[ { "title": "Atg27 is required for autophagy-dependent cycling of Atg9.", "journal": "Molecular biology of the cell", "date": "2007-02", "authors": "Yen Wei-Lien, Legakis Julie E, Nair Usha, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "17135291", "url": "https://pubmed.ncbi.nlm.nih.gov/17135291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46989-1", "protein_name": "Autophagy-related protein 27", "gene_name": "ATG27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46989", "url": "https://www.uniprot.org/uniprotkb/P46989" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17135291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A cycling protein complex required for selective autophagy.", "journal": "Autophagy", "date": "2007", "authors": "Legakis Julie E, Yen Wei-Lien, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "17426440", "url": "https://pubmed.ncbi.nlm.nih.gov/17426440" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46989-1", "protein_name": "Autophagy-related protein 27", "gene_name": "ATG27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06628-1", "protein_name": "Autophagy-related protein 13", "gene_name": "ATG13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06671-1", "protein_name": "Autophagy-related protein 23", "gene_name": "ATG23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46989", "url": "https://www.uniprot.org/uniprotkb/P46989" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17426440", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg9 vesicles are an important membrane source during early steps of autophagosome formation.", "journal": "The Journal of cell biology", "date": "2012-07-23", "authors": "Yamamoto Hayashi, Kakuta Soichiro, Watanabe Tomonobu M, Kitamura Akira, Sekito Takayuki, Kondo-Kakuta Chika, Ichikawa Rie, Kinjo Masataka, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "22826123", "url": "https://pubmed.ncbi.nlm.nih.gov/22826123" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46989-1", "protein_name": "Autophagy-related protein 27", "gene_name": "ATG27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46989", "url": "https://www.uniprot.org/uniprotkb/P46989" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22826123", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg9 vesicles recruit vesicle-tethering proteins Trs85 and Ypt1 to the autophagosome formation site.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Kakuta Soichiro, Yamamoto Hayashi, Negishi Lumi, Kondo-Kakuta Chika, Hayashi Nobuhiro, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "23129774", "url": "https://pubmed.ncbi.nlm.nih.gov/23129774" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46989-1", "protein_name": "Autophagy-related protein 27", "gene_name": "ATG27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46989", "url": "https://www.uniprot.org/uniprotkb/P46989" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23129774", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural analysis of WW domains and design of a WW prototype.", "journal": "Nat. Struct. Biol.", "date": "2000", "authors": "Macias M J, Gervais V, Civera C, Oschkinat H", "reference": { "type": "PubMed", "id": "10802733", "url": "https://pubmed.ncbi.nlm.nih.gov/10802733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8CGF7-1", "protein_name": "Transcription elongation regulator 1", "gene_name": "Tcerg1", "tax_name": "Mouse" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10802733", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Set2 is a nucleosomal histone H3-selective methyltransferase that mediates transcriptional repression.", "journal": "Molecular and cellular biology", "date": "2002-03", "authors": "Strahl Brian D, Grant Patrick A, Briggs Scott D, Sun Zu-Wen, Bone James R, Caldwell Jennifer A, Mollah Sahana, Cook Richard G, Shabanowitz Jeffrey, Hunt Donald F, Allis C David", "reference": { "type": "PubMed", "id": "11839797", "url": "https://pubmed.ncbi.nlm.nih.gov/11839797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P61830-1", "protein_name": "Histone H3", "gene_name": "HHT1; HHT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 195, "end_pos": 195, "sequence_org": "R", "sequence_mut": "G", "comment": "Reduces dramatically histone methyltransferase activity toward nucleosomes.", "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" }, { "database": "PubMed", "id": "11839797", "url": "https://pubmed.ncbi.nlm.nih.gov/11839797" } ], "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 201, "end_pos": 201, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduces dramatically histone methyltransferase activity toward nucleosomes.", "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" }, { "database": "PubMed", "id": "11839797", "url": "https://pubmed.ncbi.nlm.nih.gov/11839797" } ], "uniprot_canonical_ac": "P46995-1" } ], "record_id": "pubmed.11839797", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of the histone methyltransferase Set2 with RNA polymerase II plays a role in transcription elongation.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Li Jiaxu, Moazed Danesh, Gygi Steven P", "reference": { "type": "PubMed", "id": "12381723", "url": "https://pubmed.ncbi.nlm.nih.gov/12381723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "12381723", "url": "https://pubmed.ncbi.nlm.nih.gov/12381723" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P46995-1" } ], "record_id": "pubmed.12381723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Set2 histone methyltransferase functions through the phosphorylated carboxyl-terminal domain of RNA polymerase II.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Li Bing, Howe LeAnn, Anderson Scott, Yates John R, Workman Jerry L", "reference": { "type": "PubMed", "id": "12511561", "url": "https://pubmed.ncbi.nlm.nih.gov/12511561" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12511561", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The histone 3 lysine 36 methyltransferase, SET2, is involved in transcriptional elongation.", "journal": "Nucleic acids research", "date": "2003-05-15", "authors": "Schaft Daniel, Roguev Assen, Kotovic Kimberly M, Shevchenko Anna, Sarov Mihail, Shevchenko Andrej, Neugebauer Karla M, Stewart A Francis", "reference": { "type": "PubMed", "id": "12736296", "url": "https://pubmed.ncbi.nlm.nih.gov/12736296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12736296", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Methylation of histone H3 by Set2 in Saccharomyces cerevisiae is linked to transcriptional elongation by RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2003-06", "authors": "Krogan Nevan J, Kim Minkyu, Tong Amy, Golshani Ashkan, Cagney Gerard, Canadien Veronica, Richards Dawn P, Beattie Bryan K, Emili Andrew, Boone Charles, Shilatifard Ali, Buratowski Stephen, Greenblatt Jack", "reference": { "type": "PubMed", "id": "12773564", "url": "https://pubmed.ncbi.nlm.nih.gov/12773564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P61830-1", "protein_name": "Histone H3", "gene_name": "HHT1; HHT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12773564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Set2-catalyzed methylation of histone H3 represses basal expression of GAL4 in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "2003-09", "authors": "Landry Joseph, Sutton Ann, Hesman Tina, Min Jinrong, Xu Rui-Ming, Johnston Mark, Sternglanz Rolf", "reference": { "type": "PubMed", "id": "12917322", "url": "https://pubmed.ncbi.nlm.nih.gov/12917322" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P61830-1", "protein_name": "Histone H3", "gene_name": "HHT1; HHT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12917322", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel domain in Set2 mediates RNA polymerase II interaction and couples histone H3 K36 methylation with transcript elongation.", "journal": "Molecular and cellular biology", "date": "2005-04", "authors": "Kizer Kelby O, Phatnani Hemali P, Shibata Yoichiro, Hall Hana, Greenleaf Arno L, Strahl Brian D", "reference": { "type": "PubMed", "id": "15798214", "url": "https://pubmed.ncbi.nlm.nih.gov/15798214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P61830-1", "protein_name": "Histone H3", "gene_name": "HHT1; HHT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15798214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dimethylation of histone H3 at lysine 36 demarcates regulatory and nonregulatory chromatin genome-wide.", "journal": "Molecular and cellular biology", "date": "2005-11", "authors": "Rao Bhargavi, Shibata Yoichiro, Strahl Brian D, Lieb Jason D", "reference": { "type": "PubMed", "id": "16227595", "url": "https://pubmed.ncbi.nlm.nih.gov/16227595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16227595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and carboxyl-terminal domain (CTD) binding of the Set2 SRI domain that couples histone H3 Lys36 methylation to transcription.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Vojnic Erika, Simon Bernd, Strahl Brian D, Sattler Michael, Cramer Patrick", "reference": { "type": "PubMed", "id": "16286474", "url": "https://pubmed.ncbi.nlm.nih.gov/16286474" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16286474", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Set2 methyltransferase associates with Ssn6 yet Tup1-Ssn6 repression is independent of histone methylation.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "Tripic Tamara, Edmondson Diane G, Davie Judith K, Strahl Brian D, Dent Sharon Y R", "reference": { "type": "PubMed", "id": "16329992", "url": "https://pubmed.ncbi.nlm.nih.gov/16329992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16329992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asf1 can promote trimethylation of H3 K36 by Set2.", "journal": "Mol. Cell. Biol.", "date": "2010", "authors": "Lin Ling-Ju, Minard Laura V, Johnston Gerald C, Singer Richard A, Schultz Michael C", "reference": { "type": "PubMed", "id": "20048053", "url": "https://pubmed.ncbi.nlm.nih.gov/20048053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.20048053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Post-translational modification analysis of Saccharomyces cerevisiae histone methylation enzymes reveals phosphorylation sites of regulatory potential.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Separovich Ryan J, Wong Mandy W M, Chapman Tyler R, Slavich Eve, Hamey Joshua J, Wilkins Marc R", "reference": { "type": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47156-1", "protein_name": "Histone demethylase JHD2", "gene_name": "JHD2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04089-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-79 specific", "gene_name": "DOT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39956-1", "protein_name": "DNA damage-responsive transcriptional repressor RPH1", "gene_name": "RPH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38890-1", "protein_name": "Histone-lysine N-methyltransferase SET5", "gene_name": "SET5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40034-1", "protein_name": "JmjC domain-containing histone demethylation protein 1", "gene_name": "JHD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr429", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 516, "end_pos": 516, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser516", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 522, "end_pos": 522, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser522", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 524, "end_pos": 524, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser524", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 531, "end_pos": 531, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Thr531", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 543, "end_pos": 543, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser543", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 572, "end_pos": 572, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser572", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser6", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 718, "end_pos": 718, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser718", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 719, "end_pos": 719, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser719", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser8", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser212", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 266, "end_pos": 266, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser266", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 274, "end_pos": 274, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser274", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 340, "end_pos": 340, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "36167807", "url": "https://pubmed.ncbi.nlm.nih.gov/36167807" }, { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser340", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 711, "end_pos": 711, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser711", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr145", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser174", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser176", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser19", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr208", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser219", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser30", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 565, "end_pos": 565, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HOG1", "evidence": [ { "database": "UniProtKB", "id": "Q04089", "url": "https://www.uniprot.org/uniprotkb/Q04089" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser565", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 576, "end_pos": 576, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HOG1", "evidence": [ { "database": "UniProtKB", "id": "Q04089", "url": "https://www.uniprot.org/uniprotkb/Q04089" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr576", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser74", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 124, "end_pos": 124, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser124", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 399, "end_pos": 399, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P39956", "url": "https://www.uniprot.org/uniprotkb/P39956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Thr399", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 412, "end_pos": 412, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "25660547", "url": "https://pubmed.ncbi.nlm.nih.gov/25660547" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32619236", "url": "https://pubmed.ncbi.nlm.nih.gov/32619236" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser412", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 458, "end_pos": 458, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser458", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 459, "end_pos": 459, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39956", "url": "https://www.uniprot.org/uniprotkb/P39956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "21296759", "url": "https://pubmed.ncbi.nlm.nih.gov/21296759" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser459", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 511, "end_pos": 511, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser511", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Thr656", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "29183786", "url": "https://pubmed.ncbi.nlm.nih.gov/29183786" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser13", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser16", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser281", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser285", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser288", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 297, "end_pos": 297, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Thr297", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 301, "end_pos": 301, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "31685550", "url": "https://pubmed.ncbi.nlm.nih.gov/31685550" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser301", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 458, "end_pos": 458, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "29183786", "url": "https://pubmed.ncbi.nlm.nih.gov/29183786" }, { "database": "PubMed", "id": "31685550", "url": "https://pubmed.ncbi.nlm.nih.gov/31685550" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser458", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "PubMed", "id": "31685550", "url": "https://pubmed.ncbi.nlm.nih.gov/31685550" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser461", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 475, "end_pos": 475, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser475", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 476, "end_pos": 476, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" } ], "site_lbl": "Ser476", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 512, "end_pos": 512, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "PubMed", "id": "31685550", "url": "https://pubmed.ncbi.nlm.nih.gov/31685550" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser512", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38890", "url": "https://www.uniprot.org/uniprotkb/P38890" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38890", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38890" }, { "database": "SGD", "id": "S000001250", "url": "https://www.yeastgenome.org/locus/S000001250" }, { "database": "PubMed", "id": "31685550", "url": "https://pubmed.ncbi.nlm.nih.gov/31685550" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser517", "uniprot_canonical_ac": "P38890-1" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40034", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40034" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000000853", "url": "https://www.yeastgenome.org/locus/S000000853" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser44", "uniprot_canonical_ac": "P40034-1" } ], "record_id": "pubmed.33334889", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 51 }, { "field": "total_sites", "count": 50 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Site-specific Phosphorylation of Histone H3K36 Methyltransferase Set2p and Demethylase Jhd1p is Required for Stress Responses in Saccharomyces cerevisiae.", "journal": "Journal of molecular biology", "date": "2022-04-15", "authors": "Separovich Ryan J, Wong Mandy W M, Bartolec Tara K, Hamey Joshua J, Wilkins Marc R", "reference": { "type": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46995-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-36 specific", "gene_name": "SET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47156-1", "protein_name": "Histone demethylase JHD2", "gene_name": "JHD2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04089-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-79 specific", "gene_name": "DOT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39956-1", "protein_name": "DNA damage-responsive transcriptional repressor RPH1", "gene_name": "RPH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38827-1", "protein_name": "Histone-lysine N-methyltransferase, H3 lysine-4 specific", "gene_name": "SET1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40034-1", "protein_name": "JmjC domain-containing histone demethylation protein 1", "gene_name": "JHD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr127", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr429", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 522, "end_pos": 522, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46995", "url": "https://www.uniprot.org/uniprotkb/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser522", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser6", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 726, "end_pos": 726, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser726", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46995", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46995" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000003704", "url": "https://www.yeastgenome.org/locus/S000003704" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser8", "uniprot_canonical_ac": "P46995-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser212", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 266, "end_pos": 266, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser266", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 274, "end_pos": 274, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser274", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 340, "end_pos": 340, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "36167807", "url": "https://pubmed.ncbi.nlm.nih.gov/36167807" }, { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser340", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 711, "end_pos": 711, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser711", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr145", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser174", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser176", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser19", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr208", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser219", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser227", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser30", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser49", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 565, "end_pos": 565, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HOG1", "evidence": [ { "database": "UniProtKB", "id": "Q04089", "url": "https://www.uniprot.org/uniprotkb/Q04089" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser565", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 576, "end_pos": 576, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HOG1", "evidence": [ { "database": "UniProtKB", "id": "Q04089", "url": "https://www.uniprot.org/uniprotkb/Q04089" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr576", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002848", "url": "https://www.yeastgenome.org/locus/S000002848" }, { "database": "iPTMnet", "id": "Q04089", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04089" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser74", "uniprot_canonical_ac": "Q04089-1" }, { "start_pos": 412, "end_pos": 412, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "25660547", "url": "https://pubmed.ncbi.nlm.nih.gov/25660547" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32619236", "url": "https://pubmed.ncbi.nlm.nih.gov/32619236" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser412", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 575, "end_pos": 575, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39956", "url": "https://www.uniprot.org/uniprotkb/P39956" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser575", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 1001, "end_pos": 1001, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr1001", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 1006, "end_pos": 1006, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr1006", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 504, "end_pos": 504, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr504", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 625, "end_pos": 625, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38827", "url": "https://www.uniprot.org/uniprotkb/P38827" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser625", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser701", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 704, "end_pos": 704, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr704", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr705", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 708, "end_pos": 708, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser708", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr785", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 787, "end_pos": 787, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr787", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 875, "end_pos": 875, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P38827", "url": "https://www.uniprot.org/uniprotkb/P38827" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P38827", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38827" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001161", "url": "https://www.yeastgenome.org/locus/S000001161" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Thr875", "uniprot_canonical_ac": "P38827-1" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40034", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40034" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "SGD", "id": "S000000853", "url": "https://www.yeastgenome.org/locus/S000000853" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser44", "uniprot_canonical_ac": "P40034-1" } ], "record_id": "pubmed.35183557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 40 }, { "field": "total_sites", "count": 40 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of NaOH-extractable cell wall proteins Ccw5p, Ccw6p, Ccw7p and Ccw8p (members of the Pir protein family) in stability of the Saccharomyces cerevisiae cell wall.", "journal": "Yeast (Chichester, England)", "date": "1999-07", "authors": "Mrsa V, Tanner W", "reference": { "type": "PubMed", "id": "10407261", "url": "https://pubmed.ncbi.nlm.nih.gov/10407261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03178-1", "protein_name": "Cell wall mannoprotein PIR1", "gene_name": "PIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10407261", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of two mannoproteins released from cell walls of a Saccharomyces cerevisiae mnn1 mnn9 double mutant by reducing agents.", "journal": "J. Bacteriol.", "date": "1999", "authors": "Moukadiri I, Jaafar L, Zueco J", "reference": { "type": "PubMed", "id": "10438739", "url": "https://pubmed.ncbi.nlm.nih.gov/10438739" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10438739", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide analysis of gene expression regulated by the yeast cell wall integrity signalling pathway.", "journal": "Mol. Microbiol.", "date": "1999", "authors": "Jung U S, Levin D E", "reference": { "type": "PubMed", "id": "10594829", "url": "https://pubmed.ncbi.nlm.nih.gov/10594829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53301-1", "protein_name": "Congo red hypersensitive protein 1", "gene_name": "CRH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28319-1", "protein_name": "Cell wall protein CWP1", "gene_name": "CWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40476-1", "protein_name": "Pheromone-regulated membrane protein 5", "gene_name": "PRM5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03178-1", "protein_name": "Cell wall mannoprotein PIR1", "gene_name": "PIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12355-1", "protein_name": "Cell wall mannoprotein PST1", "gene_name": "PST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05777-1", "protein_name": "Cell wall biogenesis protein NCW2", "gene_name": "NCW2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10594829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-mannosylation precedes and potentially controls the N-glycosylation of a yeast cell wall glycoprotein.", "journal": "EMBO reports", "date": "2003-06", "authors": "Ecker Margit, Mrsa Vladimir, Hagen Ilja, Deutzmann Rainer, Strahl Sabine, Tanner Widmar", "reference": { "type": "PubMed", "id": "12776183", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 105, "start_aa": "Ser", "end_pos": 105, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser105", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 106, "start_aa": "Ser", "end_pos": 106, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser106", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 107, "start_aa": "Ser", "end_pos": 107, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser107", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 109, "start_aa": "Ser", "end_pos": 109, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser109", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Man) threonine", "icn3d_view": {}, "start_pos": 111, "start_aa": "Thr", "end_pos": 111, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr111", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 112, "start_aa": "Ser", "end_pos": 112, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser112", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Man) threonine", "icn3d_view": {}, "start_pos": 113, "start_aa": "Thr", "end_pos": 113, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr113", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Man) threonine", "icn3d_view": {}, "start_pos": 116, "start_aa": "Thr", "end_pos": 116, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr116", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 117, "start_aa": "Ser", "end_pos": 117, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser117", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 118, "start_aa": "Ser", "end_pos": 118, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser118", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "12776183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12776183" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P47001-1" } ], "record_id": "pubmed.12776183", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the cysteine residues and the repetitive sequence of Saccharomyces cerevisiae Pir4/Cis3: the repetitive sequence is needed for binding to the cell wall beta-1,3-glucan.", "journal": "Yeast (Chichester, England)", "date": "2003-08", "authors": "Castillo Luis, Martinez Ana I, Garcer\u00e1 Ana, Elorza M Victoria, Valent\u00edn Eulogio, Sentandreu Rafael", "reference": { "type": "PubMed", "id": "12898712", "url": "https://pubmed.ncbi.nlm.nih.gov/12898712" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 130, "end_pos": 130, "sequence_org": "C", "sequence_mut": "S", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "12898712", "url": "https://pubmed.ncbi.nlm.nih.gov/12898712" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 197, "end_pos": 197, "sequence_org": "C", "sequence_mut": "S", "comment": "Results in the incorporation of KEX2-unprocessed precursor protein into the cell wall.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "12898712", "url": "https://pubmed.ncbi.nlm.nih.gov/12898712" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 208, "end_pos": 227, "sequence_org": "QNVAEQCSAIHLEAVSLVDC", "sequence_mut": "LDC", "comment": "In PIR4t18; destabilizes the protein.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "12898712", "url": "https://pubmed.ncbi.nlm.nih.gov/12898712" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 227, "end_pos": 227, "sequence_org": "C", "sequence_mut": "", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "12898712", "url": "https://pubmed.ncbi.nlm.nih.gov/12898712" } ], "uniprot_canonical_ac": "P47001-1" } ], "record_id": "pubmed.12898712", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the transcriptional response to cell wall stress in Saccharomyces cerevisiae.", "journal": "Yeast", "date": "2004", "authors": "Boorsma Andr\u00e9, de Nobel Hans, ter Riet Bas, Bargmann Bastiaan, Brul Stanley, Hellingwerf Klaas J, Klis Frans M", "reference": { "type": "PubMed", "id": "15116342", "url": "https://pubmed.ncbi.nlm.nih.gov/15116342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46998-1", "protein_name": "Mitochondrial membrane protein FMP33", "gene_name": "FMP33", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02895-1", "protein_name": "Putative aryl-alcohol dehydrogenase AAD16", "gene_name": "AAD16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03178-1", "protein_name": "Cell wall mannoprotein PIR1", "gene_name": "PIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12355-1", "protein_name": "Cell wall mannoprotein PST1", "gene_name": "PST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38892-1", "protein_name": "Probable S-adenosylmethionine-dependent methyltransferase CRG1", "gene_name": "CRG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06991-1", "protein_name": "Protein PUN1", "gene_name": "PUN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07990-1", "protein_name": "Cell wall protein YLR042C", "gene_name": "", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15116342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased mortality of Saccharomyces cerevisiae cell wall protein mutants.", "journal": "Microbiology (Reading, England)", "date": "2004-10", "authors": "Tepari\u0107 Renata, Stuparevi\u0107 Igor, Mrsa Vladimir", "reference": { "type": "PubMed", "id": "15470095", "url": "https://pubmed.ncbi.nlm.nih.gov/15470095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03178-1", "protein_name": "Cell wall mannoprotein PIR1", "gene_name": "PIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15470095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive proteomic analysis of Saccharomyces cerevisiae cell walls: identification of proteins covalently attached via glycosylphosphatidylinositol remnants or mild alkali-sensitive linkages.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Yin Qing Yuan, de Groot Piet W J, Dekker Henk L, de Jong Luitzen, Klis Frans M, de Koster Chris G", "reference": { "type": "PubMed", "id": "15781460", "url": "https://pubmed.ncbi.nlm.nih.gov/15781460" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53301-1", "protein_name": "Congo red hypersensitive protein 1", "gene_name": "CRH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28319-1", "protein_name": "Cell wall protein CWP1", "gene_name": "CWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32623-1", "protein_name": "Congo red hypersensitive protein 2", "gene_name": "UTR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03178-1", "protein_name": "Cell wall mannoprotein PIR1", "gene_name": "PIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03655-1", "protein_name": "Probable 1,3-beta-glucanosyltransferase GAS3", "gene_name": "GAS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03674-1", "protein_name": "Lysophospholipase 2", "gene_name": "PLB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08193-1", "protein_name": "1,3-beta-glucanosyltransferase GAS5", "gene_name": "GAS5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38248-1", "protein_name": "Cell wall protein ECM33", "gene_name": "ECM33", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38288-1", "protein_name": "Probable circularly permuted 1,3-beta-glucanase TOS1", "gene_name": "TOS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27654-1", "protein_name": "Temperature shock-inducible protein 1", "gene_name": "TIP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O13547-1", "protein_name": "Covalently-linked cell wall protein 14", "gene_name": "CCW14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10863-1", "protein_name": "Cold shock-induced protein TIR1", "gene_name": "TIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22146-1", "protein_name": "1,3-beta-glucanosyltransferase GAS1", "gene_name": "GAS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15781460", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pir proteins of Saccharomyces cerevisiae are attached to beta-1,3-glucan by a new protein-carbohydrate linkage.", "journal": "The Journal of biological chemistry", "date": "2006-04-28", "authors": "Ecker Margit, Deutzmann Rainer, Lehle Ludwig, Mrsa Vladimir, Tanner Widmar", "reference": { "type": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Man) serine", "icn3d_view": {}, "start_pos": 68, "start_aa": "Ser", "end_pos": 68, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser68", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "16495216", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "filter_code": "000000000000000100000.00000000001000.00.01100", "uniprot_canonical_ac": "P47001-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Man) threonine", "icn3d_view": {}, "start_pos": 78, "start_aa": "Thr", "end_pos": 78, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr78", "evidence": [ { "id": "P47001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47001#ptm_processing" }, { "id": "16495216", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "filter_code": "000000000000000010000.00000000001000.00.01100", "uniprot_canonical_ac": "P47001-1" } ], "mutagenesis": [ { "start_pos": 65, "end_pos": 65, "sequence_org": "D", "sequence_mut": "N", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "Q", "sequence_mut": "A", "comment": "Results in complete loss of cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "D", "sequence_mut": "N", "comment": "Results in complete loss of cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 74, "end_pos": 74, "sequence_org": "Q", "sequence_mut": "A", "comment": "Results in complete loss of cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "Q", "sequence_mut": "A", "comment": "Results in complete loss of cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 78, "end_pos": 78, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" }, { "start_pos": 82, "end_pos": 82, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect cell wall incorporation.", "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" }, { "database": "PubMed", "id": "16495216", "url": "https://pubmed.ncbi.nlm.nih.gov/16495216" } ], "uniprot_canonical_ac": "P47001-1" } ], "record_id": "pubmed.16495216", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mass spectrometric quantitation of covalently bound cell wall proteins in Saccharomyces cerevisiae.", "journal": "FEMS Yeast Res.", "date": "2007", "authors": "Yin Qing Yuan, de Groot Piet W J, de Jong Luitzen, Klis Frans M, De Koster Chris G", "reference": { "type": "PubMed", "id": "17617218", "url": "https://pubmed.ncbi.nlm.nih.gov/17617218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53301-1", "protein_name": "Congo red hypersensitive protein 1", "gene_name": "CRH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53334-1", "protein_name": "Probable family 17 glucosidase SCW4", "gene_name": "SCW4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28319-1", "protein_name": "Cell wall protein CWP1", "gene_name": "CWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38248-1", "protein_name": "Cell wall protein ECM33", "gene_name": "ECM33", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22146-1", "protein_name": "1,3-beta-glucanosyltransferase GAS1", "gene_name": "GAS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17617218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Global analysis of the glycoproteome in Saccharomyces cerevisiae reveals new roles for protein glycosylation in eukaryotes.", "journal": "Molecular systems biology", "date": "2009", "authors": "Kung Li A, Tao Sheng-Ce, Qian Jiang, Smith Michael G, Snyder Michael, Zhu Heng", "reference": { "type": "PubMed", "id": "19756047", "url": "https://pubmed.ncbi.nlm.nih.gov/19756047" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50079-1", "protein_name": "SVP1-like protein 2", "gene_name": "HSV2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53163-1", "protein_name": "Large ribosomal subunit protein bL12m", "gene_name": "MNP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53334-1", "protein_name": "Probable family 17 glucosidase SCW4", "gene_name": "SCW4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04080-1", "protein_name": "GPI transamidase component GPI17", "gene_name": "GPI17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08989-1", "protein_name": "Uncharacterized protein YPL277C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12230-1", "protein_name": "Sphingolipid long chain base-responsive protein LSP1", "gene_name": "LSP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P37370-1", "protein_name": "Verprolin", "gene_name": "VRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40095-1", "protein_name": "Uncharacterized protein YER158C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38887-1", "protein_name": "5'-nucleotidase SMN1", "gene_name": "SMN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40520-1", "protein_name": "Uncharacterized protein YIL059C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43600-1", "protein_name": "Secreted protein CSS2", "gene_name": "CSS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47078-1", "protein_name": "Uncharacterized protein YJL009W", "gene_name": "J1369", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08743-1", "protein_name": "Vacuolar membrane protein YOR292C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08910-1", "protein_name": "VEL1-related protein YOR387C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12167-1", "protein_name": "Required for respiratory growth protein 1, mitochondrial", "gene_name": "RRG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12282-1", "protein_name": "Sorulation-regulated protein 2", "gene_name": "SPR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8TGK4-1", "protein_name": "Uncharacterized protein YBR298C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53720-1", "protein_name": "tRNA-dihydrouridine(20) synthase [NAD(P)+]", "gene_name": "SMM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53832-1", "protein_name": "Cell wall integrity and stress response component 2", "gene_name": "WSC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53950-1", "protein_name": "Vacuolar segregation protein 7", "gene_name": "VAC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02775-1", "protein_name": "Pre-mRNA-splicing factor SLU7", "gene_name": "SLU7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02783-1", "protein_name": "Mitochondrial inner membrane magnesium transporter MFM1", "gene_name": "MFM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03655-1", "protein_name": "Probable 1,3-beta-glucanosyltransferase GAS3", "gene_name": "GAS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05031-1", "protein_name": "Mannan endo-1,6-alpha-mannosidase DFG5", "gene_name": "DFG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08651-1", "protein_name": "Probable oxidoreductase ENV9", "gene_name": "ENV9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34231-1", "protein_name": "Uncharacterized protein YKL187C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38694-1", "protein_name": "Putative aldehyde dehydrogenase-like protein YHR039C", "gene_name": "MSC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40099-1", "protein_name": "5-formyltetrahydrofolate cyclo-ligase", "gene_name": "FAU1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40100-1", "protein_name": "Protoporphyrin uptake protein 1", "gene_name": "PUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40533-1", "protein_name": "Protein TED1", "gene_name": "TED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40583-1", "protein_name": "Aspartic proteinase yapsin-6", "gene_name": "YPS6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47055-1", "protein_name": "Outer spore wall protein 4", "gene_name": "LOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53058-1", "protein_name": "Protein VEL1", "gene_name": "VEL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53938-1", "protein_name": "N-glycosylation protein EOS1", "gene_name": "EOS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04952-1", "protein_name": "1,3-beta-glucan synthase component FKS3", "gene_name": "FKS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06689-1", "protein_name": "Cell membrane protein YLR413W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06991-1", "protein_name": "Protein PUN1", "gene_name": "PUN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08199-1", "protein_name": "Nucleotide exchange factor SIL1", "gene_name": "SIL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25353-1", "protein_name": "Ectonucleotide pyrophosphatase/phosphodiesterase 1", "gene_name": "NPP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25574-1", "protein_name": "ER membrane protein complex subunit 1", "gene_name": "EMC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25653-1", "protein_name": "Factor-induced gene 2 protein", "gene_name": "FIG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27810-1", "protein_name": "Alpha-1,2 mannosyltransferase KTR1", "gene_name": "KTR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P42846-1", "protein_name": "Protein KRI1", "gene_name": "KRI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53933-1", "protein_name": "Phosphatidate phosphatase APP1", "gene_name": "APP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15705-1", "protein_name": "Heat shock protein STI1", "gene_name": "STI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25381-1", "protein_name": "Subtilase-type proteinase RRT12", "gene_name": "RRT12", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19756047", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specific labelling of cell wall proteins by biotinylation. Identification of four covalently linked O-mannosylated proteins of Saccharomyces cerevisiae.", "journal": "Yeast (Chichester, England)", "date": "1997-09-30", "authors": "Mrs\u0103 V, Seidl T, Gentzsch M, Tanner W", "reference": { "type": "PubMed", "id": "9301021", "url": "https://pubmed.ncbi.nlm.nih.gov/9301021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32478-1", "protein_name": "Cell wall mannoprotein HSP150", "gene_name": "HSP150", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03178-1", "protein_name": "Cell wall mannoprotein PIR1", "gene_name": "PIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9301021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New potential cell wall glucanases of Saccharomyces cerevisiae and their involvement in mating.", "journal": "J. Bacteriol.", "date": "1998", "authors": "Cappellaro C, Mrsa V, Tanner W", "reference": { "type": "PubMed", "id": "9748433", "url": "https://pubmed.ncbi.nlm.nih.gov/9748433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47001-1", "protein_name": "Cell wall mannoprotein CIS3", "gene_name": "CIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53334-1", "protein_name": "Probable family 17 glucosidase SCW4", "gene_name": "SCW4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53616-1", "protein_name": "Probable secreted beta-glucosidase SUN4", "gene_name": "SUN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P29029-1", "protein_name": "Endochitinase", "gene_name": "CTS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04951-1", "protein_name": "Probable family 17 glucosidase SCW10", "gene_name": "SCW10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53189-1", "protein_name": "Probable family 17 glucosidase SCW11", "gene_name": "SCW11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15703-1", "protein_name": "Glucan 1,3-beta-glucosidase", "gene_name": "BGL2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23776-1", "protein_name": "Glucan 1,3-beta-glucosidase I/II", "gene_name": "EXG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47001", "url": "https://www.uniprot.org/uniprotkb/P47001" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9748433", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and biochemical analysis of the yeast plasma membrane Ssy1p-Ptr3p-Ssy5p sensor of extracellular amino acids.", "journal": "Molecular and cellular biology", "date": "2001-02", "authors": "Forsberg H, Ljungdahl P O", "reference": { "type": "PubMed", "id": "11154269", "url": "https://pubmed.ncbi.nlm.nih.gov/11154269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43606-1", "protein_name": "SPS-sensor component PTR3", "gene_name": "PTR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03770-1", "protein_name": "SPS-sensor component SSY1", "gene_name": "SSY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25376-1", "protein_name": "General amino acid permease AGP1", "gene_name": "AGP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11154269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic analysis of the signalling pathway activated by external amino acids in Saccharomyces cerevisiae.", "journal": "Molecular microbiology", "date": "2001-07", "authors": "Bernard F, Andr\u00e9 B", "reference": { "type": "PubMed", "id": "11489133", "url": "https://pubmed.ncbi.nlm.nih.gov/11489133" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43606-1", "protein_name": "SPS-sensor component PTR3", "gene_name": "PTR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11489133", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor-mediated endoproteolytic activation of two transcription factors in yeast.", "journal": "Genes & development", "date": "2002-12-15", "authors": "Andr\u00e9asson Claes, Ljungdahl Per O", "reference": { "type": "PubMed", "id": "12502738", "url": "https://pubmed.ncbi.nlm.nih.gov/12502738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00947-1", "protein_name": "Transcription factor STP1", "gene_name": "STP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38704-1", "protein_name": "Transcription factor STP2", "gene_name": "STP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43606-1", "protein_name": "SPS-sensor component PTR3", "gene_name": "PTR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03770-1", "protein_name": "SPS-sensor component SSY1", "gene_name": "SSY1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 9, "end_pos": 66, "sequence_org": "PQKHIRAIPGKIYAFFRELVSGVIISKPDLSHHYSCENATKEEGKDAADEEKTTTSLF", "sequence_mut": "", "comment": "In ASI13-1; dominant active and constitutively nuclear localized transcription factor.", "evidence": [ { "database": "UniProtKB", "id": "Q00947", "url": "https://www.uniprot.org/uniprotkb/Q00947" }, { "database": "PubMed", "id": "12502738", "url": "https://pubmed.ncbi.nlm.nih.gov/12502738" } ], "uniprot_canonical_ac": "Q00947-1" }, { "start_pos": 2, "end_pos": 74, "sequence_org": "PILSLSSTRNSVLTRIYDYLKALVQQVIVPNVEDDKSSKSTPFEKLEPAKQNHPQKDCCATEKDDLVDVSELF", "sequence_mut": "", "comment": "Dominant active transcription factor.", "evidence": [ { "database": "UniProtKB", "id": "P38704", "url": "https://www.uniprot.org/uniprotkb/P38704" }, { "database": "PubMed", "id": "12502738", "url": "https://pubmed.ncbi.nlm.nih.gov/12502738" } ], "uniprot_canonical_ac": "P38704-1" } ], "record_id": "pubmed.12502738", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid signaling in yeast: casein kinase I and the Ssy5 endoprotease are key determinants of endoproteolytic activation of the membrane-bound Stp1 transcription factor.", "journal": "Molecular and cellular biology", "date": "2004-11", "authors": "Abdel-Sater Fadi, El Bakkoury Mohamed, Urrestarazu Antonio, Vissers Stephan, Andr\u00e9 Bruno", "reference": { "type": "PubMed", "id": "15509782", "url": "https://pubmed.ncbi.nlm.nih.gov/15509782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00947-1", "protein_name": "Transcription factor STP1", "gene_name": "STP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 420, "end_pos": 424, "sequence_org": "PISMS", "sequence_mut": "", "comment": "Prevents maturation and amino-acid-induced STP1 cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "15509782", "url": "https://pubmed.ncbi.nlm.nih.gov/15509782" } ], "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 640, "end_pos": 640, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs maturation and amino acid-induced STP1 cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "15509782", "url": "https://pubmed.ncbi.nlm.nih.gov/15509782" } ], "uniprot_canonical_ac": "P47002-1" } ], "record_id": "pubmed.15509782", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Constitutive signal transduction by mutant Ssy5p and Ptr3p components of the SPS amino acid sensor system in Saccharomyces cerevisiae.", "journal": "Eukaryotic cell", "date": "2005-06", "authors": "Poulsen Peter, Wu Boqian, Gaber Richard F, Kielland-Brandt Morten C", "reference": { "type": "PubMed", "id": "15947203", "url": "https://pubmed.ncbi.nlm.nih.gov/15947203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43606-1", "protein_name": "SPS-sensor component PTR3", "gene_name": "PTR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 512, "end_pos": 512, "sequence_org": "E", "sequence_mut": "K", "comment": "In SSY5-6; constitutively active, confers 30% increased STP1 processing in the absence of amino acids.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "15947203", "url": "https://pubmed.ncbi.nlm.nih.gov/15947203" } ], "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 435, "end_pos": 435, "sequence_org": "T", "sequence_mut": "K", "comment": "In PTR3-17; constitutively active, confers increased STP1 processing in the absence of amino acids.", "evidence": [ { "database": "UniProtKB", "id": "P43606", "url": "https://www.uniprot.org/uniprotkb/P43606" }, { "database": "PubMed", "id": "17984223", "url": "https://pubmed.ncbi.nlm.nih.gov/17984223" }, { "database": "PubMed", "id": "15947203", "url": "https://pubmed.ncbi.nlm.nih.gov/15947203" } ], "uniprot_canonical_ac": "P43606-1" }, { "start_pos": 439, "end_pos": 439, "sequence_org": "Q", "sequence_mut": "R", "comment": "In PTR3-5; constitutively active and hyperphosphorylated, confers increased STP1 processing in the absence of amino acids.", "evidence": [ { "database": "UniProtKB", "id": "P43606", "url": "https://www.uniprot.org/uniprotkb/P43606" }, { "database": "PubMed", "id": "17984223", "url": "https://pubmed.ncbi.nlm.nih.gov/17984223" }, { "database": "PubMed", "id": "15947203", "url": "https://pubmed.ncbi.nlm.nih.gov/15947203" } ], "uniprot_canonical_ac": "P43606-1" } ], "record_id": "pubmed.15947203", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mapping of an internal protease cleavage site in the Ssy5p component of the amino acid sensor of Saccharomyces cerevisiae and functional characterization of the resulting pro- and protease domains by gain-of-function genetics.", "journal": "Eukaryotic cell", "date": "2006-03", "authors": "Poulsen Peter, Lo Leggio Leila, Kielland-Brandt Morten C", "reference": { "type": "PubMed", "id": "16524914", "url": "https://pubmed.ncbi.nlm.nih.gov/16524914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 131, "end_pos": 131, "sequence_org": "E", "sequence_mut": "K", "comment": "In SSY5-13; constitutively active, confers 9.3% increased STP1 processing in the absence of amino acids.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "16524914", "url": "https://pubmed.ncbi.nlm.nih.gov/16524914" } ], "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 575, "end_pos": 575, "sequence_org": "F", "sequence_mut": "V", "comment": "In SSY5-14; constitutively active, confers 30% increased STP1 processing in the absence of amino acids.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "16524914", "url": "https://pubmed.ncbi.nlm.nih.gov/16524914" } ], "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 576, "end_pos": 576, "sequence_org": "Q", "sequence_mut": "P", "comment": "In SSY5-15; constitutively active, confers 30% increased STP1 processing in the absence of amino acids.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "16524914", "url": "https://pubmed.ncbi.nlm.nih.gov/16524914" } ], "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 581, "end_pos": 581, "sequence_org": "K", "sequence_mut": "N", "comment": "In SSY5-18; constitutively active, confers 15.5% increased STP1 processing in the absence of amino acids; when associated with H-632.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "16524914", "url": "https://pubmed.ncbi.nlm.nih.gov/16524914" } ], "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 632, "end_pos": 632, "sequence_org": "P", "sequence_mut": "H", "comment": "In SSY5-18; constitutively active, confers 15.5% increased STP1 processing in the absence of amino acids; when associated with N-581.", "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" }, { "database": "PubMed", "id": "16524914", "url": "https://pubmed.ncbi.nlm.nih.gov/16524914" } ], "uniprot_canonical_ac": "P47002-1" } ], "record_id": "pubmed.16524914", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of transcription factor latency by receptor-activated proteolysis.", "journal": "Genes & development", "date": "2006-06-15", "authors": "Andr\u00e9asson Claes, Heessen Stijn, Ljungdahl Per O", "reference": { "type": "PubMed", "id": "16778074", "url": "https://pubmed.ncbi.nlm.nih.gov/16778074" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00947-1", "protein_name": "Transcription factor STP1", "gene_name": "STP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16778074", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatial and temporal regulation of the endoproteolytic activity of the SPS-sensor-controlled Ssy5 signaling protease.", "journal": "Molecular biology of the cell", "date": "2019-10-01", "authors": "Martins Ant\u00f3nio, Ring Andreas, Omnus Deike J, Heessen Stijn, Pfirrmann Thorsten, Ljungdahl Per O", "reference": { "type": "PubMed", "id": "31461372", "url": "https://pubmed.ncbi.nlm.nih.gov/31461372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 422, "end_pos": 422, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47002" }, { "database": "PubMed", "id": "31461372", "url": "https://pubmed.ncbi.nlm.nih.gov/31461372" } ], "site_lbl": "Ser422", "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 424, "end_pos": 424, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47002" }, { "database": "PubMed", "id": "31461372", "url": "https://pubmed.ncbi.nlm.nih.gov/31461372" } ], "site_lbl": "Ser424", "uniprot_canonical_ac": "P47002-1" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47002" }, { "database": "PubMed", "id": "31461372", "url": "https://pubmed.ncbi.nlm.nih.gov/31461372" } ], "site_lbl": "Ser426", "uniprot_canonical_ac": "P47002-1" } ], "record_id": "pubmed.31461372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in five loci affecting GAP1-independent uptake of neutral amino acids in yeast.", "journal": "Yeast", "date": "1998", "authors": "J\u00f8rgensen M U, Bruun M B, Didion T, Kielland-Brandt M C", "reference": { "type": "PubMed", "id": "9483800", "url": "https://pubmed.ncbi.nlm.nih.gov/9483800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47002-1", "protein_name": "SPS-sensor serine protease component SSY5", "gene_name": "SSY5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43606-1", "protein_name": "SPS-sensor component PTR3", "gene_name": "PTR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03770-1", "protein_name": "SPS-sensor component SSY1", "gene_name": "SSY1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47002", "url": "https://www.uniprot.org/uniprotkb/P47002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9483800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdc53/cullin and the essential Hrt1 RING-H2 subunit of SCF define a ubiquitin ligase module that activates the E2 enzyme Cdc34.", "journal": "Genes Dev.", "date": "1999", "authors": "Seol J H, Feldman R M, Zachariae W, Shevchenko A, Correll C C, Lyapina S, Chi Y, Galova M, Claypool J, Sandmeyer S, Nasmyth K, Deshaies R J, Shevchenko A, Deshaies R J", "reference": { "type": "PubMed", "id": "10385629", "url": "https://pubmed.ncbi.nlm.nih.gov/10385629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47005-1", "protein_name": "F-box protein DAS1", "gene_name": "DAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14682-1", "protein_name": "Ubiquitin-conjugating enzyme E2-34 kDa", "gene_name": "CDC34", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07834-1", "protein_name": "Cell division control protein 4", "gene_name": "CDC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08273-1", "protein_name": "RING-box protein HRT1", "gene_name": "HRT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12018-1", "protein_name": "Cell division control protein 53", "gene_name": "CDC53", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47005", "url": "https://www.uniprot.org/uniprotkb/P47005" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10385629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SCF ubiquitin protein ligases and phosphorylation-dependent proteolysis.", "journal": "Philos. Trans. R. Soc. Lond., B, Biol. Sci.", "date": "1999", "authors": "Willems A R, Goh T, Taylor L, Chernushevich I, Shevchenko A, Tyers M", "reference": { "type": "PubMed", "id": "10582239", "url": "https://pubmed.ncbi.nlm.nih.gov/10582239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47005-1", "protein_name": "F-box protein DAS1", "gene_name": "DAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03899-1", "protein_name": "F-box protein YDR131C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05947-1", "protein_name": "F-box protein UCC1", "gene_name": "UCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08496-1", "protein_name": "Protein DIA2", "gene_name": "DIA2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47005", "url": "https://www.uniprot.org/uniprotkb/P47005" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10582239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Remodeling of the SCF complex-mediated ubiquitination system by compositional alteration of incorporated F-box proteins.", "journal": "Proteomics", "date": "2010", "authors": "Kato Mitsunori, Kito Keiji, Ota Kazuhisa, Ito Takashi", "reference": { "type": "PubMed", "id": "19882662", "url": "https://pubmed.ncbi.nlm.nih.gov/19882662" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47005-1", "protein_name": "F-box protein DAS1", "gene_name": "DAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38352-1", "protein_name": "SCF-associated factor 1", "gene_name": "SAF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04847-1", "protein_name": "Non-SCF-type F-box protein ROY1", "gene_name": "ROY1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47005", "url": "https://www.uniprot.org/uniprotkb/P47005" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19882662", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI.", "journal": "Yeast", "date": "1996", "authors": "Katsoulou C, Tzermia M, Tavernarakis N, Alexandraki D", "reference": { "type": "PubMed", "id": "8813765", "url": "https://pubmed.ncbi.nlm.nih.gov/8813765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47005-1", "protein_name": "F-box protein DAS1", "gene_name": "DAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47006-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA34", "gene_name": "RPA34", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47008-1", "protein_name": "Phosphatidylinositol transfer protein SFH5", "gene_name": "SFH5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47011-1", "protein_name": "Glycogenin-2", "gene_name": "GLG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34110-1", "protein_name": "Vacuolar protein sorting-associated protein 35", "gene_name": "VPS35", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47009-1", "protein_name": "Uncharacterized protein YJL144W", "gene_name": "J0646", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47010-1", "protein_name": "Uncharacterized protein IRC9", "gene_name": "IRC9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47014-1", "protein_name": "Uncharacterized protein YJL132W", "gene_name": "J0678", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E754-1", "protein_name": "Small ribosomal subunit protein eS21B", "gene_name": "RPS21B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14359-1", "protein_name": "Protein SNA3", "gene_name": "SNA3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P11986-1", "protein_name": "Inositol-3-phosphate synthase", "gene_name": "INO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46958-1", "protein_name": "IME2-dependent-signaling protein", "gene_name": "IDS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47007-1", "protein_name": "MIOREX complex component 5", "gene_name": "MRX5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47015-1", "protein_name": "Translation initiation factor IF-3, mitochondrial", "gene_name": "AIM23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14680-1", "protein_name": "Dual specificity protein kinase YAK1", "gene_name": "YAK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20433-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB4", "gene_name": "RPB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07259-1", "protein_name": "Multifunctional protein URA2", "gene_name": "URA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10081-1", "protein_name": "ATP-dependent RNA helicase eIF4A", "gene_name": "TIF1; TIF2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10566-1", "protein_name": "Mitochondrial RNA-splicing protein MRS3", "gene_name": "MRS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26725-1", "protein_name": "Probable mannosyltransferase YUR1", "gene_name": "YUR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39515-1", "protein_name": "Mitochondrial import inner membrane translocase subunit TIM17", "gene_name": "TIM17", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47005", "url": "https://www.uniprot.org/uniprotkb/P47005" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8813765", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rpa12p, a conserved RNA polymerase I subunit with two functional domains.", "journal": "Mol. Microbiol.", "date": "2002", "authors": "Van Mullem Vincent, Landrieux Emilie, Vandenhaute Jean, Thuriaux Pierre", "reference": { "type": "PubMed", "id": "11918799", "url": "https://pubmed.ncbi.nlm.nih.gov/11918799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47006-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA34", "gene_name": "RPA34", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50106-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA14", "gene_name": "RPA14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20435-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "RPO26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10964-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA190", "gene_name": "RPA190", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20434-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC1", "gene_name": "RPB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22138-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA135", "gene_name": "RPA135", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32529-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA12", "gene_name": "RPA12", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47006", "url": "https://www.uniprot.org/uniprotkb/P47006" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 10, "sequence_org": "C", "sequence_mut": "S", "comment": "Severe growth defect.", "evidence": [ { "database": "UniProtKB", "id": "P32529", "url": "https://www.uniprot.org/uniprotkb/P32529" }, { "database": "PubMed", "id": "11918799", "url": "https://pubmed.ncbi.nlm.nih.gov/11918799" } ], "uniprot_canonical_ac": "P32529-1" }, { "start_pos": 13, "end_pos": 13, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P32529", "url": "https://www.uniprot.org/uniprotkb/P32529" }, { "database": "PubMed", "id": "11918799", "url": "https://pubmed.ncbi.nlm.nih.gov/11918799" } ], "uniprot_canonical_ac": "P32529-1" }, { "start_pos": 30, "end_pos": 30, "sequence_org": "C", "sequence_mut": "S", "comment": "Limited growth defect.", "evidence": [ { "database": "UniProtKB", "id": "P32529", "url": "https://www.uniprot.org/uniprotkb/P32529" }, { "database": "PubMed", "id": "11918799", "url": "https://pubmed.ncbi.nlm.nih.gov/11918799" } ], "uniprot_canonical_ac": "P32529-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P32529", "url": "https://www.uniprot.org/uniprotkb/P32529" }, { "database": "PubMed", "id": "11918799", "url": "https://pubmed.ncbi.nlm.nih.gov/11918799" } ], "uniprot_canonical_ac": "P32529-1" } ], "record_id": "pubmed.11918799", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA polymerase I contains a TFIIF-related DNA-binding subcomplex.", "journal": "Molecular cell", "date": "2010-08-27", "authors": "Geiger Sebastian R, Lorenzen Kristina, Schreieck Amelie, Hanecker Patrizia, Kostrewa Dirk, Heck Albert J R, Cramer Patrick", "reference": { "type": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47006-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA34", "gene_name": "RPA34", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01080-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA49", "gene_name": "RPA49", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47006", "url": "https://www.uniprot.org/uniprotkb/P47006" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 325, "end_pos": 326, "sequence_org": "ED", "sequence_mut": "AA", "comment": "No effect on DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q01080", "url": "https://www.uniprot.org/uniprotkb/Q01080" }, { "database": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" } ], "uniprot_canonical_ac": "Q01080-1" }, { "start_pos": 356, "end_pos": 356, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of DNA binding; when associated with A-358.", "evidence": [ { "database": "UniProtKB", "id": "Q01080", "url": "https://www.uniprot.org/uniprotkb/Q01080" }, { "database": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" } ], "uniprot_canonical_ac": "Q01080-1" }, { "start_pos": 358, "end_pos": 358, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of DNA binding; when associated with A-356.", "evidence": [ { "database": "UniProtKB", "id": "Q01080", "url": "https://www.uniprot.org/uniprotkb/Q01080" }, { "database": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" } ], "uniprot_canonical_ac": "Q01080-1" }, { "start_pos": 359, "end_pos": 359, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q01080", "url": "https://www.uniprot.org/uniprotkb/Q01080" }, { "database": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" } ], "uniprot_canonical_ac": "Q01080-1" }, { "start_pos": 365, "end_pos": 365, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q01080", "url": "https://www.uniprot.org/uniprotkb/Q01080" }, { "database": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" } ], "uniprot_canonical_ac": "Q01080-1" }, { "start_pos": 393, "end_pos": 393, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q01080", "url": "https://www.uniprot.org/uniprotkb/Q01080" }, { "database": "PubMed", "id": "20797630", "url": "https://pubmed.ncbi.nlm.nih.gov/20797630" } ], "uniprot_canonical_ac": "Q01080-1" } ], "record_id": "pubmed.20797630", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A34.5, a nonessential component of yeast RNA polymerase I, cooperates with subunit A14 and DNA topoisomerase I to produce a functional rRNA synthesis machine.", "journal": "Molecular and cellular biology", "date": "1997-04", "authors": "Gadal O, Mariotte-Labarre S, Chedin S, Quemeneur E, Carles C, Sentenac A, Thuriaux P", "reference": { "type": "PubMed", "id": "9121426", "url": "https://pubmed.ncbi.nlm.nih.gov/9121426" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47006-1", "protein_name": "DNA-directed RNA polymerase I subunit RPA34", "gene_name": "RPA34", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47006", "url": "https://www.uniprot.org/uniprotkb/P47006" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9121426", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel family of nonclassic yeast phosphatidylinositol transfer proteins whose function modulates phospholipase D activity and Sec14p-independent cell growth.", "journal": "Molecular biology of the cell", "date": "2000-06", "authors": "Li X, Routt S M, Xie Z, Cui X, Fang M, Kearns M A, Bard M, Kirsch D R, Bankaitis V A", "reference": { "type": "PubMed", "id": "10848624", "url": "https://pubmed.ncbi.nlm.nih.gov/10848624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47008-1", "protein_name": "Phosphatidylinositol transfer protein SFH5", "gene_name": "SFH5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53844-1", "protein_name": "Phosphatidylinositol transfer protein PDR17", "gene_name": "PDR17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53860-1", "protein_name": "Phosphatidylinositol transfer protein PDR16", "gene_name": "PDR16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06705-1", "protein_name": "Phosphatidylinositol transfer protein CSR1", "gene_name": "CSR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P24280-1", "protein_name": "SEC14 cytosolic factor", "gene_name": "SEC14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47008", "url": "https://www.uniprot.org/uniprotkb/P47008" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10848624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subcellular localization of yeast Sec14 homologues and their involvement in regulation of phospholipid turnover.", "journal": "European journal of biochemistry", "date": "2003-08", "authors": "Schnabl Martina, Oskolkova Olga V, Holic Roman, Brezn\u00e1 Barbara, Pichler Harald, Z\u00e1gorsek Milos, Kohlwein Sepp D, Paltauf Fritz, Daum G\u00fcnther, Griac Peter", "reference": { "type": "PubMed", "id": "12869188", "url": "https://pubmed.ncbi.nlm.nih.gov/12869188" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47008-1", "protein_name": "Phosphatidylinositol transfer protein SFH5", "gene_name": "SFH5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53844-1", "protein_name": "Phosphatidylinositol transfer protein PDR17", "gene_name": "PDR17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53860-1", "protein_name": "Phosphatidylinositol transfer protein PDR16", "gene_name": "PDR16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06705-1", "protein_name": "Phosphatidylinositol transfer protein CSR1", "gene_name": "CSR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P24280-1", "protein_name": "SEC14 cytosolic factor", "gene_name": "SEC14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47008", "url": "https://www.uniprot.org/uniprotkb/P47008" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12869188", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sec14p-like proteins regulate phosphoinositide homoeostasis and intracellular protein and lipid trafficking in yeast.", "journal": "Biochemical Society transactions", "date": "2006-06", "authors": "Mousley C J, Tyeryar K R, Ryan M M, Bankaitis V A", "reference": { "type": "PubMed", "id": "16709158", "url": "https://pubmed.ncbi.nlm.nih.gov/16709158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47008-1", "protein_name": "Phosphatidylinositol transfer protein SFH5", "gene_name": "SFH5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47008", "url": "https://www.uniprot.org/uniprotkb/P47008" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16709158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Sec14-like phosphatidylinositol transfer protein paralog defines a novel class of heme-binding proteins.", "journal": "eLife", "date": "2020-08-11", "authors": "Khan Danish, Lee Dongju, Gulten Gulcin, Aggarwal Anup, Wofford Joshua, Krieger Inna, Tripathi Ashutosh, Patrick John W, Eckert Debra M, Laganowsky Arthur, Sacchettini James, Lindahl Paul, Bankaitis Vytas A", "reference": { "type": "PubMed", "id": "32780017", "url": "https://pubmed.ncbi.nlm.nih.gov/32780017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47008-1", "protein_name": "Phosphatidylinositol transfer protein SFH5", "gene_name": "SFH5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47008", "url": "https://www.uniprot.org/uniprotkb/P47008" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.32780017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast glycogenin (Glg2p) produced in Escherichia coli is simultaneously glucosylated at two vicinal tyrosine residues but results in a reduced bacterial glycogen accumulation.", "journal": "European journal of biochemistry", "date": "2004-10", "authors": "Albrecht Tanja, Haebel Sophie, Koch Anke, Krause Ulrike, Eckermann Nora, Steup Martin", "reference": { "type": "PubMed", "id": "15479227", "url": "https://pubmed.ncbi.nlm.nih.gov/15479227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47011-1", "protein_name": "Glycogenin-2", "gene_name": "GLG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "Y", "relation": "attached", "comment": "O-linked (Glc...) tyrosine;O-glucosylation", "icn3d_view": {}, "start_pos": 230, "start_aa": "Tyr", "end_pos": 230, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr230", "evidence": [ { "id": "P47011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47011#ptm_processing" }, { "id": "15479227", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15479227" } ], "filter_code": "000000000000000000100.00000000100000.00.01100", "uniprot_canonical_ac": "P47011-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "Y", "relation": "attached", "comment": "O-linked (Glc...) tyrosine;O-glucosylation", "icn3d_view": {}, "start_pos": 232, "start_aa": "Tyr", "end_pos": 232, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr232", "evidence": [ { "id": "P47011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47011#ptm_processing" }, { "id": "15479227", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15479227" } ], "filter_code": "000000000000000000100.00000000100000.00.01100", "uniprot_canonical_ac": "P47011-1" } ], "record_id": "pubmed.15479227", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg45 is an autophagy receptor for glycogen, a non-preferred cargo of bulk autophagy in yeast.", "journal": "IScience", "date": "2024", "authors": "Isoda Takahiro, Takeda Eigo, Hosokawa Sachiko, Hotta-Ren Shukun, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "38832010", "url": "https://pubmed.ncbi.nlm.nih.gov/38832010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47011-1", "protein_name": "Glycogenin-2", "gene_name": "GLG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47057-1", "protein_name": "Sorting nexin-4", "gene_name": "SNX4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36143-1", "protein_name": "Glycogenin-1", "gene_name": "GLG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40543-1", "protein_name": "Autophagy receptor ATG45", "gene_name": "ATG45", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32775-1", "protein_name": "1,4-alpha-glucan-branching enzyme", "gene_name": "GLC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27472-1", "protein_name": "Glycogen [starch] synthase isoform 2", "gene_name": "GSY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06738-1", "protein_name": "Glycogen phosphorylase", "gene_name": "GPH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 127, "end_pos": 130, "sequence_org": "YVNL", "sequence_mut": "AVNA", "comment": "Decreases interaction with ATG8.", "evidence": [ { "database": "UniProtKB", "id": "P40543", "url": "https://www.uniprot.org/uniprotkb/P40543" }, { "database": "PubMed", "id": "38832010", "url": "https://pubmed.ncbi.nlm.nih.gov/38832010" } ], "uniprot_canonical_ac": "P40543-1" }, { "start_pos": 176, "end_pos": 187, "sequence_org": "LMCIAKKVKTYW", "sequence_mut": "AMCAAKKAKTAA", "comment": "Impairs glycophagy (autophagy of glycogen).", "evidence": [ { "database": "UniProtKB", "id": "P40543", "url": "https://www.uniprot.org/uniprotkb/P40543" }, { "database": "PubMed", "id": "38832010", "url": "https://pubmed.ncbi.nlm.nih.gov/38832010" } ], "uniprot_canonical_ac": "P40543-1" } ], "record_id": "pubmed.38832010", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement of the self-glucosylating initiator proteins Glg1p and Glg2p for glycogen accumulation in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "1995-12", "authors": "Cheng C, Mu J, Farkas I, Huang D, Goebl M G, Roach P J", "reference": { "type": "PubMed", "id": "8524228", "url": "https://pubmed.ncbi.nlm.nih.gov/8524228" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47011-1", "protein_name": "Glycogenin-2", "gene_name": "GLG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36143-1", "protein_name": "Glycogenin-1", "gene_name": "GLG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10081-1", "protein_name": "ATP-dependent RNA helicase eIF4A", "gene_name": "TIF1; TIF2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8524228", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Initiation of glycogen synthesis in yeast. Requirement of multiple tyrosine residues for function of the self-glucosylating Glg proteins in vivo.", "journal": "The Journal of biological chemistry", "date": "1996-10-25", "authors": "Mu J, Cheng C, Roach P J", "reference": { "type": "PubMed", "id": "8900126", "url": "https://pubmed.ncbi.nlm.nih.gov/8900126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47011-1", "protein_name": "Glycogenin-2", "gene_name": "GLG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36143-1", "protein_name": "Glycogenin-1", "gene_name": "GLG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 230, "end_pos": 230, "sequence_org": "Y", "sequence_mut": "F", "comment": "Eliminates glycogen accumulation; when associated with F-232 and F-367.", "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" }, { "database": "PubMed", "id": "8900126", "url": "https://pubmed.ncbi.nlm.nih.gov/8900126" } ], "uniprot_canonical_ac": "P47011-1" }, { "start_pos": 232, "end_pos": 232, "sequence_org": "Y", "sequence_mut": "F", "comment": "Eliminates glycogen accumulation; when associated with F-230 and F-367.", "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" }, { "database": "PubMed", "id": "8900126", "url": "https://pubmed.ncbi.nlm.nih.gov/8900126" } ], "uniprot_canonical_ac": "P47011-1" }, { "start_pos": 367, "end_pos": 367, "sequence_org": "Y", "sequence_mut": "F", "comment": "Eliminates glycogen accumulation; when associated with F-230 and F-232.", "evidence": [ { "database": "UniProtKB", "id": "P47011", "url": "https://www.uniprot.org/uniprotkb/P47011" }, { "database": "PubMed", "id": "8900126", "url": "https://pubmed.ncbi.nlm.nih.gov/8900126" } ], "uniprot_canonical_ac": "P47011-1" }, { "start_pos": 230, "end_pos": 230, "sequence_org": "Y", "sequence_mut": "F", "comment": "Eliminates glycogen accumulation; when associated with F-598.", "evidence": [ { "database": "UniProtKB", "id": "P36143", "url": "https://www.uniprot.org/uniprotkb/P36143" }, { "database": "PubMed", "id": "8900126", "url": "https://pubmed.ncbi.nlm.nih.gov/8900126" } ], "uniprot_canonical_ac": "P36143-1" }, { "start_pos": 598, "end_pos": 598, "sequence_org": "Y", "sequence_mut": "F", "comment": "Eliminates glycogen accumulation; when associated with F-230.", "evidence": [ { "database": "UniProtKB", "id": "P36143", "url": "https://www.uniprot.org/uniprotkb/P36143" }, { "database": "PubMed", "id": "8900126", "url": "https://pubmed.ncbi.nlm.nih.gov/8900126" } ], "uniprot_canonical_ac": "P36143-1" } ], "record_id": "pubmed.8900126", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The dihydrosphingosine-1-phosphate phosphatases of Saccharomyces cerevisiae are important regulators of cell proliferation and heat stress responses.", "journal": "The Biochemical journal", "date": "1999-09-15", "authors": "Mao C, Saba J D, Obeid L M", "reference": { "type": "PubMed", "id": "10477278", "url": "https://pubmed.ncbi.nlm.nih.gov/10477278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23501-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase YSR3", "gene_name": "YSR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10477278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast sphingosine-1-phosphate phosphatases: assay, expression, deletion, purification, and cellular localization by GFP tagging.", "journal": "Methods in enzymology", "date": "2000", "authors": "Mao C, Obeid L M", "reference": { "type": "PubMed", "id": "10563329", "url": "https://pubmed.ncbi.nlm.nih.gov/10563329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23501-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase YSR3", "gene_name": "YSR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10563329", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sphingoid base synthesis requirement for endocytosis in Saccharomyces cerevisiae.", "journal": "The EMBO journal", "date": "2000-06-15", "authors": "Zanolari B, Friant S, Funato K, S\u00fctterlin C, Stevenson B J, Riezman H", "reference": { "type": "PubMed", "id": "10856228", "url": "https://pubmed.ncbi.nlm.nih.gov/10856228" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23501-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase YSR3", "gene_name": "YSR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10856228", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation.", "journal": "The Journal of biological chemistry", "date": "2001-04-13", "authors": "Birchwood C J, Saba J D, Dickson R C, Cunningham K W", "reference": { "type": "PubMed", "id": "11278643", "url": "https://pubmed.ncbi.nlm.nih.gov/11278643" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06147-1", "protein_name": "Sphingoid long chain base kinase 5", "gene_name": "LCB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12246-1", "protein_name": "Sphingoid long chain base kinase 4", "gene_name": "LCB4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11278643", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast.", "journal": "Yeast (Chichester, England)", "date": "2002-05", "authors": "Ferguson-Yankey Stacey R, Skrzypek Marek S, Lester Robert L, Dickson Robert C", "reference": { "type": "PubMed", "id": "11967828", "url": "https://pubmed.ncbi.nlm.nih.gov/11967828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12246-1", "protein_name": "Sphingoid long chain base kinase 4", "gene_name": "LCB4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11967828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lcb4p is a key regulator of ceramide synthesis from exogenous long chain sphingoid base in Saccharomyces cerevisiae.", "journal": "The Journal of biological chemistry", "date": "2003-02-28", "authors": "Funato Kouichi, Lombardi Ruben, Vallee Beatrice, Riezman Howard", "reference": { "type": "PubMed", "id": "12493772", "url": "https://pubmed.ncbi.nlm.nih.gov/12493772" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06147-1", "protein_name": "Sphingoid long chain base kinase 5", "gene_name": "LCB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12246-1", "protein_name": "Sphingoid long chain base kinase 4", "gene_name": "LCB4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12493772", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p.", "journal": "Eukaryotic cell", "date": "2003-04", "authors": "Kobayashi Scott D, Nagiec Marek M", "reference": { "type": "PubMed", "id": "12684378", "url": "https://pubmed.ncbi.nlm.nih.gov/12684378" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12684378", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transmembrane topology of sphingoid long-chain base-1-phosphate phosphatase, Lcb3p.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2003-06", "authors": "Kihara Akio, Sano Takamitsu, Iwaki Soichiro, Igarashi Yasuyuki", "reference": { "type": "PubMed", "id": "12786943", "url": "https://pubmed.ncbi.nlm.nih.gov/12786943" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04396-1", "protein_name": "Lipid phosphate phosphatase 1", "gene_name": "LPP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 128, "end_pos": 128, "sequence_org": "K", "sequence_mut": "A", "comment": "Impairs dihydrosphingosine 1-phosphate phosphatase activity.", "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" }, { "database": "PubMed", "id": "12786943", "url": "https://pubmed.ncbi.nlm.nih.gov/12786943" } ], "uniprot_canonical_ac": "P47013-1" }, { "start_pos": 160, "end_pos": 160, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs dihydrosphingosine 1-phosphate phosphatase activity.", "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" }, { "database": "PubMed", "id": "12786943", "url": "https://pubmed.ncbi.nlm.nih.gov/12786943" } ], "uniprot_canonical_ac": "P47013-1" }, { "start_pos": 210, "end_pos": 210, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs dihydrosphingosine 1-phosphate phosphatase activity.", "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" }, { "database": "PubMed", "id": "12786943", "url": "https://pubmed.ncbi.nlm.nih.gov/12786943" } ], "uniprot_canonical_ac": "P47013-1" } ], "record_id": "pubmed.12786943", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the phytosphingosine metabolic pathway leading to odd-numbered fatty acids.", "journal": "Nature communications", "date": "2014-10-27", "authors": "Kondo Natsuki, Ohno Yusuke, Yamagata Maki, Obara Takashi, Seki Naoya, Kitamura Takuya, Naganuma Tatsuro, Kihara Akio", "reference": { "type": "PubMed", "id": "25345524", "url": "https://pubmed.ncbi.nlm.nih.gov/25345524" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05567-1", "protein_name": "Sphingosine-1-phosphate lyase", "gene_name": "DPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06147-1", "protein_name": "Sphingoid long chain base kinase 5", "gene_name": "LCB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12246-1", "protein_name": "Sphingoid long chain base kinase 4", "gene_name": "LCB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23501-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase YSR3", "gene_name": "YSR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25338-1", "protein_name": "2-hydroxy-palmitic acid dioxygenase MPO1", "gene_name": "MPO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.25345524", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a Saccharomyces gene, LCB3, necessary for incorporation of exogenous long chain bases into sphingolipids.", "journal": "The Journal of biological chemistry", "date": "1997-06-27", "authors": "Qie L, Nagiec M M, Baltisberger J A, Lester R L, Dickson R C", "reference": { "type": "PubMed", "id": "9195906", "url": "https://pubmed.ncbi.nlm.nih.gov/9195906" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9195906", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of Saccharomyces cerevisiae dihydrosphingosine-1-phosphate phosphatase.", "journal": "The Journal of biological chemistry", "date": "1997-11-07", "authors": "Mao C, Wadleigh M, Jenkins G M, Hannun Y A, Obeid L M", "reference": { "type": "PubMed", "id": "9353337", "url": "https://pubmed.ncbi.nlm.nih.gov/9353337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23501-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase YSR3", "gene_name": "YSR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9353337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sphingoid base 1-phosphate phosphatase: a key regulator of sphingolipid metabolism and stress response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998-01-06", "authors": "Mandala S M, Thornton R, Tu Z, Kurtz M B, Nickels J, Broach J, Menzeleev R, Spiegel S", "reference": { "type": "PubMed", "id": "9419344", "url": "https://pubmed.ncbi.nlm.nih.gov/9419344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47013-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase LCB3", "gene_name": "LCB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23501-1", "protein_name": "Dihydrosphingosine 1-phosphate phosphatase YSR3", "gene_name": "YSR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47013", "url": "https://www.uniprot.org/uniprotkb/P47013" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9419344", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the worm NitFhit Rosetta stone protein reveals a Nit tetramer binding two Fhit dimers.", "journal": "Curr. Biol.", "date": "2000", "authors": "Pace H C, Hodawadekar S C, Draganescu A, Huang J, Bieganowski P, Pekarsky Y, Croce C M, Brenner C", "reference": { "type": "PubMed", "id": "10959838", "url": "https://pubmed.ncbi.nlm.nih.gov/10959838" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47016-1", "protein_name": "Deaminated glutathione amidase", "gene_name": "NIT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9JHW2-1", "protein_name": "Omega-amidase NIT2", "gene_name": "Nit2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NQR4-1", "protein_name": "Omega-amidase NIT2", "gene_name": "NIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49954-1", "protein_name": "Omega-amidase NIT3", "gene_name": "NIT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47016", "url": "https://www.uniprot.org/uniprotkb/P47016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10959838", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structures of enzyme-intermediate complexes of yeast Nit2: insights into its catalytic mechanism and different substrate specificity compared with mammalian Nit2.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2013-08", "authors": "Liu Hejun, Gao Yongxiang, Zhang Mengying, Qiu Xiaoting, Cooper Arthur J L, Niu Liwen, Teng Maikun", "reference": { "type": "PubMed", "id": "23897470", "url": "https://pubmed.ncbi.nlm.nih.gov/23897470" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47016-1", "protein_name": "Deaminated glutathione amidase", "gene_name": "NIT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47016", "url": "https://www.uniprot.org/uniprotkb/P47016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 169, "end_pos": 169, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "P47016", "url": "https://www.uniprot.org/uniprotkb/P47016" }, { "database": "PubMed", "id": "23897470", "url": "https://pubmed.ncbi.nlm.nih.gov/23897470" } ], "uniprot_canonical_ac": "P47016-1" } ], "record_id": "pubmed.23897470", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nit1 is a metabolite repair enzyme that hydrolyzes deaminated glutathione.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Peracchi A, Veiga-da-Cunha M, Kuhara T, Ellens KW, Paczia N, Stroobant V, Seliga AK, Marlaire S, Jaisson S, Bommer GT, Sun J, Huebner K, Linster CL, Cooper AJL, Van Schaftingen E", "reference": { "type": "PubMed", "id": "28373563", "url": "https://pubmed.ncbi.nlm.nih.gov/28373563" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47016-1", "protein_name": "Deaminated glutathione amidase", "gene_name": "NIT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8VDK1-1", "protein_name": "Deaminated glutathione amidase", "gene_name": "Nit1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JHW2-1", "protein_name": "Omega-amidase NIT2", "gene_name": "Nit2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49954-1", "protein_name": "Omega-amidase NIT3", "gene_name": "NIT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47016", "url": "https://www.uniprot.org/uniprotkb/P47016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.28373563", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequencing analysis of a 40.2 kb fragment of yeast chromosome X reveals 19 open reading frames including URA2 (5' end), TRK1, PBS2, SPT10, GCD14, RPE1, PHO86, NCA3, ASF1, CCT7, GZF3, two tRNA genes, three remnant delta elements and a Ty4 transposon.", "journal": "Yeast", "date": "1996", "authors": "Cziepluch C, Kordes E, Pujol A, Jauniaux J C", "reference": { "type": "PubMed", "id": "8948101", "url": "https://pubmed.ncbi.nlm.nih.gov/8948101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47016-1", "protein_name": "Deaminated glutathione amidase", "gene_name": "NIT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47024-1", "protein_name": "Transposon Ty4-J Gag-Pol polyprotein", "gene_name": "TY4B-J", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35208-1", "protein_name": "Protein SPT10", "gene_name": "SPT10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47022-1", "protein_name": "Uncharacterized protein YJL118W", "gene_name": "J0742", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47023-1", "protein_name": "Transposon Ty4-J Gag polyprotein", "gene_name": "TY4A-J", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47019-1", "protein_name": "Ribosome biogenesis protein ALB1", "gene_name": "ALB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P42943-1", "protein_name": "T-complex protein 1 subunit eta", "gene_name": "CCT7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P42944-1", "protein_name": "Protein GZF3", "gene_name": "GZF3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46955-1", "protein_name": "Beta-glucosidase-like protein NCA3, mitochondrial", "gene_name": "NCA3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46956-1", "protein_name": "Inorganic phosphate transporter PHO86", "gene_name": "PHO86", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46969-1", "protein_name": "Ribulose-phosphate 3-epimerase", "gene_name": "RPE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47018-1", "protein_name": "Maintenance of telomere capping protein 1", "gene_name": "MTC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07259-1", "protein_name": "Multifunctional protein URA2", "gene_name": "URA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P08018-1", "protein_name": "MAP kinase kinase PBS2", "gene_name": "PBS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32447-1", "protein_name": "Histone chaperone ASF1", "gene_name": "ASF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P12685-1", "protein_name": "High-affinity potassium transport protein", "gene_name": "TRK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46959-1", "protein_name": "tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61", "gene_name": "GCD14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47017-1", "protein_name": "LSM1-LSM7 complex subunit LSM1", "gene_name": "LSM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47016", "url": "https://www.uniprot.org/uniprotkb/P47016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8948101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ty4, a new retrotransposon from Saccharomyces cerevisiae, flanked by tau-elements.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Janetzky B, Lehle L", "reference": { "type": "PubMed", "id": "1328182", "url": "https://pubmed.ncbi.nlm.nih.gov/1328182" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47024-1", "protein_name": "Transposon Ty4-J Gag-Pol polyprotein", "gene_name": "TY4B-J", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47023-1", "protein_name": "Transposon Ty4-J Gag polyprotein", "gene_name": "TY4A-J", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47024", "url": "https://www.uniprot.org/uniprotkb/P47024" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1328182", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gag3p, an outer membrane protein required for fission of mitochondrial tubules.", "journal": "The Journal of cell biology", "date": "2000-10-16", "authors": "Fekkes P, Shepard K A, Yaffe M P", "reference": { "type": "PubMed", "id": "11038180", "url": "https://pubmed.ncbi.nlm.nih.gov/11038180" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11038180", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mdv1p is a WD repeat protein that interacts with the dynamin-related GTPase, Dnm1p, to trigger mitochondrial division.", "journal": "The Journal of cell biology", "date": "2000-10-16", "authors": "Tieu Q, Nunnari J", "reference": { "type": "PubMed", "id": "11038182", "url": "https://pubmed.ncbi.nlm.nih.gov/11038182" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40515-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54861-1", "protein_name": "Dynamin-related protein DNM1", "gene_name": "DNM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11038182", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dnm1p GTPase-mediated mitochondrial fission is a multi-step process requiring the novel integral membrane component Fis1p.", "journal": "The Journal of cell biology", "date": "2000-10-16", "authors": "Mozdy A D, McCaffery J M, Shaw J M", "reference": { "type": "PubMed", "id": "11038183", "url": "https://pubmed.ncbi.nlm.nih.gov/11038183" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40515-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11038183", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The WD repeat protein, Mdv1p, functions as a molecular adaptor by interacting with Dnm1p and Fis1p during mitochondrial fission.", "journal": "The Journal of cell biology", "date": "2002-08-05", "authors": "Tieu Quinton, Okreglak Voytek, Naylor Kari, Nunnari Jodi", "reference": { "type": "PubMed", "id": "12163467", "url": "https://pubmed.ncbi.nlm.nih.gov/12163467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40515-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 80, "end_pos": 80, "sequence_org": "L", "sequence_mut": "P", "comment": "In fis1-L80P; no interaction with MDV1; mitochondrial fission is blocked; DNM1 assembly at punctate structures normal as in wild-type.", "evidence": [ { "database": "UniProtKB", "id": "P40515", "url": "https://www.uniprot.org/uniprotkb/P40515" }, { "database": "PubMed", "id": "12163467", "url": "https://pubmed.ncbi.nlm.nih.gov/12163467" } ], "uniprot_canonical_ac": "P40515-1" } ], "record_id": "pubmed.12163467", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The WD-repeats of Net2p interact with Dnm1p and Fis1p to regulate division of mitochondria.", "journal": "Molecular biology of the cell", "date": "2003-10", "authors": "Cerveny Kara L, Jensen Robert E", "reference": { "type": "PubMed", "id": "14517324", "url": "https://pubmed.ncbi.nlm.nih.gov/14517324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40515-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54861-1", "protein_name": "Dynamin-related protein DNM1", "gene_name": "DNM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 400, "end_pos": 400, "sequence_org": "F", "sequence_mut": "A", "comment": "No interaction with FIS1; slight decrease in interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "14517324", "url": "https://pubmed.ncbi.nlm.nih.gov/14517324" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 461, "end_pos": 461, "sequence_org": "R", "sequence_mut": "A", "comment": "Slight decrease in interaction with FIS1; 20-fold decrease in interaction with DNM1; even distribution along mitochondria not punctate.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "14517324", "url": "https://pubmed.ncbi.nlm.nih.gov/14517324" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 664, "end_pos": 664, "sequence_org": "D", "sequence_mut": "A", "comment": "Slight decrease in interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "14517324", "url": "https://pubmed.ncbi.nlm.nih.gov/14517324" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 689, "end_pos": 689, "sequence_org": "S", "sequence_mut": "A", "comment": "Slight decrease in interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "14517324", "url": "https://pubmed.ncbi.nlm.nih.gov/14517324" } ], "uniprot_canonical_ac": "P47025-1" } ], "record_id": "pubmed.14517324", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel structure of the N terminus in yeast Fis1 correlates with a specialized function in mitochondrial fission.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Suzuki Motoshi, Neutzner Albert, Tjandra Nico, Youle Richard J", "reference": { "type": "PubMed", "id": "15809300", "url": "https://pubmed.ncbi.nlm.nih.gov/15809300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40515-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15809300", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The WD40 protein Caf4p is a component of the mitochondrial fission machinery and recruits Dnm1p to mitochondria.", "journal": "J. Cell Biol.", "date": "2005", "authors": "Griffin Erik E, Graumann Johannes, Chan David C", "reference": { "type": "PubMed", "id": "16009724", "url": "https://pubmed.ncbi.nlm.nih.gov/16009724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36130-1", "protein_name": "CCR4-associated factor 4", "gene_name": "CAF4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16009724", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of Fis1p-Mdv1p interactions in mitochondrial fission complex assembly.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Karren MA, Coonrod EM, Anderson TK, Shaw JM", "reference": { "type": "PubMed", "id": "16247028", "url": "https://pubmed.ncbi.nlm.nih.gov/16247028" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 250, "end_pos": 250, "sequence_org": "E", "sequence_mut": "G", "comment": "Suppresses the mitochondrial fission defect of a FIS1-3 mutant by affecting interaction with FIS1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "16247028", "url": "https://pubmed.ncbi.nlm.nih.gov/16247028" } ], "uniprot_canonical_ac": "P47025-1" } ], "record_id": "pubmed.16247028", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mdv1 interacts with assembled dnm1 to promote mitochondrial division.", "journal": "The Journal of biological chemistry", "date": "2006-01-27", "authors": "Naylor Kari, Ingerman Elena, Okreglak Voytek, Marino Michael, Hinshaw Jenny E, Nunnari Jodi", "reference": { "type": "PubMed", "id": "16272155", "url": "https://pubmed.ncbi.nlm.nih.gov/16272155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 148, "end_pos": 148, "sequence_org": "L", "sequence_mut": "P", "comment": "Abolishes interaction with FIS1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "16272155", "url": "https://pubmed.ncbi.nlm.nih.gov/16272155" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 440, "end_pos": 440, "sequence_org": "H", "sequence_mut": "E", "comment": "Abolishes interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "16272155", "url": "https://pubmed.ncbi.nlm.nih.gov/16272155" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 440, "end_pos": 440, "sequence_org": "H", "sequence_mut": "N", "comment": "Abolishes interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "16272155", "url": "https://pubmed.ncbi.nlm.nih.gov/16272155" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 544, "end_pos": 544, "sequence_org": "N", "sequence_mut": "R", "comment": "Results in mitochondrial division defect, but has no effect on the interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "16272155", "url": "https://pubmed.ncbi.nlm.nih.gov/16272155" } ], "uniprot_canonical_ac": "P47025-1" }, { "start_pos": 605, "end_pos": 605, "sequence_org": "H", "sequence_mut": "E", "comment": "Abolishes interaction with DNM1.", "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" }, { "database": "PubMed", "id": "16272155", "url": "https://pubmed.ncbi.nlm.nih.gov/16272155" } ], "uniprot_canonical_ac": "P47025-1" } ], "record_id": "pubmed.16272155", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dimeric Dnm1-G385D interacts with Mdv1 on mitochondria and can be stimulated to assemble into fission complexes containing Mdv1 and Fis1.", "journal": "The Journal of biological chemistry", "date": "2006-06-23", "authors": "Bhar Debjani, Karren Mary Anne, Babst Markus, Shaw Janet M", "reference": { "type": "PubMed", "id": "16601120", "url": "https://pubmed.ncbi.nlm.nih.gov/16601120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16601120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Koirala S, Guo Q, Kalia R, Bui HT, Eckert DM, Frost A, Shaw JM", "reference": { "type": "PubMed", "id": "23530241", "url": "https://pubmed.ncbi.nlm.nih.gov/23530241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47025-1", "protein_name": "Mitochondrial division protein 1", "gene_name": "MDV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40515-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54861-1", "protein_name": "Dynamin-related protein DNM1", "gene_name": "DNM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q96C03-1", "protein_name": "Mitochondrial dynamics protein MID49", "gene_name": "MIEF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQG6-1", "protein_name": "Mitochondrial dynamics protein MIEF1", "gene_name": "MIEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3D6-1", "protein_name": "Mitochondrial fission 1 protein", "gene_name": "FIS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00429-1", "protein_name": "Dynamin-1-like protein", "gene_name": "DNM1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZY8-1", "protein_name": "Mitochondrial fission factor", "gene_name": "MFF", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47025", "url": "https://www.uniprot.org/uniprotkb/P47025" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23530241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GWT1 gene is required for inositol acylation of glycosylphosphatidylinositol anchors in yeast.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Umemura M, Okamoto M, Nakayama K, Sagane K, Tsukahara K, Hata K, Jigami Y", "reference": { "type": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47026-1", "protein_name": "GPI-anchored wall transfer protein 1", "gene_name": "GWT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 209, "end_pos": 209, "sequence_org": "L", "sequence_mut": "P", "comment": "In gwt1-28; temperature sensitive mutant that induces a delay in export of GPI-anchored proteins; when associated with D-259.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" } ], "uniprot_canonical_ac": "P47026-1" }, { "start_pos": 259, "end_pos": 259, "sequence_org": "V", "sequence_mut": "D", "comment": "In gwt1-28; temperature sensitive mutant that induces a delay in export of GPI-anchored proteins; when associated with P-209.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" } ], "uniprot_canonical_ac": "P47026-1" }, { "start_pos": 330, "end_pos": 330, "sequence_org": "N", "sequence_mut": "S", "comment": "In gwt1-16; temperature sensitive mutant that induces a delay in export of GPI-anchored proteins; when associated with P-362 and A-479.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" } ], "uniprot_canonical_ac": "P47026-1" }, { "start_pos": 362, "end_pos": 362, "sequence_org": "L", "sequence_mut": "P", "comment": "In gwt1-16; temperature sensitive mutant that induces a delay in export of GPI-anchored proteins; when associated with S-330 and A-479.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" } ], "uniprot_canonical_ac": "P47026-1" }, { "start_pos": 479, "end_pos": 479, "sequence_org": "V", "sequence_mut": "A", "comment": "In gwt1-16; temperature sensitive mutant that induces a delay in export of GPI-anchored proteins; when associated with S-330 and P-362.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" } ], "uniprot_canonical_ac": "P47026-1" }, { "start_pos": 63, "end_pos": 64, "sequence_org": "WV", "sequence_mut": "RA", "comment": "In gwt1-20; temperature sensitive mutant that induces a delay in export of GPI-anchored proteins.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12714589", "url": "https://pubmed.ncbi.nlm.nih.gov/12714589" } ], "uniprot_canonical_ac": "P47026-1" } ], "record_id": "pubmed.12714589", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Medicinal genetics approach towards identifying the molecular target of a novel inhibitor of fungal cell wall assembly.", "journal": "Molecular microbiology", "date": "2003-05", "authors": "Tsukahara Kappei, Hata Katsura, Nakamoto Kazutaka, Sagane Koji, Watanabe Nao-Aki, Kuromitsu Junro, Kai Junko, Tsuchiya Mamiko, Ohba Fuminori, Jigami Yoshifumi, Yoshimatsu Kentaro, Nagasu Takeshi", "reference": { "type": "PubMed", "id": "12753194", "url": "https://pubmed.ncbi.nlm.nih.gov/12753194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47026-1", "protein_name": "GPI-anchored wall transfer protein 1", "gene_name": "GWT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 132, "end_pos": 132, "sequence_org": "G", "sequence_mut": "R", "comment": "Resistant to the drug 1-[4-butylbenzyl]isoquinoline (BIQ).", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12753194", "url": "https://pubmed.ncbi.nlm.nih.gov/12753194" } ], "uniprot_canonical_ac": "P47026-1" }, { "start_pos": 397, "end_pos": 397, "sequence_org": "V", "sequence_mut": "I", "comment": "Resistant to the drug 1-[4-butylbenzyl]isoquinoline (BIQ).", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "12753194", "url": "https://pubmed.ncbi.nlm.nih.gov/12753194" } ], "uniprot_canonical_ac": "P47026-1" } ], "record_id": "pubmed.12753194", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycosylphosphatidylinositol-anchored proteins are required for the transport of detergent-resistant microdomain-associated membrane proteins Tat2p and Fur4p.", "journal": "The Journal of biological chemistry", "date": "2006-02-17", "authors": "Okamoto Michiyo, Yoko-o Takehiko, Umemura Mariko, Nakayama Ken-Ichi, Jigami Yoshifumi", "reference": { "type": "PubMed", "id": "16361252", "url": "https://pubmed.ncbi.nlm.nih.gov/16361252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47026-1", "protein_name": "GPI-anchored wall transfer protein 1", "gene_name": "GWT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 8, "end_pos": 8, "sequence_org": "K", "sequence_mut": "E", "comment": "In gwt1-10; impairs the transport of detergent-resistant microdomain-associated membrane proteins TAT2 and FUR4.", "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" }, { "database": "PubMed", "id": "16361252", "url": "https://pubmed.ncbi.nlm.nih.gov/16361252" } ], "uniprot_canonical_ac": "P47026-1" } ], "record_id": "pubmed.16361252", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of a 33.1 kb fragment from the left arm of Saccharomyces cerevisiae chromosome X, including putative proteins with leucine zippers, a fungal Zn(II)2-Cys6 binuclear cluster domain and a putative alpha 2-SCB-alpha 2 binding site.", "journal": "Yeast", "date": "1995", "authors": "Miosga T, Schaaff-Gerstenschl\u00e4ger I, Chalwatzis N, Baur A, Boles E, Fournier C, Schmitt S, Velten C, Wilhelm N, Zimmermann F K", "reference": { "type": "PubMed", "id": "7483841", "url": "https://pubmed.ncbi.nlm.nih.gov/7483841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47026-1", "protein_name": "GPI-anchored wall transfer protein 1", "gene_name": "GWT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47029-1", "protein_name": "Arrestin-related trafficking adapter 3", "gene_name": "ALY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47030-1", "protein_name": "Protein TAX4", "gene_name": "TAX4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47032-1", "protein_name": "Protein PRY1", "gene_name": "PRY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P80428-1", "protein_name": "Actin-related protein 4", "gene_name": "ARP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46954-1", "protein_name": "Protein SIP4", "gene_name": "SIP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47031-1", "protein_name": "Inclusion body clearance protein IML2", "gene_name": "IML2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19658-1", "protein_name": "Exocyst complex component EXO70", "gene_name": "EXO70", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47027-1", "protein_name": "DNA replication regulator DPB11", "gene_name": "DPB11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P05150-1", "protein_name": "Ornithine carbamoyltransferase", "gene_name": "ARG3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06105-1", "protein_name": "Protein SCP160", "gene_name": "SCP160", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P09880-1", "protein_name": "tRNA ligase", "gene_name": "TRL1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47026", "url": "https://www.uniprot.org/uniprotkb/P47026" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7483841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of phosphorylation of YJL084c, a yeast protein.", "journal": "Sheng wu hua xue yu sheng wu wu li xue bao Acta biochimica et biophysica Sinica", "date": "2002-07", "authors": "Shi Xiao-Zhong, Ao Shi-Zhou", "reference": { "type": "PubMed", "id": "12098764", "url": "https://pubmed.ncbi.nlm.nih.gov/12098764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47029-1", "protein_name": "Arrestin-related trafficking adapter 3", "gene_name": "ALY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40038-1", "protein_name": "PHO85 cyclin-6", "gene_name": "PCL6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40186-1", "protein_name": "PHO85 cyclin-7", "gene_name": "PCL7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17157-1", "protein_name": "Cyclin-dependent protein kinase PHO85", "gene_name": "PHO85", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47029", "url": "https://www.uniprot.org/uniprotkb/P47029" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12098764", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitination screen using protein microarrays for comprehensive identification of Rsp5 substrates in yeast.", "journal": "Molecular systems biology", "date": "2007", "authors": "Gupta Ronish, Kus Bart, Fladd Christopher, Wasmuth James, Tonikian Raffi, Sidhu Sachdev, Krogan Nevan J, Parkinson John, Rotin Daniela", "reference": { "type": "PubMed", "id": "17551511", "url": "https://pubmed.ncbi.nlm.nih.gov/17551511" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47029-1", "protein_name": "Arrestin-related trafficking adapter 3", "gene_name": "ALY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53244-1", "protein_name": "Arrestin-related trafficking adapter 5", "gene_name": "ART5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53281-1", "protein_name": "LAS seventeen-binding protein 1", "gene_name": "LSB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36117-1", "protein_name": "Arrestin-related trafficking adapter 6", "gene_name": "ALY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P18634-1", "protein_name": "Arrestin-related trafficking adapter 10", "gene_name": "ART10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38741-1", "protein_name": "Meiotic activator RIM4", "gene_name": "RIM4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47029", "url": "https://www.uniprot.org/uniprotkb/P47029" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17551511", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arrestin-related ubiquitin-ligase adaptors regulate endocytosis and protein turnover at the cell surface.", "journal": "Cell", "date": "2008-11-14", "authors": "Lin Charles H, MacGurn Jason A, Chu Tony, Stefan Christopher J, Emr Scott D", "reference": { "type": "PubMed", "id": "18976803", "url": "https://pubmed.ncbi.nlm.nih.gov/18976803" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47029-1", "protein_name": "Arrestin-related trafficking adapter 3", "gene_name": "ALY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53244-1", "protein_name": "Arrestin-related trafficking adapter 5", "gene_name": "ART5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36117-1", "protein_name": "Arrestin-related trafficking adapter 6", "gene_name": "ALY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P18634-1", "protein_name": "Arrestin-related trafficking adapter 10", "gene_name": "ART10", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47029", "url": "https://www.uniprot.org/uniprotkb/P47029" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18976803", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Methionine triggers Ppz-mediated dephosphorylation of Art1 to promote cargo-specific endocytosis.", "journal": "The Journal of cell biology", "date": "2019-03-04", "authors": "Lee Sora, Ho Hsuan-Chung, Tumolo Jessica M, Hsu Pi-Chiang, MacGurn Jason A", "reference": { "type": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47029-1", "protein_name": "Arrestin-related trafficking adapter 3", "gene_name": "ALY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02805-1", "protein_name": "Protein ROD1", "gene_name": "ROD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12502-1", "protein_name": "Protein LDB19", "gene_name": "LDB19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36117-1", "protein_name": "Arrestin-related trafficking adapter 6", "gene_name": "ALY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39940-1", "protein_name": "E3 ubiquitin-protein ligase RSP5", "gene_name": "RSP5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47029", "url": "https://www.uniprot.org/uniprotkb/P47029" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P47029", "url": "https://www.uniprot.org/uniprotkb/P47029" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser155", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser166", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser171", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser176", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 201, "end_pos": 201, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser201", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 581, "end_pos": 581, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser581", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 777, "end_pos": 777, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr777", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 810, "end_pos": 810, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser810", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 883, "end_pos": 883, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser883", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 900, "end_pos": 900, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P47029", "url": "https://www.uniprot.org/uniprotkb/P47029" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser900", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 931, "end_pos": 931, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003620", "url": "https://www.yeastgenome.org/locus/S000003620" }, { "database": "iPTMnet", "id": "P47029", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47029" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser931", "uniprot_canonical_ac": "P47029-1" }, { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser138", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser426", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 436, "end_pos": 436, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser436", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 602, "end_pos": 602, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser602", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 720, "end_pos": 720, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser720", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 722, "end_pos": 722, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser722", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 810, "end_pos": 810, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser810", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 815, "end_pos": 815, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser815", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser104", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser113", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 124, "end_pos": 124, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser124", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 238, "end_pos": 238, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "31618110", "url": "https://pubmed.ncbi.nlm.nih.gov/31618110" }, { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser238", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 241, "end_pos": 241, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser241", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr245", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 619, "end_pos": 619, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12502", "url": "https://www.uniprot.org/uniprotkb/Q12502" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "PubMed", "id": "22118465", "url": "https://pubmed.ncbi.nlm.nih.gov/22118465" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Thr619", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 623, "end_pos": 623, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "22118465", "url": "https://pubmed.ncbi.nlm.nih.gov/22118465" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser623", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 709, "end_pos": 709, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "22118465", "url": "https://pubmed.ncbi.nlm.nih.gov/22118465" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser709", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 710, "end_pos": 710, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr710", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Thr795", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 798, "end_pos": 798, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser798", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser85", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12502", "url": "https://www.uniprot.org/uniprotkb/Q12502" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "31618110", "url": "https://pubmed.ncbi.nlm.nih.gov/31618110" }, { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr93", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005849", "url": "https://www.yeastgenome.org/locus/S000005849" }, { "database": "iPTMnet", "id": "Q12502", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12502" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "Q12502-1" }, { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser182", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 185, "end_pos": 185, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser185", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser231", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 569, "end_pos": 569, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser569", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 596, "end_pos": 596, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" } ], "site_lbl": "Ser596", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 659, "end_pos": 659, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser659", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 824, "end_pos": 824, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser824", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 149, "end_pos": 149, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser149", "uniprot_canonical_ac": "P39940-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "P39940-1" }, { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser179", "uniprot_canonical_ac": "P39940-1" }, { "start_pos": 195, "end_pos": 195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Ser195", "uniprot_canonical_ac": "P39940-1" }, { "start_pos": 223, "end_pos": 223, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser223", "uniprot_canonical_ac": "P39940-1" }, { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" } ], "site_lbl": "Thr245", "uniprot_canonical_ac": "P39940-1" }, { "start_pos": 623, "end_pos": 623, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000927", "url": "https://www.yeastgenome.org/locus/S000000927" }, { "database": "iPTMnet", "id": "P39940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39940" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr623", "uniprot_canonical_ac": "P39940-1" } ], "record_id": "pubmed.30610170", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 49 }, { "field": "total_sites", "count": 47 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Negative regulation of phosphatidylinositol 4,5-bisphosphate levels by the INP51-associated proteins TAX4 and IRS4.", "journal": "The Journal of biological chemistry", "date": "2004-09-17", "authors": "Morales-Johansson Helena, Jenoe Paul, Cooke Frank T, Hall Michael N", "reference": { "type": "PubMed", "id": "15265867", "url": "https://pubmed.ncbi.nlm.nih.gov/15265867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47030-1", "protein_name": "Protein TAX4", "gene_name": "TAX4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36115-1", "protein_name": "Increased rDNA silencing protein 4", "gene_name": "IRS4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40559-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51", "gene_name": "INP51", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprotkb/P47030" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15265867", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recognition specificity of individual EH domains of mammals and yeast.", "journal": "EMBO J.", "date": "1998", "authors": "Paoluzi S, Castagnoli L, Lauro I, Salcini A E, Coda L, Fre' S, Confalonieri S, Pelicci P G, Di Fiore P P, Cesareni G", "reference": { "type": "PubMed", "id": "9822599", "url": "https://pubmed.ncbi.nlm.nih.gov/9822599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47030-1", "protein_name": "Protein TAX4", "gene_name": "TAX4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32521-1", "protein_name": "Actin cytoskeleton-regulatory complex protein PAN1", "gene_name": "PAN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36115-1", "protein_name": "Increased rDNA silencing protein 4", "gene_name": "IRS4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39013-1", "protein_name": "Actin cytoskeleton-regulatory complex protein END3", "gene_name": "END3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47030", "url": "https://www.uniprot.org/uniprotkb/P47030" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9822599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence-based approach for identification of cell wall proteins in Saccharomyces cerevisiae.", "journal": "Curr. Genet.", "date": "2002", "authors": "Terashima Hiromichi, Fukuchi Satoshi, Nakai Kenta, Arisawa Mikio, Hamada Kenji, Yabuki Nami, Kitada Kunio", "reference": { "type": "PubMed", "id": "11935221", "url": "https://pubmed.ncbi.nlm.nih.gov/11935221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47032-1", "protein_name": "Protein PRY1", "gene_name": "PRY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08300-1", "protein_name": "Secreted protein CSS3", "gene_name": "CSS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08910-1", "protein_name": "VEL1-related protein YOR387C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36110-1", "protein_name": "Protein PRY2", "gene_name": "PRY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05164-1", "protein_name": "Haze protective factor 1", "gene_name": "HPF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38288-1", "protein_name": "Probable circularly permuted 1,3-beta-glucanase TOS1", "gene_name": "TOS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38844-1", "protein_name": "Protein DSE2", "gene_name": "DSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53058-1", "protein_name": "Protein VEL1", "gene_name": "VEL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08673-1", "protein_name": "Cell wall protein SRL1", "gene_name": "SRL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12232-1", "protein_name": "Uncharacterized protein SLP1", "gene_name": "SLP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47032", "url": "https://www.uniprot.org/uniprotkb/P47032" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11935221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pathogen-Related Yeast (PRY) proteins and members of the CAP superfamily are secreted sterol-binding proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012-10-16", "authors": "Choudhary Vineet, Schneiter Roger", "reference": { "type": "PubMed", "id": "23027975", "url": "https://pubmed.ncbi.nlm.nih.gov/23027975" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47032-1", "protein_name": "Protein PRY1", "gene_name": "PRY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36110-1", "protein_name": "Protein PRY2", "gene_name": "PRY2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47032", "url": "https://www.uniprot.org/uniprotkb/P47032" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23027975", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The undertranslated transcriptome reveals widespread translational silencing by alternative 5' transcript leaders.", "journal": "Genome Biol.", "date": "2005", "authors": "Law G Lynn, Bickel Kellie S, MacKay Vivian L, Morris David R", "reference": { "type": "PubMed", "id": "16420678", "url": "https://pubmed.ncbi.nlm.nih.gov/16420678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47033", "url": "https://www.uniprot.org/uniprotkb/P47033" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16420678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the transcription activator Ste12p as a repressor of PRY3 expression.", "journal": "Molecular and cellular biology", "date": "2006-11", "authors": "Bickel Kellie S, Morris David R", "reference": { "type": "PubMed", "id": "16940175", "url": "https://pubmed.ncbi.nlm.nih.gov/16940175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47033", "url": "https://www.uniprot.org/uniprotkb/P47033" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16940175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of congenital disorder of glycosylation-Id in a yeast model system shows diverse site-specific under-glycosylation of glycoproteins.", "journal": "Journal of proteome research", "date": "2012-11-02", "authors": "Bailey Ulla-Maja, Jamaluddin Muhammad Fairuz, Schulz Benjamin L", "reference": { "type": "PubMed", "id": "23038983", "url": "https://pubmed.ncbi.nlm.nih.gov/23038983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47033", "url": "https://www.uniprot.org/uniprotkb/P47033" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P47033", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P47033#ptm_processing" }, { "id": "23038983", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23038983" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P47033-1" } ], "record_id": "pubmed.23038983", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ABC transporters and cell wall proteins involved in organic solvent tolerance in Saccharomyces cerevisiae.", "journal": "J. Biotechnol.", "date": "2013", "authors": "Nishida Nao, Ozato Naoki, Matsui Ken, Kuroda Kouichi, Ueda Mitsuyoshi", "reference": { "type": "PubMed", "id": "23523622", "url": "https://pubmed.ncbi.nlm.nih.gov/23523622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47033", "url": "https://www.uniprot.org/uniprotkb/P47033" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23523622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of formyl kynurenine formamidase and kynurenine aminotransferase from Saccharomyces cerevisiae using crystallographic, bioinformatic and biochemical evidence.", "journal": "Biochemistry", "date": "2008", "authors": "Wogulis Mark, Chew Erin R, Donohoue Paul D, Wilson David K", "reference": { "type": "PubMed", "id": "18205391", "url": "https://pubmed.ncbi.nlm.nih.gov/18205391" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47039-1", "protein_name": "Probable kynurenine--oxoglutarate transaminase BNA3", "gene_name": "BNA3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04066-1", "protein_name": "Kynurenine formamidase", "gene_name": "BNA7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47039", "url": "https://www.uniprot.org/uniprotkb/P47039" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18205391", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]