17124492", "url": "https://pubmed.ncbi.nlm.nih.gov/17124492" }, { "database": "PubMed", "id": "17406032", "url": "https://pubmed.ncbi.nlm.nih.gov/17406032" }, { "database": "PubMed", "id": "17486112", "url": "https://pubmed.ncbi.nlm.nih.gov/17486112" }, { "database": "PubMed", "id": "17638905", "url": "https://pubmed.ncbi.nlm.nih.gov/17638905" }, { "database": "PubMed", "id": "17700524", "url": "https://pubmed.ncbi.nlm.nih.gov/17700524" }, { "database": "PubMed", "id": "18048416", "url": "https://pubmed.ncbi.nlm.nih.gov/18048416" }, { "database": "PubMed", "id": "18059176", "url": "https://pubmed.ncbi.nlm.nih.gov/18059176" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18344987", "url": "https://pubmed.ncbi.nlm.nih.gov/18344987" }, { "database": "PubMed", "id": "18431490", "url": "https://pubmed.ncbi.nlm.nih.gov/18431490" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18571408", "url": "https://pubmed.ncbi.nlm.nih.gov/18571408" }, { "database": "PubMed", "id": "18593910", "url": "https://pubmed.ncbi.nlm.nih.gov/18593910" }, { "database": "PubMed", "id": "18596698", "url": "https://pubmed.ncbi.nlm.nih.gov/18596698" }, { "database": "PubMed", "id": "18619531", "url": "https://pubmed.ncbi.nlm.nih.gov/18619531" }, { "database": "PubMed", "id": "18663430", "url": "https://pubmed.ncbi.nlm.nih.gov/18663430" }, { "database": "PubMed", "id": "18762365", "url": "https://pubmed.ncbi.nlm.nih.gov/18762365" }, { "database": "PubMed", "id": "18959818", "url": "https://pubmed.ncbi.nlm.nih.gov/18959818" }, { "database": "PubMed", "id": "18985806", "url": "https://pubmed.ncbi.nlm.nih.gov/18985806" }, { "database": "PubMed", "id": "19401701", "url": "https://pubmed.ncbi.nlm.nih.gov/19401701" }, { "database": "PubMed", "id": "19411853", "url": "https://pubmed.ncbi.nlm.nih.gov/19411853" }, { "database": "PubMed", "id": "19451263", "url": "https://pubmed.ncbi.nlm.nih.gov/19451263" }, { "database": "PubMed", "id": "19605351", "url": "https://pubmed.ncbi.nlm.nih.gov/19605351" }, { "database": "PubMed", "id": "19621083", "url": "https://pubmed.ncbi.nlm.nih.gov/19621083" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19671522", "url": "https://pubmed.ncbi.nlm.nih.gov/19671522" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19798429", "url": "https://pubmed.ncbi.nlm.nih.gov/19798429" }, { "database": "PubMed", "id": "20014310", "url": "https://pubmed.ncbi.nlm.nih.gov/20014310" }, { "database": "PubMed", "id": "20126263", "url": "https://pubmed.ncbi.nlm.nih.gov/20126263" }, { "database": "PubMed", "id": "20205745", "url": "https://pubmed.ncbi.nlm.nih.gov/20205745" }, { "database": "PubMed", "id": "20660628", "url": "https://pubmed.ncbi.nlm.nih.gov/20660628" }, { "database": "PubMed", "id": "20678255", "url": "https://pubmed.ncbi.nlm.nih.gov/20678255" }, { "database": "PubMed", "id": "20700484", "url": "https://pubmed.ncbi.nlm.nih.gov/20700484" }, { "database": "PubMed", "id": "20711462", "url": "https://pubmed.ncbi.nlm.nih.gov/20711462" }, { "database": "PubMed", "id": "20959117", "url": "https://pubmed.ncbi.nlm.nih.gov/20959117" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "20978201", "url": "https://pubmed.ncbi.nlm.nih.gov/20978201" }, { "database": "PubMed", "id": "21078189", "url": "https://pubmed.ncbi.nlm.nih.gov/21078189" }, { "database": "PubMed", "id": "21157431", "url": "https://pubmed.ncbi.nlm.nih.gov/21157431" }, { "database": "PubMed", "id": "21219611", "url": "https://pubmed.ncbi.nlm.nih.gov/21219611" }, { "database": "PubMed", "id": "21292467", "url": "https://pubmed.ncbi.nlm.nih.gov/21292467" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21824286", "url": "https://pubmed.ncbi.nlm.nih.gov/21824286" }, { "database": "PubMed", "id": "21997193", "url": "https://pubmed.ncbi.nlm.nih.gov/21997193" }, { "database": "PubMed", "id": "22323184", "url": "https://pubmed.ncbi.nlm.nih.gov/22323184" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22493319", "url": "https://pubmed.ncbi.nlm.nih.gov/22493319" }, { "database": "PubMed", "id": "22498490", "url": "https://pubmed.ncbi.nlm.nih.gov/22498490" }, { "database": "PubMed", "id": "22655027", "url": "https://pubmed.ncbi.nlm.nih.gov/22655027" }, { "database": "PubMed", "id": "22739265", "url": "https://pubmed.ncbi.nlm.nih.gov/22739265" }, { "database": "PubMed", "id": "22761798", "url": "https://pubmed.ncbi.nlm.nih.gov/22761798" }, { "database": "PubMed", "id": "22837425", "url": "https://pubmed.ncbi.nlm.nih.gov/22837425" }, { "database": "PubMed", "id": "22841545", "url": "https://pubmed.ncbi.nlm.nih.gov/22841545" }, { "database": "PubMed", "id": "22952040", "url": "https://pubmed.ncbi.nlm.nih.gov/22952040" }, { "database": "PubMed", "id": "23146902", "url": "https://pubmed.ncbi.nlm.nih.gov/23146902" }, { "database": "PubMed", "id": "23166842", "url": "https://pubmed.ncbi.nlm.nih.gov/23166842" }, { "database": "PubMed", "id": "23185347", "url": "https://pubmed.ncbi.nlm.nih.gov/23185347" }, { "database": "PubMed", "id": "23193277", "url": "https://pubmed.ncbi.nlm.nih.gov/23193277" }, { "database": "PubMed", "id": "23365634", "url": "https://pubmed.ncbi.nlm.nih.gov/23365634" }, { "database": "PubMed", "id": "23383259", "url": "https://pubmed.ncbi.nlm.nih.gov/23383259" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23552604", "url": "https://pubmed.ncbi.nlm.nih.gov/23552604" }, { "database": "PubMed", "id": "23620287", "url": "https://pubmed.ncbi.nlm.nih.gov/23620287" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23900392", "url": "https://pubmed.ncbi.nlm.nih.gov/23900392" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24113180", "url": "https://pubmed.ncbi.nlm.nih.gov/24113180" }, { "database": "PubMed", "id": "24268576", "url": "https://pubmed.ncbi.nlm.nih.gov/24268576" }, { "database": "PubMed", "id": "24280901", "url": "https://pubmed.ncbi.nlm.nih.gov/24280901" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24763056", "url": "https://pubmed.ncbi.nlm.nih.gov/24763056" }, { "database": "PubMed", "id": "24812435", "url": "https://pubmed.ncbi.nlm.nih.gov/24812435" }, { "database": "PubMed", "id": "24933654", "url": "https://pubmed.ncbi.nlm.nih.gov/24933654" }, { "database": "PubMed", "id": "24988892", "url": "https://pubmed.ncbi.nlm.nih.gov/24988892" }, { "database": "PubMed", "id": "25003995", "url": "https://pubmed.ncbi.nlm.nih.gov/25003995" }, { "database": "PubMed", "id": "25077176", "url": "https://pubmed.ncbi.nlm.nih.gov/25077176" }, { "database": "PubMed", "id": "25088203", "url": "https://pubmed.ncbi.nlm.nih.gov/25088203" }, { "database": "PubMed", "id": "25111195", "url": "https://pubmed.ncbi.nlm.nih.gov/25111195" }, { "database": "PubMed", "id": "25240135", "url": "https://pubmed.ncbi.nlm.nih.gov/25240135" }, { "database": "PubMed", "id": "25527123", "url": "https://pubmed.ncbi.nlm.nih.gov/25527123" }, { "database": "PubMed", "id": "25611382", "url": "https://pubmed.ncbi.nlm.nih.gov/25611382" }, { "database": "PubMed", "id": "25821946", "url": "https://pubmed.ncbi.nlm.nih.gov/25821946" }, { "database": "PubMed", "id": "25826455", "url": "https://pubmed.ncbi.nlm.nih.gov/25826455" }, { "database": "PubMed", "id": "25865756", "url": "https://pubmed.ncbi.nlm.nih.gov/25865756" }, { "database": "PubMed", "id": "25904696", "url": "https://pubmed.ncbi.nlm.nih.gov/25904696" }, { "database": "PubMed", "id": "25923214", "url": "https://pubmed.ncbi.nlm.nih.gov/25923214" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "26158765", "url": "https://pubmed.ncbi.nlm.nih.gov/26158765" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, { "database": "PubMed", "id": "26275218", "url": "https://pubmed.ncbi.nlm.nih.gov/26275218" }, { "database": "PubMed", "id": "26416514", "url": "https://pubmed.ncbi.nlm.nih.gov/26416514" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26438152", "url": "https://pubmed.ncbi.nlm.nih.gov/26438152" }, { "database": "PubMed", "id": "26517194", "url": "https://pubmed.ncbi.nlm.nih.gov/26517194" }, { "database": "PubMed", "id": "26517239", "url": "https://pubmed.ncbi.nlm.nih.gov/26517239" }, { "database": "PubMed", "id": "26556501", "url": "https://pubmed.ncbi.nlm.nih.gov/26556501" }, { "database": "PubMed", "id": "26677768", "url": "https://pubmed.ncbi.nlm.nih.gov/26677768" }, { "database": "PubMed", "id": "26683224", "url": "https://pubmed.ncbi.nlm.nih.gov/26683224" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26860083", "url": "https://pubmed.ncbi.nlm.nih.gov/26860083" }, { "database": "PubMed", "id": "26875667", "url": "https://pubmed.ncbi.nlm.nih.gov/26875667" }, { "database": "PubMed", "id": "26919204", "url": "https://pubmed.ncbi.nlm.nih.gov/26919204" }, { "database": "PubMed", "id": "27029031", "url": "https://pubmed.ncbi.nlm.nih.gov/27029031" }, { "database": "PubMed", "id": "27089984", "url": "https://pubmed.ncbi.nlm.nih.gov/27089984" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27258787", "url": "https://pubmed.ncbi.nlm.nih.gov/27258787" }, { "database": "PubMed", "id": "27259260", "url": "https://pubmed.ncbi.nlm.nih.gov/27259260" }, { "database": "PubMed", "id": "27273218", "url": "https://pubmed.ncbi.nlm.nih.gov/27273218" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27462418", "url": "https://pubmed.ncbi.nlm.nih.gov/27462418" }, { "database": "PubMed", "id": "27468685", "url": "https://pubmed.ncbi.nlm.nih.gov/27468685" }, { "database": "PubMed", "id": "27524627", "url": "https://pubmed.ncbi.nlm.nih.gov/27524627" }, { "database": "PubMed", "id": "27602502", "url": "https://pubmed.ncbi.nlm.nih.gov/27602502" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27613518", "url": "https://pubmed.ncbi.nlm.nih.gov/27613518" }, { "database": "PubMed", "id": "27705915", "url": "https://pubmed.ncbi.nlm.nih.gov/27705915" }, { "database": "PubMed", "id": "27907109", "url": "https://pubmed.ncbi.nlm.nih.gov/27907109" }, { "database": "PubMed", "id": "27959319", "url": "https://pubmed.ncbi.nlm.nih.gov/27959319" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28202068", "url": "https://pubmed.ncbi.nlm.nih.gov/28202068" }, { "database": "PubMed", "id": "28250390", "url": "https://pubmed.ncbi.nlm.nih.gov/28250390" }, { "database": "PubMed", "id": "28259977", "url": "https://pubmed.ncbi.nlm.nih.gov/28259977" }, { "database": "PubMed", "id": "28387728", "url": "https://pubmed.ncbi.nlm.nih.gov/28387728" }, { "database": "PubMed", "id": "28412751", "url": "https://pubmed.ncbi.nlm.nih.gov/28412751" }, { "database": "PubMed", "id": "28477111", "url": "https://pubmed.ncbi.nlm.nih.gov/28477111" }, { "database": "PubMed", "id": "28477132", "url": "https://pubmed.ncbi.nlm.nih.gov/28477132" }, { "database": "PubMed", "id": "28648892", "url": "https://pubmed.ncbi.nlm.nih.gov/28648892" }, { "database": "PubMed", "id": "28881600", "url": "https://pubmed.ncbi.nlm.nih.gov/28881600" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29088817", "url": "https://pubmed.ncbi.nlm.nih.gov/29088817" }, { "database": "PubMed", "id": "29147215", "url": "https://pubmed.ncbi.nlm.nih.gov/29147215" }, { "database": "PubMed", "id": "29294106", "url": "https://pubmed.ncbi.nlm.nih.gov/29294106" }, { "database": "PubMed", "id": "29399146", "url": "https://pubmed.ncbi.nlm.nih.gov/29399146" }, { "database": "PubMed", "id": "29540829", "url": "https://pubmed.ncbi.nlm.nih.gov/29540829" }, { "database": "PubMed", "id": "29615613", "url": "https://pubmed.ncbi.nlm.nih.gov/29615613" }, { "database": "PubMed", "id": "30088201", "url": "https://pubmed.ncbi.nlm.nih.gov/30088201" }, { "database": "PubMed", "id": "30237520", "url": "https://pubmed.ncbi.nlm.nih.gov/30237520" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30258062", "url": "https://pubmed.ncbi.nlm.nih.gov/30258062" }, { "database": "PubMed", "id": "30297868", "url": "https://pubmed.ncbi.nlm.nih.gov/30297868" }, { "database": "PubMed", "id": "30473536", "url": "https://pubmed.ncbi.nlm.nih.gov/30473536" }, { "database": "PubMed", "id": "30565836", "url": "https://pubmed.ncbi.nlm.nih.gov/30565836" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30679601", "url": "https://pubmed.ncbi.nlm.nih.gov/30679601" }, { "database": "PubMed", "id": "30783677", "url": "https://pubmed.ncbi.nlm.nih.gov/30783677" }, { "database": "PubMed", "id": "30886146", "url": "https://pubmed.ncbi.nlm.nih.gov/30886146" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30967632", "url": "https://pubmed.ncbi.nlm.nih.gov/30967632" }, { "database": "PubMed", "id": "31114877", "url": "https://pubmed.ncbi.nlm.nih.gov/31114877" }, { "database": "PubMed", "id": "31164689", "url": "https://pubmed.ncbi.nlm.nih.gov/31164689" }, { "database": "PubMed", "id": "31307507", "url": "https://pubmed.ncbi.nlm.nih.gov/31307507" }, { "database": "PubMed", "id": "31372798", "url": "https://pubmed.ncbi.nlm.nih.gov/31372798" }, { "database": "PubMed", "id": "31481733", "url": "https://pubmed.ncbi.nlm.nih.gov/31481733" }, { "database": "PubMed", "id": "31759252", "url": "https://pubmed.ncbi.nlm.nih.gov/31759252" }, { "database": "PubMed", "id": "31805725", "url": "https://pubmed.ncbi.nlm.nih.gov/31805725" }, { "database": "PubMed", "id": "31827702", "url": "https://pubmed.ncbi.nlm.nih.gov/31827702" }, { "database": "PubMed", "id": "31857852", "url": "https://pubmed.ncbi.nlm.nih.gov/31857852" }, { "database": "PubMed", "id": "32015321", "url": "https://pubmed.ncbi.nlm.nih.gov/32015321" }, { "database": "PubMed", "id": "32059363", "url": "https://pubmed.ncbi.nlm.nih.gov/32059363" }, { "database": "PubMed", "id": "32203529", "url": "https://pubmed.ncbi.nlm.nih.gov/32203529" }, { "database": "PubMed", "id": "32226530", "url": "https://pubmed.ncbi.nlm.nih.gov/32226530" }, { "database": "PubMed", "id": "32377397", "url": "https://pubmed.ncbi.nlm.nih.gov/32377397" }, { "database": "PubMed", "id": "32444694", "url": "https://pubmed.ncbi.nlm.nih.gov/32444694" }, { "database": "PubMed", "id": "32479542", "url": "https://pubmed.ncbi.nlm.nih.gov/32479542" }, { "database": "PubMed", "id": "32665601", "url": "https://pubmed.ncbi.nlm.nih.gov/32665601" }, { "database": "PubMed", "id": "32752095", "url": "https://pubmed.ncbi.nlm.nih.gov/32752095" }, { "database": "PubMed", "id": "32879366", "url": "https://pubmed.ncbi.nlm.nih.gov/32879366" }, { "database": "PubMed", "id": "33024871", "url": "https://pubmed.ncbi.nlm.nih.gov/33024871" }, { "database": "PubMed", "id": "33039867", "url": "https://pubmed.ncbi.nlm.nih.gov/33039867" }, { "database": "PubMed", "id": "33096336", "url": "https://pubmed.ncbi.nlm.nih.gov/33096336" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33437944", "url": "https://pubmed.ncbi.nlm.nih.gov/33437944" }, { "database": "PubMed", "id": "33628174", "url": "https://pubmed.ncbi.nlm.nih.gov/33628174" }, { "database": "PubMed", "id": "33802884", "url": "https://pubmed.ncbi.nlm.nih.gov/33802884" }, { "database": "PubMed", "id": "16141325", "url": "https://pubmed.ncbi.nlm.nih.gov/16141325" }, { "database": "PubMed", "id": "17525332", "url": "https://pubmed.ncbi.nlm.nih.gov/17525332" }, { "database": "PubMed", "id": "21144835", "url": "https://pubmed.ncbi.nlm.nih.gov/21144835" }, { "database": "PubMed", "id": "30944854", "url": "https://pubmed.ncbi.nlm.nih.gov/30944854" } ], "site_lbl": "Ser1981", "uniprot_canonical_ac": "Q13315-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.24086335", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of RSK2 at Tyr529 by FGFR2-p38 enhances human mammary epithelial cells migration.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Czaplinska D, Turczyk L, Grudowska A, Mieszkowska M, Lipinska AD, Skladanowski AC, Zaczek AJ, Romanska HM, Sadej R", "reference": { "type": "PubMed", "id": "25014166", "url": "https://pubmed.ncbi.nlm.nih.gov/25014166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FGFR3", "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" }, { "database": "iPTMnet", "id": "P51812", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51812" }, { "database": "PubMed", "id": "17785199", "url": "https://pubmed.ncbi.nlm.nih.gov/17785199" }, { "database": "PubMed", "id": "18156174", "url": "https://pubmed.ncbi.nlm.nih.gov/18156174" }, { "database": "PubMed", "id": "25014166", "url": "https://pubmed.ncbi.nlm.nih.gov/25014166" } ], "site_lbl": "Tyr529", "uniprot_canonical_ac": "P51812-1" } ], "record_id": "pubmed.25014166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crucial roles of RSK in cell motility by catalysing serine phosphorylation of EphA2.", "journal": "Nature communications", "date": "2015", "authors": "Zhou Y, Yamada N, Tanaka T, Hori T, Yokoyama S, Hayakawa Y, Yano S, Fukuoka J, Koizumi K, Saiki I, Sakurai H", "reference": { "type": "PubMed", "id": "26158630", "url": "https://pubmed.ncbi.nlm.nih.gov/26158630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51812-1", "protein_name": "Ribosomal protein S6 kinase alpha-3", "gene_name": "RPS6KA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29317-1", "protein_name": "Ephrin type-A receptor 2", "gene_name": "EPHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51812", "url": "https://www.uniprot.org/uniprotkb/P51812" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 897, "end_pos": 897, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKB/AKT1, RPS6KA1, RPS6KA3 AND PKA", "evidence": [ { "database": "UniProtKB", "id": "P29317", "url": "https://www.uniprot.org/uniprotkb/P29317" }, { "database": "iPTMnet", "id": "P29317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29317" }, { "database": "PubMed", "id": "19573808", "url": "https://pubmed.ncbi.nlm.nih.gov/19573808" }, { "database": "PubMed", "id": "21408136", "url": "https://pubmed.ncbi.nlm.nih.gov/21408136" }, { "database": "PubMed", "id": "23315987", "url": "https://pubmed.ncbi.nlm.nih.gov/23315987" }, { "database": "PubMed", "id": "23772378", "url": "https://pubmed.ncbi.nlm.nih.gov/23772378" }, { "database": "PubMed", "id": "24486585", "url": "https://pubmed.ncbi.nlm.nih.gov/24486585" }, { "database": "PubMed", "id": "25239188", "url": "https://pubmed.ncbi.nlm.nih.gov/25239188" }, { "database": "PubMed", "id": "25344320", "url": "https://pubmed.ncbi.nlm.nih.gov/25344320" }, { "database": "PubMed", "id": "26158630", "url": "https://pubmed.ncbi.nlm.nih.gov/26158630" }, { "database": "PubMed", "id": "27132626", "url": "https://pubmed.ncbi.nlm.nih.gov/27132626" }, { "database": "PubMed", "id": "27281300", "url": "https://pubmed.ncbi.nlm.nih.gov/27281300" }, { "database": "PubMed", "id": "27326255", "url": "https://pubmed.ncbi.nlm.nih.gov/27326255" }, { "database": "PubMed", "id": "27385333", "url": "https://pubmed.ncbi.nlm.nih.gov/27385333" }, { "database": "PubMed", "id": "27533087", "url": "https://pubmed.ncbi.nlm.nih.gov/27533087" }, { "database": "PubMed", "id": "27742560", "url": "https://pubmed.ncbi.nlm.nih.gov/27742560" }, { "database": "PubMed", "id": "28705041", "url": "https://pubmed.ncbi.nlm.nih.gov/28705041" }, { "database": "PubMed", "id": "28957431", "url": "https://pubmed.ncbi.nlm.nih.gov/28957431" }, { "database": "PubMed", "id": "28966234", "url": "https://pubmed.ncbi.nlm.nih.gov/28966234" }, { "database": "PubMed", "id": "29048432", "url": "https://pubmed.ncbi.nlm.nih.gov/29048432" }, { "database": "PubMed", "id": "29351356", "url": "https://pubmed.ncbi.nlm.nih.gov/29351356" }, { "database": "PubMed", "id": "29956803", "url": "https://pubmed.ncbi.nlm.nih.gov/29956803" }, { "database": "PubMed", "id": "30412282", "url": "https://pubmed.ncbi.nlm.nih.gov/30412282" }, { "database": "PubMed", "id": "30583071", "url": "https://pubmed.ncbi.nlm.nih.gov/30583071" }, { "database": "PubMed", "id": "31160603", "url": "https://pubmed.ncbi.nlm.nih.gov/31160603" }, { "database": "PubMed", "id": "31887630", "url": "https://pubmed.ncbi.nlm.nih.gov/31887630" }, { "database": "PubMed", "id": "32115889", "url": "https://pubmed.ncbi.nlm.nih.gov/32115889" }, { "database": "PubMed", "id": "32376822", "url": "https://pubmed.ncbi.nlm.nih.gov/32376822" }, { "database": "PubMed", "id": "32413552", "url": "https://pubmed.ncbi.nlm.nih.gov/32413552" }, { "database": "PubMed", "id": "32417448", "url": "https://pubmed.ncbi.nlm.nih.gov/32417448" }, { "database": "PubMed", "id": "32750331", "url": "https://pubmed.ncbi.nlm.nih.gov/32750331" }, { "database": "PubMed", "id": "32762307", "url": "https://pubmed.ncbi.nlm.nih.gov/32762307" }, { "database": "PubMed", "id": "33196021", "url": "https://pubmed.ncbi.nlm.nih.gov/33196021" }, { "database": "PubMed", "id": "33893375", "url": "https://pubmed.ncbi.nlm.nih.gov/33893375" }, { "database": "PubMed", "id": "34484860", "url": "https://pubmed.ncbi.nlm.nih.gov/34484860" }, { "database": "PubMed", "id": "35110502", "url": "https://pubmed.ncbi.nlm.nih.gov/35110502" }, { "database": "PubMed", "id": "35124461", "url": "https://pubmed.ncbi.nlm.nih.gov/35124461" }, { "database": "PubMed", "id": "35668076", "url": "https://pubmed.ncbi.nlm.nih.gov/35668076" }, { "database": "PubMed", "id": "36063341", "url": "https://pubmed.ncbi.nlm.nih.gov/36063341" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser897", "uniprot_canonical_ac": "P29317-1" } ], "record_id": "pubmed.26158630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]