[ { "title": "Cloning and characterization of cell adhesion kinase beta, a novel protein-tyrosine kinase of the focal adhesion kinase subfamily.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Sasaki H, Nagura K, Ishino M, Tobioka H, Kotani K, Sasaki T", "reference": { "type": "PubMed", "id": "7673154", "url": "https://pubmed.ncbi.nlm.nih.gov/7673154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70600-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q14289-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "PTK2B", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7673154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for Pyk2 and Src in linking G-protein-coupled receptors with MAP kinase activation.", "journal": "Nature", "date": "1996", "authors": "Dikic I, Tokiwa G, Lev S, Courtneidge SA, Schlessinger J", "reference": { "type": "PubMed", "id": "8849729", "url": "https://pubmed.ncbi.nlm.nih.gov/8849729" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70600-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9WUD9-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "Src", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q14289-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "PTK2B", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FAK2", "evidence": [ { "database": "UniProtKB", "id": "Q9WUD9", "url": "https://www.uniprot.org/uniprotkb/Q9WUD9" }, { "database": "iPTMnet", "id": "Q9WUD9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9WUD9" }, { "database": "PubMed", "id": "27379421", "url": "https://pubmed.ncbi.nlm.nih.gov/27379421" }, { "database": "PubMed", "id": "32753687", "url": "https://pubmed.ncbi.nlm.nih.gov/32753687" }, { "database": "PubMed", "id": "8849729", "url": "https://pubmed.ncbi.nlm.nih.gov/8849729" } ], "site_lbl": "Tyr419", "uniprot_canonical_ac": "Q9WUD9-1" }, { "start_pos": 402, "end_pos": 402, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q14289", "url": "https://www.uniprot.org/uniprotkb/Q14289" }, { "database": "IntAct", "id": "Q14289", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q14289*" }, { "database": "iPTMnet", "id": "Q14289", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14289" }, { "database": "PubMed", "id": "10521452", "url": "https://pubmed.ncbi.nlm.nih.gov/10521452" }, { "database": "PubMed", "id": "10867021", "url": "https://pubmed.ncbi.nlm.nih.gov/10867021" }, { "database": "PubMed", "id": "11149930", "url": "https://pubmed.ncbi.nlm.nih.gov/11149930" }, { "database": "PubMed", "id": "12063569", "url": "https://pubmed.ncbi.nlm.nih.gov/12063569" }, { "database": "PubMed", "id": "8849729", "url": "https://pubmed.ncbi.nlm.nih.gov/8849729" }, { "database": "PRO", "id": "Q14289", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14289" }, { "database": "PubMed", "id": "11698270", "url": "https://pubmed.ncbi.nlm.nih.gov/11698270" }, { "database": "PubMed", "id": "11007796", "url": "https://pubmed.ncbi.nlm.nih.gov/11007796" }, { "database": "PubMed", "id": "11149924", "url": "https://pubmed.ncbi.nlm.nih.gov/11149924" }, { "database": "PubMed", "id": "11493697", "url": "https://pubmed.ncbi.nlm.nih.gov/11493697" }, { "database": "PubMed", "id": "11520052", "url": "https://pubmed.ncbi.nlm.nih.gov/11520052" }, { "database": "PubMed", "id": "11602570", "url": "https://pubmed.ncbi.nlm.nih.gov/11602570" }, { "database": "PubMed", "id": "11820787", "url": "https://pubmed.ncbi.nlm.nih.gov/11820787" }, { "database": "PubMed", "id": "12231407", "url": "https://pubmed.ncbi.nlm.nih.gov/12231407" }, { "database": "PubMed", "id": "12514172", "url": "https://pubmed.ncbi.nlm.nih.gov/12514172" }, { "database": "PubMed", "id": "14996908", "url": "https://pubmed.ncbi.nlm.nih.gov/14996908" }, { "database": "PubMed", "id": "15105428", "url": "https://pubmed.ncbi.nlm.nih.gov/15105428" }, { "database": "PubMed", "id": "15213840", "url": "https://pubmed.ncbi.nlm.nih.gov/15213840" }, { "database": "PubMed", "id": "15585656", "url": "https://pubmed.ncbi.nlm.nih.gov/15585656" }, { "database": "PubMed", "id": "15695828", "url": "https://pubmed.ncbi.nlm.nih.gov/15695828" }, { "database": "PubMed", "id": "16414994", "url": "https://pubmed.ncbi.nlm.nih.gov/16414994" }, { "database": "PubMed", "id": "16574377", "url": "https://pubmed.ncbi.nlm.nih.gov/16574377" }, { "database": "PubMed", "id": "17055484", "url": "https://pubmed.ncbi.nlm.nih.gov/17055484" }, { "database": "PubMed", "id": "17188509", "url": "https://pubmed.ncbi.nlm.nih.gov/17188509" }, { "database": "PubMed", "id": "17321230", "url": "https://pubmed.ncbi.nlm.nih.gov/17321230" }, { "database": "PubMed", "id": "17581824", "url": "https://pubmed.ncbi.nlm.nih.gov/17581824" }, { "database": "PubMed", "id": "18367725", "url": "https://pubmed.ncbi.nlm.nih.gov/18367725" }, { "database": "PubMed", "id": "18535108", "url": "https://pubmed.ncbi.nlm.nih.gov/18535108" }, { "database": "PubMed", "id": "19380485", "url": "https://pubmed.ncbi.nlm.nih.gov/19380485" }, { "database": "PubMed", "id": "19861182", "url": "https://pubmed.ncbi.nlm.nih.gov/19861182" }, { "database": "PubMed", "id": "19919693", "url": "https://pubmed.ncbi.nlm.nih.gov/19919693" }, { "database": "PubMed", "id": "20028775", "url": "https://pubmed.ncbi.nlm.nih.gov/20028775" }, { "database": "PubMed", "id": "20156366", "url": "https://pubmed.ncbi.nlm.nih.gov/20156366" }, { "database": "PubMed", "id": "20180987", "url": "https://pubmed.ncbi.nlm.nih.gov/20180987" }, { "database": "PubMed", "id": "20308428", "url": "https://pubmed.ncbi.nlm.nih.gov/20308428" }, { "database": "PubMed", "id": "20381867", "url": "https://pubmed.ncbi.nlm.nih.gov/20381867" }, { "database": "PubMed", "id": "20507587", "url": "https://pubmed.ncbi.nlm.nih.gov/20507587" }, { "database": "PubMed", "id": "20826662", "url": "https://pubmed.ncbi.nlm.nih.gov/20826662" }, { "database": "PubMed", "id": "21429240", "url": "https://pubmed.ncbi.nlm.nih.gov/21429240" }, { "database": "PubMed", "id": "21859844", "url": "https://pubmed.ncbi.nlm.nih.gov/21859844" }, { "database": "PubMed", "id": "22859931", "url": "https://pubmed.ncbi.nlm.nih.gov/22859931" }, { "database": "PubMed", "id": "23300847", "url": "https://pubmed.ncbi.nlm.nih.gov/23300847" }, { "database": "PubMed", "id": "24965120", "url": "https://pubmed.ncbi.nlm.nih.gov/24965120" }, { "database": "PubMed", "id": "25090023", "url": "https://pubmed.ncbi.nlm.nih.gov/25090023" }, { "database": "PubMed", "id": "25433371", "url": "https://pubmed.ncbi.nlm.nih.gov/25433371" }, { "database": "PubMed", "id": "25889845", "url": "https://pubmed.ncbi.nlm.nih.gov/25889845" }, { "database": "PubMed", "id": "26084289", "url": "https://pubmed.ncbi.nlm.nih.gov/26084289" }, { "database": "PubMed", "id": "26202465", "url": "https://pubmed.ncbi.nlm.nih.gov/26202465" }, { "database": "PubMed", "id": "27602957", "url": "https://pubmed.ncbi.nlm.nih.gov/27602957" }, { "database": "PubMed", "id": "27613122", "url": "https://pubmed.ncbi.nlm.nih.gov/27613122" }, { "database": "PubMed", "id": "29133485", "url": "https://pubmed.ncbi.nlm.nih.gov/29133485" }, { "database": "PubMed", "id": "29438996", "url": "https://pubmed.ncbi.nlm.nih.gov/29438996" }, { "database": "PubMed", "id": "29491534", "url": "https://pubmed.ncbi.nlm.nih.gov/29491534" }, { "database": "PubMed", "id": "29920512", "url": "https://pubmed.ncbi.nlm.nih.gov/29920512" }, { "database": "PubMed", "id": "30020827", "url": "https://pubmed.ncbi.nlm.nih.gov/30020827" }, { "database": "PubMed", "id": "30250159", "url": "https://pubmed.ncbi.nlm.nih.gov/30250159" }, { "database": "PubMed", "id": "30433799", "url": "https://pubmed.ncbi.nlm.nih.gov/30433799" }, { "database": "PubMed", "id": "30571746", "url": "https://pubmed.ncbi.nlm.nih.gov/30571746" }, { "database": "PubMed", "id": "32792487", "url": "https://pubmed.ncbi.nlm.nih.gov/32792487" }, { "database": "PubMed", "id": "33273492", "url": "https://pubmed.ncbi.nlm.nih.gov/33273492" }, { "database": "PubMed", "id": "33277387", "url": "https://pubmed.ncbi.nlm.nih.gov/33277387" }, { "database": "PubMed", "id": "33785524", "url": "https://pubmed.ncbi.nlm.nih.gov/33785524" }, { "database": "PubMed", "id": "9242628", "url": "https://pubmed.ncbi.nlm.nih.gov/9242628" }, { "database": "PubMed", "id": "15166227", "url": "https://pubmed.ncbi.nlm.nih.gov/15166227" }, { "database": "PubMed", "id": "17329398", "url": "https://pubmed.ncbi.nlm.nih.gov/17329398" }, { "database": "PubMed", "id": "19207108", "url": "https://pubmed.ncbi.nlm.nih.gov/19207108" }, { "database": "PubMed", "id": "20521079", "url": "https://pubmed.ncbi.nlm.nih.gov/20521079" } ], "site_lbl": "Tyr402", "uniprot_canonical_ac": "Q14289-1" } ], "mutagenesis": [ { "start_pos": 402, "end_pos": 402, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes autophosphorylation. Abolishes interaction with SRC.", "evidence": [ { "database": "UniProtKB", "id": "Q14289", "url": "https://www.uniprot.org/uniprotkb/Q14289" }, { "database": "PubMed", "id": "8849729", "url": "https://pubmed.ncbi.nlm.nih.gov/8849729" } ], "uniprot_canonical_ac": "Q14289-1" } ], "record_id": "pubmed.8849729", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of a novel calcium-dependent protein-tyrosine kinase. Correlation with c-Jun N-terminal kinase but not mitogen-activated protein kinase activation.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Yu H, Li X, Marchetto G S, Dy R, Hunter D, Calvo B, Dawson T L, Wilm M, Anderegg R J, Graves L M, Earp H S", "reference": { "type": "PubMed", "id": "8939945", "url": "https://pubmed.ncbi.nlm.nih.gov/8939945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70600-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8939945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of apoptosis after expression of PYK2, a tyrosine kinase structurally related to focal adhesion kinase.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Xiong W, Parsons JT", "reference": { "type": "PubMed", "id": "9334354", "url": "https://pubmed.ncbi.nlm.nih.gov/9334354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70600-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35346-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "Ptk2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 402, "end_pos": 402, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" }, { "database": "iPTMnet", "id": "P70600", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P70600" }, { "database": "PubMed", "id": "11352655", "url": "https://pubmed.ncbi.nlm.nih.gov/11352655" }, { "database": "PubMed", "id": "12967635", "url": "https://pubmed.ncbi.nlm.nih.gov/12967635" }, { "database": "PubMed", "id": "15236860", "url": "https://pubmed.ncbi.nlm.nih.gov/15236860" }, { "database": "PubMed", "id": "15911746", "url": "https://pubmed.ncbi.nlm.nih.gov/15911746" }, { "database": "PubMed", "id": "15970382", "url": "https://pubmed.ncbi.nlm.nih.gov/15970382" }, { "database": "PubMed", "id": "20071509", "url": "https://pubmed.ncbi.nlm.nih.gov/20071509" }, { "database": "PubMed", "id": "21258655", "url": "https://pubmed.ncbi.nlm.nih.gov/21258655" }, { "database": "PubMed", "id": "24718602", "url": "https://pubmed.ncbi.nlm.nih.gov/24718602" }, { "database": "PubMed", "id": "24884636", "url": "https://pubmed.ncbi.nlm.nih.gov/24884636" }, { "database": "PubMed", "id": "25347863", "url": "https://pubmed.ncbi.nlm.nih.gov/25347863" }, { "database": "PubMed", "id": "26704905", "url": "https://pubmed.ncbi.nlm.nih.gov/26704905" }, { "database": "PubMed", "id": "9334354", "url": "https://pubmed.ncbi.nlm.nih.gov/9334354" }, { "database": "PubMed", "id": "20849950", "url": "https://pubmed.ncbi.nlm.nih.gov/20849950" } ], "site_lbl": "Tyr402", "uniprot_canonical_ac": "P70600-1" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "O35346", "url": "https://www.uniprot.org/uniprotkb/O35346" }, { "database": "PRO", "id": "O35346", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O35346" }, { "database": "iPTMnet", "id": "O35346", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O35346" }, { "database": "PubMed", "id": "27994061", "url": "https://pubmed.ncbi.nlm.nih.gov/27994061" }, { "database": "PubMed", "id": "11882598", "url": "https://pubmed.ncbi.nlm.nih.gov/11882598" }, { "database": "PubMed", "id": "12732587", "url": "https://pubmed.ncbi.nlm.nih.gov/12732587" }, { "database": "PubMed", "id": "12805241", "url": "https://pubmed.ncbi.nlm.nih.gov/12805241" }, { "database": "PubMed", "id": "15096502", "url": "https://pubmed.ncbi.nlm.nih.gov/15096502" }, { "database": "PubMed", "id": "15537746", "url": "https://pubmed.ncbi.nlm.nih.gov/15537746" }, { "database": "PubMed", "id": "15817454", "url": "https://pubmed.ncbi.nlm.nih.gov/15817454" }, { "database": "PubMed", "id": "15923313", "url": "https://pubmed.ncbi.nlm.nih.gov/15923313" }, { "database": "PubMed", "id": "15930288", "url": "https://pubmed.ncbi.nlm.nih.gov/15930288" }, { "database": "PubMed", "id": "16195476", "url": "https://pubmed.ncbi.nlm.nih.gov/16195476" }, { "database": "PubMed", "id": "16618703", "url": "https://pubmed.ncbi.nlm.nih.gov/16618703" }, { "database": "PubMed", "id": "16825486", "url": "https://pubmed.ncbi.nlm.nih.gov/16825486" }, { "database": "PubMed", "id": "17003277", "url": "https://pubmed.ncbi.nlm.nih.gov/17003277" }, { "database": "PubMed", "id": "17549512", "url": "https://pubmed.ncbi.nlm.nih.gov/17549512" }, { "database": "PubMed", "id": "18539755", "url": "https://pubmed.ncbi.nlm.nih.gov/18539755" }, { "database": "PubMed", "id": "19361463", "url": "https://pubmed.ncbi.nlm.nih.gov/19361463" }, { "database": "PubMed", "id": "19364917", "url": "https://pubmed.ncbi.nlm.nih.gov/19364917" }, { "database": "PubMed", "id": "19470782", "url": "https://pubmed.ncbi.nlm.nih.gov/19470782" }, { "database": "PubMed", "id": "19880666", "url": "https://pubmed.ncbi.nlm.nih.gov/19880666" }, { "database": "PubMed", "id": "21246051", "url": "https://pubmed.ncbi.nlm.nih.gov/21246051" }, { "database": "PubMed", "id": "21357465", "url": "https://pubmed.ncbi.nlm.nih.gov/21357465" }, { "database": "PubMed", "id": "22276220", "url": "https://pubmed.ncbi.nlm.nih.gov/22276220" }, { "database": "PubMed", "id": "22654119", "url": "https://pubmed.ncbi.nlm.nih.gov/22654119" }, { "database": "PubMed", "id": "22900166", "url": "https://pubmed.ncbi.nlm.nih.gov/22900166" }, { "database": "PubMed", "id": "22914642", "url": "https://pubmed.ncbi.nlm.nih.gov/22914642" }, { "database": "PubMed", "id": "23118988", "url": "https://pubmed.ncbi.nlm.nih.gov/23118988" }, { "database": "PubMed", "id": "24217647", "url": "https://pubmed.ncbi.nlm.nih.gov/24217647" }, { "database": "PubMed", "id": "24772088", "url": "https://pubmed.ncbi.nlm.nih.gov/24772088" }, { "database": "PubMed", "id": "24884636", "url": "https://pubmed.ncbi.nlm.nih.gov/24884636" }, { "database": "PubMed", "id": "25300309", "url": "https://pubmed.ncbi.nlm.nih.gov/25300309" }, { "database": "PubMed", "id": "26018803", "url": "https://pubmed.ncbi.nlm.nih.gov/26018803" }, { "database": "PubMed", "id": "28744198", "url": "https://pubmed.ncbi.nlm.nih.gov/28744198" }, { "database": "PubMed", "id": "29018403", "url": "https://pubmed.ncbi.nlm.nih.gov/29018403" }, { "database": "PubMed", "id": "30187999", "url": "https://pubmed.ncbi.nlm.nih.gov/30187999" }, { "database": "PubMed", "id": "30510582", "url": "https://pubmed.ncbi.nlm.nih.gov/30510582" }, { "database": "PubMed", "id": "30853931", "url": "https://pubmed.ncbi.nlm.nih.gov/30853931" }, { "database": "PubMed", "id": "31784544", "url": "https://pubmed.ncbi.nlm.nih.gov/31784544" }, { "database": "PubMed", "id": "32352989", "url": "https://pubmed.ncbi.nlm.nih.gov/32352989" }, { "database": "PubMed", "id": "32592615", "url": "https://pubmed.ncbi.nlm.nih.gov/32592615" }, { "database": "PubMed", "id": "33692398", "url": "https://pubmed.ncbi.nlm.nih.gov/33692398" }, { "database": "PubMed", "id": "33920786", "url": "https://pubmed.ncbi.nlm.nih.gov/33920786" }, { "database": "PubMed", "id": "34194565", "url": "https://pubmed.ncbi.nlm.nih.gov/34194565" }, { "database": "PubMed", "id": "9334354", "url": "https://pubmed.ncbi.nlm.nih.gov/9334354" }, { "database": "PubMed", "id": "9353341", "url": "https://pubmed.ncbi.nlm.nih.gov/9353341" }, { "database": "PubMed", "id": "9374543", "url": "https://pubmed.ncbi.nlm.nih.gov/9374543" } ], "site_lbl": "Tyr397", "uniprot_canonical_ac": "O35346-1" } ], "record_id": "pubmed.9334354", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell adhesion kinase beta forms a complex with a new member, Hic-5, of proteins localized at focal adhesions.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Matsuya M, Sasaki H, Aoto H, Mitaka T, Nagura K, Ohba T, Ishino M, Takahashi S, Suzuki R, Sasaki T", "reference": { "type": "PubMed", "id": "9422762", "url": "https://pubmed.ncbi.nlm.nih.gov/9422762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70600-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P34152-3", "protein_name": "Focal adhesion kinase 1", "gene_name": "Ptk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q62219-1", "protein_name": "Transforming growth factor beta-1-induced transcript 1 protein", "gene_name": "Tgfb1i1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35346-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "Ptk2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99PD6-1", "protein_name": "Transforming growth factor beta-1-induced transcript 1 protein", "gene_name": "Tgfb1i1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O43294-1", "protein_name": "Transforming growth factor beta-1-induced transcript 1 protein", "gene_name": "TGFB1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QVP9-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14289-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "PTK2B", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9422762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and characterization of splice variants of PYK2, a focal adhesion kinase-related protein.", "journal": "J. Cell Sci.", "date": "1998", "authors": "Xiong W C, Macklem M, Parsons J T", "reference": { "type": "PubMed", "id": "9645946", "url": "https://pubmed.ncbi.nlm.nih.gov/9645946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70600-1", "protein_name": "Protein-tyrosine kinase 2-beta", "gene_name": "Ptk2b", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70600", "url": "https://www.uniprot.org/uniprotkb/P70600" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9645946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tricyclic farnesyl protein transferase inhibitors: crystallographic and calorimetric studies of structure-activity relationships.", "journal": "J. Med. Chem.", "date": "1999", "authors": "Strickland C L, Weber P C, Windsor W T, Wu Z, Le H V, Albanese M M, Alvarez C S, Cesarz D, del Rosario J, Deskus J, Mallams A K, Njoroge F G, Piwinski J J, Remiszewski S, Rossman R R, Taveras A G, Vibulbhan B, Doll R J, Girijavallabhan V M, Ganguly A K", "reference": { "type": "PubMed", "id": "10377218", "url": "https://pubmed.ncbi.nlm.nih.gov/10377218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10377218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The basis for K-Ras4B binding specificity to protein farnesyltransferase revealed by 2 A resolution ternary complex structures.", "journal": "Structure", "date": "2000", "authors": "Long S B, Casey P J, Beese L S", "reference": { "type": "PubMed", "id": "10673434", "url": "https://pubmed.ncbi.nlm.nih.gov/10673434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10673434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reaction path of protein farnesyltransferase at atomic resolution.", "journal": "Nature", "date": "2002", "authors": "Long Stephen B, Casey Patrick J, Beese Lorena S", "reference": { "type": "PubMed", "id": "12374986", "url": "https://pubmed.ncbi.nlm.nih.gov/12374986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12374986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.", "journal": "Bioorg. Med. Chem. Lett.", "date": "2003", "authors": "Gwaltney Stephen L, O'Connor Stephen J, Nelson Lissa T J, Sullivan Gerard M, Imade Hovis, Wang Weibo, Hasvold Lisa, Li Qun, Cohen Jerome, Gu Wen-Zhen, Tahir Stephen K, Bauch Joy, Marsh Kennan, Ng Shi-Chung, Frost David J, Zhang Haiying, Muchmore Steve, Jakob Clarissa G, Stoll Vincent, Hutchins Charles, Rosenberg Saul H, Sham Hing L", "reference": { "type": "PubMed", "id": "12657282", "url": "https://pubmed.ncbi.nlm.nih.gov/12657282" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12657282", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical and structural studies with prenyl diphosphate analogues provide insights into isoprenoid recognition by protein farnesyl transferase.", "journal": "Biochemistry", "date": "2003", "authors": "Turek-Etienne Tammy C, Strickland Corey L, Distefano Mark D", "reference": { "type": "PubMed", "id": "12667062", "url": "https://pubmed.ncbi.nlm.nih.gov/12667062" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P22007-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "RAM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12667062", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of mammalian protein geranylgeranyltransferase type-I.", "journal": "The EMBO journal", "date": "2003", "authors": "Taylor JS, Reid TS, Terry KL, Casey PJ, Beese LS", "reference": { "type": "PubMed", "id": "14609943", "url": "https://pubmed.ncbi.nlm.nih.gov/14609943" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P53610-1", "protein_name": "Geranylgeranyl transferase type-1 subunit beta", "gene_name": "Pggt1b", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14609943", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.", "journal": "Biochemistry", "date": "2004", "authors": "Reid T Scott, Beese Lorena S", "reference": { "type": "PubMed", "id": "15170324", "url": "https://pubmed.ncbi.nlm.nih.gov/15170324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49354-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "FNTA", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15170324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of a cDNA encoding the alpha subunit of rat p21ras protein farnesyltransferase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Chen WJ, Andres DA, Goldstein JL, Brown MS", "reference": { "type": "PubMed", "id": "1763049", "url": "https://pubmed.ncbi.nlm.nih.gov/1763049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1763049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caged protein prenyltransferase substrates: tools for understanding protein prenylation.", "journal": "Chemical biology & drug design", "date": "2008", "authors": "DeGraw AJ, Hast MA, Xu J, Mullen D, Beese LS, Barany G, Distefano MD", "reference": { "type": "PubMed", "id": "18844669", "url": "https://pubmed.ncbi.nlm.nih.gov/18844669" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.18844669", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the eukaryotic prenylome by isoprenoid affinity tagging.", "journal": "Nature chemical biology", "date": "2009-04", "authors": "Nguyen Uyen T T, Guo Zhong, Delon Christine, Wu Yaowen, Deraeve Celine, Fr\u00e4nzel Benjamin, Bon Robin S, Blankenfeldt Wulf, Goody Roger S, Waldmann Herbert, Wolters Dirk, Alexandrov Kirill", "reference": { "type": "PubMed", "id": "19219049", "url": "https://pubmed.ncbi.nlm.nih.gov/19219049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19219049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Development of selective, potent RabGGTase inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2012-10-11", "authors": "Stigter E Anouk, Guo Zhong, Bon Robin S, Wu Yao-Wen, Choidas Axel, Wolf Alexander, Menninger Sascha, Waldmann Herbert, Blankenfeldt Wulf, Goody Roger S", "reference": { "type": "PubMed", "id": "22963166", "url": "https://pubmed.ncbi.nlm.nih.gov/22963166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q08602-1", "protein_name": "Geranylgeranyl transferase type-2 subunit alpha", "gene_name": "Rabggta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q08603-1", "protein_name": "Geranylgeranyl transferase type-2 subunit beta", "gene_name": "Rabggtb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22963166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Geranylgeranyltransferase I mediates BDNF-induced synaptogenesis.", "journal": "Journal of neurochemistry", "date": "2013", "authors": "Li Z, Sun C, Zhang T, Mo J, Shi Q, Zhang X, Yuan M, Chen L, Mao X, Yu R, Zhou X", "reference": { "type": "PubMed", "id": "23534605", "url": "https://pubmed.ncbi.nlm.nih.gov/23534605" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.23534605", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Efficient farnesylation of an extended C-terminal C(x)3X sequence motif expands the scope of the prenylated proteome.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Blanden MJ, Suazo KF, Hildebrandt ER, Hardgrove DS, Patel M, Saunders WP, Distefano MD, Schmidt WK, Hougland JL", "reference": { "type": "PubMed", "id": "29282289", "url": "https://pubmed.ncbi.nlm.nih.gov/29282289" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29282289", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of protein farnesyltransferase at 2.25-A resolution.", "journal": "Science", "date": "1997", "authors": "Park HW, Boduluri SR, Moomaw JF, Casey PJ, Beese LS", "reference": { "type": "PubMed", "id": "9065406", "url": "https://pubmed.ncbi.nlm.nih.gov/9065406" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9065406", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein farnesyltransferase: structure and implications for substrate binding.", "journal": "Biochemistry", "date": "1998", "authors": "Dunten P, Kammlott U, Crowther R, Weber D, Palermo R, Birktoft J", "reference": { "type": "PubMed", "id": "9609683", "url": "https://pubmed.ncbi.nlm.nih.gov/9609683" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9609683", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cocrystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate.", "journal": "Biochemistry", "date": "1998", "authors": "Long SB, Casey PJ, Beese LS", "reference": { "type": "PubMed", "id": "9657673", "url": "https://pubmed.ncbi.nlm.nih.gov/9657673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9657673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of farnesyl protein transferase complexed with a CaaX peptide and farnesyl diphosphate analogue.", "journal": "Biochemistry", "date": "1998", "authors": "Strickland C L, Windsor W T, Syto R, Wang L, Bond R, Wu Z, Schwartz J, Le H V, Beese L S, Weber P C", "reference": { "type": "PubMed", "id": "9843427", "url": "https://pubmed.ncbi.nlm.nih.gov/9843427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04631-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "Fnta", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02293-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "Fntb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q04631", "url": "https://www.uniprot.org/uniprotkb/Q04631" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9843427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamin is a minibrain kinase/dual specificity Yak1-related kinase 1A substrate.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Chen-Hwang MC, Chen HR, Elzinga M, Hwang YW", "reference": { "type": "PubMed", "id": "11877424", "url": "https://pubmed.ncbi.nlm.nih.gov/11877424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11877424", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Down syndrome candidate dual-specificity tyrosine phosphorylation-regulated kinase 1A phosphorylates the neurodegeneration-related septin 4.", "journal": "Neuroscience", "date": "2008", "authors": "Sitz JH, Baumgartel K, Hammerle B, Papadopoulos C, Hekerman P, Tejedor FJ, Becker W, Lutz B", "reference": { "type": "PubMed", "id": "18938227", "url": "https://pubmed.ncbi.nlm.nih.gov/18938227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q61214-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Z2Q6-1", "protein_name": "Septin-5", "gene_name": "Septin5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A0A096MJN4-1", "protein_name": "Septin-4", "gene_name": "Septin4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JJM9-1", "protein_name": "Septin-5", "gene_name": "Septin5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99NB9-1", "protein_name": "Splicing factor 3B subunit 1", "gene_name": "Sf3b1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P28661-1", "protein_name": "Septin-4", "gene_name": "Septin4", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 434, "end_pos": 434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by DYRK1A", "evidence": [ { "database": "UniProtKB", "id": "Q99NB9", "url": "https://www.uniprot.org/uniprotkb/Q99NB9" }, { "database": "iPTMnet", "id": "Q99NB9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99NB9" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "PubMed", "id": "18938227", "url": "https://pubmed.ncbi.nlm.nih.gov/18938227" } ], "site_lbl": "Thr434", "uniprot_canonical_ac": "Q99NB9-1" } ], "record_id": "pubmed.18938227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid leucettamine B.", "journal": "Journal of medicinal chemistry", "date": "2012", "authors": "Tahtouh T, Elkins JM, Filippakopoulos P, Soundararajan M, Burgy G, Durieu E, Cochet C, Schmid RS, Lo DC, Delhommel F, Oberholzer AE, Pearl LH, Carreaux F, Bazureau JP, Knapp S, Meijer L", "reference": { "type": "PubMed", "id": "22998443", "url": "https://pubmed.ncbi.nlm.nih.gov/22998443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q13627-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "DYRK1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y463-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1B", "gene_name": "DYRK1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q61214-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q92630-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 2", "gene_name": "DYRK2", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "Q92630-1", "kinase_gene_name": "DYRK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92630" }, { "database": "PubMed", "id": "18491313", "url": "https://pubmed.ncbi.nlm.nih.gov/18491313" }, { "database": "PubMed", "id": "22998443", "url": "https://pubmed.ncbi.nlm.nih.gov/22998443" }, { "database": "PubMed", "id": "9748265", "url": "https://pubmed.ncbi.nlm.nih.gov/9748265" }, { "database": "UniProtKB", "id": "Q92630", "url": "https://www.uniprot.org/uniprotkb/Q92630" } ], "site_lbl": "Tyr382", "uniprot_canonical_ac": "Q92630-1" } ], "record_id": "pubmed.22998443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of NPY2R/NFATc1/DYRK1A regulatory axis in sebaceous glands for sebum synthesis.", "journal": "Cellular & molecular biology letters", "date": "2023-07-27", "authors": "Yang Tao, Hei Renyi, Li Xiaosong, Ma Tianhua, Shen Yifen, Liu Chao, He Wen, Zhu Lin, Gu Yongchun, Hu Yanping, Wei Wenbin, Shen Yihang", "reference": { "type": "PubMed", "id": "37501148", "url": "https://pubmed.ncbi.nlm.nih.gov/37501148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "A0ABK0LRW4-1", "protein_name": "Neuropeptide Y receptor type 2", "gene_name": "Npy2r", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37501148", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of DYRK1a in myocardial ischemia-reperfusion injury by regulating ferroptosis of cardiomyocytes.", "journal": "The Kaohsiung journal of medical sciences", "date": "2023-12", "authors": "Wang Jing, Xu Rui-Ming, Cao Qiu-Mei, Ma Bing-Chen, Zhang Hao, Hao Hua-Peng", "reference": { "type": "PubMed", "id": "37702441", "url": "https://pubmed.ncbi.nlm.nih.gov/37702441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37702441", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dyrk, a dual specificity protein kinase with unique structural features whose activity is dependent on tyrosine residues between subdomains VII and VIII.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kentrup H, Becker W, Heukelbach J, Wilmes A, Schurmann A, Huppertz C, Kainulainen H, Joost HG", "reference": { "type": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 188, "end_pos": 188, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes autophosphorylation. Retains marginal kinase activity towards histones.", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" }, { "database": "PubMed", "id": "22767602", "url": "https://pubmed.ncbi.nlm.nih.gov/22767602" } ], "uniprot_canonical_ac": "Q63470-1" }, { "start_pos": 219, "end_pos": 219, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduced autophosphorylation on tyrosine, but retains some kinase activity towards histones.", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" } ], "uniprot_canonical_ac": "Q63470-1" }, { "start_pos": 319, "end_pos": 319, "sequence_org": "Y", "sequence_mut": "F", "comment": "Suppressed autophosphorylation on tyrosine and reduced tyrosine, threonine and serine kinase activity towards histones; when associated with F-321.", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" } ], "uniprot_canonical_ac": "Q63470-1" }, { "start_pos": 321, "end_pos": 321, "sequence_org": "Y", "sequence_mut": "F", "comment": "Suppressed autophosphorylation on tyrosine and reduced tyrosine, threonine and serine kinase activity towards histones; when associated with F-319.", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" } ], "uniprot_canonical_ac": "Q63470-1" } ], "phosphorylation": [ { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "Q63470-1", "kinase_gene_name": "Dyrk1a", "residue": "Tyr", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "iPTMnet", "id": "Q63470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" } ], "site_lbl": "Tyr219", "uniprot_canonical_ac": "Q63470-1" }, { "start_pos": 319, "end_pos": 319, "kinase_uniprot_canonical_ac": "Q63470-1", "kinase_gene_name": "Dyrk1a", "residue": "Tyr", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "iPTMnet", "id": "Q63470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" } ], "site_lbl": "Tyr319", "uniprot_canonical_ac": "Q63470-1" }, { "start_pos": 321, "end_pos": 321, "kinase_uniprot_canonical_ac": "Q63470-1", "kinase_gene_name": "Dyrk1a", "residue": "Tyr", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" }, { "database": "iPTMnet", "id": "Q63470", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q63470" }, { "database": "PubMed", "id": "8631952", "url": "https://pubmed.ncbi.nlm.nih.gov/8631952" } ], "site_lbl": "Tyr321", "uniprot_canonical_ac": "Q63470-1" } ], "record_id": "pubmed.8631952", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence characteristics, subcellular localization, and substrate specificity of DYRK-related kinases, a novel family of dual specificity protein kinases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Becker W, Weber Y, Wetzel K, Eirmbter K, Tejedor FJ, Joost HG", "reference": { "type": "PubMed", "id": "9748265", "url": "https://pubmed.ncbi.nlm.nih.gov/9748265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63470-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 1A", "gene_name": "Dyrk1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q4V8A3-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 3", "gene_name": "Dyrk3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9NR20-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 4", "gene_name": "DYRK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92630-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 2", "gene_name": "DYRK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43781-1", "protein_name": "Dual specificity tyrosine-phosphorylation-regulated kinase 3", "gene_name": "DYRK3", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63470", "url": "https://www.uniprot.org/uniprotkb/Q63470" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "Q92630-1", "kinase_gene_name": "DYRK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92630" }, { "database": "PubMed", "id": "18491313", "url": "https://pubmed.ncbi.nlm.nih.gov/18491313" }, { "database": "PubMed", "id": "22998443", "url": "https://pubmed.ncbi.nlm.nih.gov/22998443" }, { "database": "PubMed", "id": "9748265", "url": "https://pubmed.ncbi.nlm.nih.gov/9748265" }, { "database": "UniProtKB", "id": "Q92630", "url": "https://www.uniprot.org/uniprotkb/Q92630" } ], "site_lbl": "Tyr382", "uniprot_canonical_ac": "Q92630-1" } ], "record_id": "pubmed.9748265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in EMP2 cause childhood-onset nephrotic syndrome.", "journal": "Am. J. Hum. Genet.", "date": "2014", "authors": "Gee HY, Ashraf S, Wan X, Vega-Warner V, Esteve-Rudd J, Lovric S, Fang H, Hurd TW, Sadowski CE, Allen SJ, Otto EA, Korkmaz E, Washburn J, Levy S, Williams DS, Bakkaloglu SA, Zolotnitskaya A, Ozaltin F, Zhou W, Hildebrandt F", "reference": { "type": "PubMed", "id": "24814193", "url": "https://pubmed.ncbi.nlm.nih.gov/24814193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q66HH2-1", "protein_name": "Epithelial membrane protein 2", "gene_name": "Emp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P54851-1", "protein_name": "Epithelial membrane protein 2", "gene_name": "EMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "F1QIK8-1", "protein_name": "Epithelial membrane protein 2", "gene_name": "emp2", "tax_name": "Zebrafish" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q66HH2", "url": "https://www.uniprot.org/uniprotkb/Q66HH2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24814193", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-340-5p mediates the therapeutic effect of mesenchymal stem cells on corneal neovascularization.", "journal": "Graefe's archive for clinical and experimental ophthalmology = Albrecht von Graefes Archiv fur klinische und experimentelle Ophthalmologie", "date": "2022", "authors": "Pan J, Luo X, Zhao S, Li J, Jiang Z", "reference": { "type": "PubMed", "id": "34495369", "url": "https://pubmed.ncbi.nlm.nih.gov/34495369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q66HH2-1", "protein_name": "Epithelial membrane protein 2", "gene_name": "Emp2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q66HH2", "url": "https://www.uniprot.org/uniprotkb/Q66HH2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34495369", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of a GATA4/Ankrd1 signaling axis in cardiomyocytes leads to sarcomere disarray: implications for anthracycline cardiomyopathy.", "journal": "PloS one", "date": "2012", "authors": "Chen B, Zhong L, Roush SF, Pentassuglia L, Peng X, Samaras S, Davidson JM, Sawyer DB, Lim CC", "reference": { "type": "PubMed", "id": "22532871", "url": "https://pubmed.ncbi.nlm.nih.gov/22532871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8R560-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8R560", "url": "https://www.uniprot.org/uniprotkb/Q8R560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22532871", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "26S proteasome regulation of Ankrd1/CARP in adult rat ventricular myocytes and human microvascular endothelial cells.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Samaras SE, Chen B, Koch SR, Sawyer DB, Lim CC, Davidson JM", "reference": { "type": "PubMed", "id": "22892129", "url": "https://pubmed.ncbi.nlm.nih.gov/22892129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8R560-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8R560", "url": "https://www.uniprot.org/uniprotkb/Q8R560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22892129", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ankrd1 is a transcriptional repressor for the androgen receptor that is downregulated by testosterone.", "journal": "Biochemical and biophysical research communications", "date": "2013", "authors": "Wu Y, Ruggiero CL, Bauman WA, Cardozo C", "reference": { "type": "PubMed", "id": "23811403", "url": "https://pubmed.ncbi.nlm.nih.gov/23811403" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8R560-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8R560", "url": "https://www.uniprot.org/uniprotkb/Q8R560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.23811403", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytosolic CARP promotes angiotensin II- or pressure overload-induced cardiomyocyte hypertrophy through calcineurin accumulation.", "journal": "PloS one", "date": "2014", "authors": "Chen C, Shen L, Cao S, Li X, Xuan W, Zhang J, Huang X, Bin J, Xu D, Li G, Kitakaze M, Liao Y", "reference": { "type": "PubMed", "id": "25089522", "url": "https://pubmed.ncbi.nlm.nih.gov/25089522" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8R560-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8R560", "url": "https://www.uniprot.org/uniprotkb/Q8R560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.25089522", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CARP, a cardiac ankyrin repeat protein, is downstream in the Nkx2-5 homeobox gene pathway.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Zou Y, Evans S, Chen J, Kuo HC, Harvey RP, Chien KR", "reference": { "type": "PubMed", "id": "9043061", "url": "https://pubmed.ncbi.nlm.nih.gov/9043061" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8R560-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9CR42-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8R560", "url": "https://www.uniprot.org/uniprotkb/Q8R560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9043061", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel cardiac-restricted target for doxorubicin. CARP, a nuclear modulator of gene expression in cardiac progenitor cells and cardiomyocytes.", "journal": "The Journal of biological chemistry", "date": "1997-09-05", "authors": "Jeyaseelan R, Poizat C, Baker R K, Abdishoo S, Isterabadi L B, Lyons G E, Kedes L", "reference": { "type": "PubMed", "id": "9278441", "url": "https://pubmed.ncbi.nlm.nih.gov/9278441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8R560-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9CR42-1", "protein_name": "Ankyrin repeat domain-containing protein 1", "gene_name": "Ankrd1", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8R560", "url": "https://www.uniprot.org/uniprotkb/Q8R560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9278441", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional regulation of the epiregulin gene in the rat ovary.", "journal": "Endocrinology", "date": "2002", "authors": "Sekiguchi Toshio, Mizutani Tetsuya, Yamada Kazuya, Yazawa Takashi, Kawata Hiroko, Yoshino Miki, Kajitani Takashi, Kameda Takashi, Minegishi Takashi, Miyamoto Kaoru", "reference": { "type": "PubMed", "id": "12446600", "url": "https://pubmed.ncbi.nlm.nih.gov/12446600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Z0L5-1", "protein_name": "Proepiregulin", "gene_name": "Ereg", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9Z0L5", "url": "https://www.uniprot.org/uniprotkb/Q9Z0L5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12446600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional suppression of Epiregulin impairs angiogenesis and aggravates left ventricular remodeling by disrupting the extracellular-signal-regulated kinase1/2 signaling pathway in rats after acute myocardial infarction.", "journal": "Journal of cellular physiology", "date": "2019", "authors": "Cai Y, Xie KL, Wu HL, Wu K", "reference": { "type": "PubMed", "id": "31062344", "url": "https://pubmed.ncbi.nlm.nih.gov/31062344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Z0L5-1", "protein_name": "Proepiregulin", "gene_name": "Ereg", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9Z0L5", "url": "https://www.uniprot.org/uniprotkb/Q9Z0L5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31062344", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epiregulin is a potent vascular smooth muscle cell-derived mitogen induced by angiotensin II, endothelin-1, and thrombin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Taylor DS, Cheng X, Pawlowski JE, Wallace AR, Ferrer P, Molloy CJ", "reference": { "type": "PubMed", "id": "9990076", "url": "https://pubmed.ncbi.nlm.nih.gov/9990076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Z0L5-1", "protein_name": "Proepiregulin", "gene_name": "Ereg", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9Z0L5", "url": "https://www.uniprot.org/uniprotkb/Q9Z0L5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9990076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PTPN21 protects PC12 cell against oxygen-glucose deprivation by activating cdk5 through ERK1/2 signaling pathway.", "journal": "European journal of pharmacology", "date": "2017", "authors": "Cui N, Lu H, Li M, Yan Q", "reference": { "type": "PubMed", "id": "28843827", "url": "https://pubmed.ncbi.nlm.nih.gov/28843827" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q62728-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 21", "gene_name": "Ptpn21", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62728", "url": "https://www.uniprot.org/uniprotkb/Q62728" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28843827", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel protein tyrosine phosphatase with sequence homology to the cytoskeletal proteins of the band 4.1 family.", "journal": "FEBS Lett.", "date": "1994", "authors": "L'Abbe D, Banville D, Tong Y, Stocco R, Masson S, Ma S, Fantus G, Shen SH", "reference": { "type": "PubMed", "id": "7805871", "url": "https://pubmed.ncbi.nlm.nih.gov/7805871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q62728-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 21", "gene_name": "Ptpn21", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62728", "url": "https://www.uniprot.org/uniprotkb/Q62728" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7805871", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The heterogenous nuclear riboprotein S1-1 regulates AT1 receptor gene expression via transcriptional and posttranscriptional mechanisms.", "journal": "Archives of biochemistry and biophysics", "date": "2009", "authors": "Mueller CF, Berger A, Zimmer S, Tiyerili V, Nickenig G", "reference": { "type": "PubMed", "id": "19508861", "url": "https://pubmed.ncbi.nlm.nih.gov/19508861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70501-1", "protein_name": "RNA-binding protein 10", "gene_name": "Rbm10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70501", "url": "https://www.uniprot.org/uniprotkb/P70501" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19508861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a RNA binding protein, S1-1.", "journal": "Nucleic acids research", "date": "1996", "authors": "Inoue A, Takahashi KP, Kimura M, Watanabe T, Morisawa S", "reference": { "type": "PubMed", "id": "8760884", "url": "https://pubmed.ncbi.nlm.nih.gov/8760884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70501-1", "protein_name": "RNA-binding protein 10", "gene_name": "Rbm10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70501", "url": "https://www.uniprot.org/uniprotkb/P70501" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8760884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MG53 constitutes a primary determinant of cardiac ischemic preconditioning.", "journal": "Circulation", "date": "2010", "authors": "Cao CM, Zhang Y, Weisleder N, Ferrante C, Wang X, Lv F, Zhang Y, Song R, Hwang M, Jin L, Guo J, Peng W, Li G, Nishi M, Takeshima H, Ma J, Xiao RP", "reference": { "type": "PubMed", "id": "20516375", "url": "https://pubmed.ncbi.nlm.nih.gov/20516375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0JPQ4-1", "protein_name": "Tripartite motif-containing protein 72", "gene_name": "Trim72", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0JPQ4", "url": "https://www.uniprot.org/uniprotkb/A0JPQ4" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20516375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Swimming Exercise Alleviated Insulin Resistance by Regulating Tripartite Motif Family Protein 72 Expression and AKT Signal Pathway in Sprague-Dawley Rats Fed with High-Fat Diet.", "journal": "Journal of diabetes research", "date": "2016", "authors": "Qi J, Yang B, Ren C, Fu J, Zhang J", "reference": { "type": "PubMed", "id": "27843952", "url": "https://pubmed.ncbi.nlm.nih.gov/27843952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0JPQ4-1", "protein_name": "Tripartite motif-containing protein 72", "gene_name": "Trim72", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P47196-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0JPQ4", "url": "https://www.uniprot.org/uniprotkb/A0JPQ4" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE, MTOR and TBK1; alternate", "evidence": [ { "database": "UniProtKB", "id": "P47196", "url": "https://www.uniprot.org/uniprotkb/P47196" }, { "database": "iPTMnet", "id": "P47196", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47196" }, { "database": "PubMed", "id": "10532637", "url": "https://pubmed.ncbi.nlm.nih.gov/10532637" }, { "database": "PubMed", "id": "10772931", "url": "https://pubmed.ncbi.nlm.nih.gov/10772931" }, { "database": "PubMed", "id": "10973608", "url": "https://pubmed.ncbi.nlm.nih.gov/10973608" }, { "database": "PubMed", "id": "11089534", "url": "https://pubmed.ncbi.nlm.nih.gov/11089534" }, { "database": "PubMed", "id": "11162248", "url": "https://pubmed.ncbi.nlm.nih.gov/11162248" }, { "database": "PubMed", "id": "11246877", "url": "https://pubmed.ncbi.nlm.nih.gov/11246877" }, { "database": "PubMed", "id": "11257444", "url": "https://pubmed.ncbi.nlm.nih.gov/11257444" }, { "database": "PubMed", "id": "11473054", "url": "https://pubmed.ncbi.nlm.nih.gov/11473054" }, { "database": "PubMed", "id": "11494150", "url": "https://pubmed.ncbi.nlm.nih.gov/11494150" }, { "database": "PubMed", "id": "11723053", "url": "https://pubmed.ncbi.nlm.nih.gov/11723053" }, { "database": "PubMed", "id": "11785657", "url": "https://pubmed.ncbi.nlm.nih.gov/11785657" }, { "database": "PubMed", "id": "11809761", "url": "https://pubmed.ncbi.nlm.nih.gov/11809761" }, { "database": "PubMed", "id": "11882599", "url": "https://pubmed.ncbi.nlm.nih.gov/11882599" }, { "database": "PubMed", "id": "11922615", "url": "https://pubmed.ncbi.nlm.nih.gov/11922615" }, { "database": "PubMed", "id": "12065658", "url": "https://pubmed.ncbi.nlm.nih.gov/12065658" }, { "database": "PubMed", "id": "12145152", "url": "https://pubmed.ncbi.nlm.nih.gov/12145152" }, { "database": "PubMed", "id": "12191493", "url": "https://pubmed.ncbi.nlm.nih.gov/12191493" }, { "database": "PubMed", "id": "12399007", "url": "https://pubmed.ncbi.nlm.nih.gov/12399007" }, { "database": "PubMed", "id": "12429379", "url": "https://pubmed.ncbi.nlm.nih.gov/12429379" }, { "database": "PubMed", "id": "12701063", "url": "https://pubmed.ncbi.nlm.nih.gov/12701063" }, { "database": "PubMed", "id": "12942548", "url": "https://pubmed.ncbi.nlm.nih.gov/12942548" }, { "database": "PubMed", "id": "14565960", "url": "https://pubmed.ncbi.nlm.nih.gov/14565960" }, { "database": "PubMed", "id": "14654226", "url": "https://pubmed.ncbi.nlm.nih.gov/14654226" }, { "database": "PubMed", "id": "15004002", "url": "https://pubmed.ncbi.nlm.nih.gov/15004002" }, { "database": "PubMed", "id": "15336705", "url": "https://pubmed.ncbi.nlm.nih.gov/15336705" }, { "database": "PubMed", "id": "15358595", "url": "https://pubmed.ncbi.nlm.nih.gov/15358595" }, { "database": "PubMed", "id": "15514089", "url": "https://pubmed.ncbi.nlm.nih.gov/15514089" }, { "database": "PubMed", "id": "15534092", "url": "https://pubmed.ncbi.nlm.nih.gov/15534092" }, { "database": "PubMed", "id": "15550465", "url": "https://pubmed.ncbi.nlm.nih.gov/15550465" }, { "database": "PubMed", "id": "15629512", "url": "https://pubmed.ncbi.nlm.nih.gov/15629512" }, { "database": "PubMed", "id": "15657091", "url": "https://pubmed.ncbi.nlm.nih.gov/15657091" }, { "database": "PubMed", "id": "15718410", "url": "https://pubmed.ncbi.nlm.nih.gov/15718410" }, { "database": "PubMed", "id": "15799772", "url": "https://pubmed.ncbi.nlm.nih.gov/15799772" }, { "database": "PubMed", "id": "15851653", "url": "https://pubmed.ncbi.nlm.nih.gov/15851653" }, { "database": "PubMed", "id": "15853465", "url": "https://pubmed.ncbi.nlm.nih.gov/15853465" }, { "database": "PubMed", "id": "15869474", "url": "https://pubmed.ncbi.nlm.nih.gov/15869474" }, { "database": "PubMed", "id": "16132952", "url": "https://pubmed.ncbi.nlm.nih.gov/16132952" }, { "database": "PubMed", "id": "16341686", "url": "https://pubmed.ncbi.nlm.nih.gov/16341686" }, { "database": "PubMed", "id": "16440211", "url": "https://pubmed.ncbi.nlm.nih.gov/16440211" }, { "database": "PubMed", "id": "16452480", "url": "https://pubmed.ncbi.nlm.nih.gov/16452480" }, { "database": "PubMed", "id": "16538228", "url": "https://pubmed.ncbi.nlm.nih.gov/16538228" }, { "database": "PubMed", "id": "16604263", "url": "https://pubmed.ncbi.nlm.nih.gov/16604263" }, { "database": "PubMed", "id": "16792806", "url": "https://pubmed.ncbi.nlm.nih.gov/16792806" }, { "database": "PubMed", "id": "17098228", "url": "https://pubmed.ncbi.nlm.nih.gov/17098228" }, { "database": "PubMed", "id": "17147515", "url": "https://pubmed.ncbi.nlm.nih.gov/17147515" }, { "database": "PubMed", "id": "17179391", "url": "https://pubmed.ncbi.nlm.nih.gov/17179391" }, { "database": "PubMed", "id": "17223256", "url": "https://pubmed.ncbi.nlm.nih.gov/17223256" }, { "database": "PubMed", "id": "17229473", "url": "https://pubmed.ncbi.nlm.nih.gov/17229473" }, { "database": "PubMed", "id": "17283241", "url": "https://pubmed.ncbi.nlm.nih.gov/17283241" }, { "database": "PubMed", "id": "17302912", "url": "https://pubmed.ncbi.nlm.nih.gov/17302912" }, { "database": "PubMed", "id": "17433823", "url": "https://pubmed.ncbi.nlm.nih.gov/17433823" }, { "database": "PubMed", "id": "17553997", "url": "https://pubmed.ncbi.nlm.nih.gov/17553997" }, { "database": "PubMed", "id": "17570255", "url": "https://pubmed.ncbi.nlm.nih.gov/17570255" }, { "database": "PubMed", "id": "17603289", "url": "https://pubmed.ncbi.nlm.nih.gov/17603289" }, { "database": "PubMed", "id": "17623045", "url": "https://pubmed.ncbi.nlm.nih.gov/17623045" }, { "database": "PubMed", "id": "17823648", "url": "https://pubmed.ncbi.nlm.nih.gov/17823648" }, { "database": "PubMed", "id": "17825157", "url": "https://pubmed.ncbi.nlm.nih.gov/17825157" }, { "database": "PubMed", "id": "17908994", "url": "https://pubmed.ncbi.nlm.nih.gov/17908994" }, { "database": "PubMed", "id": "17925408", "url": "https://pubmed.ncbi.nlm.nih.gov/17925408" }, { "database": "PubMed", "id": "17934340", "url": "https://pubmed.ncbi.nlm.nih.gov/17934340" }, { "database": "PubMed", "id": "17951543", "url": "https://pubmed.ncbi.nlm.nih.gov/17951543" }, { "database": "PubMed", "id": "17964598", "url": "https://pubmed.ncbi.nlm.nih.gov/17964598" }, { "database": "PubMed", "id": "17996850", "url": "https://pubmed.ncbi.nlm.nih.gov/17996850" }, { "database": "PubMed", "id": "18063688", "url": "https://pubmed.ncbi.nlm.nih.gov/18063688" }, { "database": "PubMed", "id": "18073321", "url": "https://pubmed.ncbi.nlm.nih.gov/18073321" }, { "database": "PubMed", "id": "18089761", "url": "https://pubmed.ncbi.nlm.nih.gov/18089761" }, { "database": "PubMed", "id": "18091994", "url": "https://pubmed.ncbi.nlm.nih.gov/18091994" }, { "database": "PubMed", "id": "18094069", "url": "https://pubmed.ncbi.nlm.nih.gov/18094069" }, { "database": "PubMed", "id": "18182053", "url": "https://pubmed.ncbi.nlm.nih.gov/18182053" }, { "database": "PubMed", "id": "18262357", "url": "https://pubmed.ncbi.nlm.nih.gov/18262357" }, { "database": "PubMed", "id": "18311783", "url": "https://pubmed.ncbi.nlm.nih.gov/18311783" }, { "database": "PubMed", "id": "18327703", "url": "https://pubmed.ncbi.nlm.nih.gov/18327703" }, { "database": "PubMed", "id": "18495798", "url": "https://pubmed.ncbi.nlm.nih.gov/18495798" }, { "database": "PubMed", "id": "18534819", "url": "https://pubmed.ncbi.nlm.nih.gov/18534819" }, { "database": "PubMed", "id": "18599524", "url": "https://pubmed.ncbi.nlm.nih.gov/18599524" }, { "database": "PubMed", "id": "18703031", "url": "https://pubmed.ncbi.nlm.nih.gov/18703031" }, { "database": "PubMed", "id": "18703632", "url": "https://pubmed.ncbi.nlm.nih.gov/18703632" }, { "database": "PubMed", "id": "18815221", "url": "https://pubmed.ncbi.nlm.nih.gov/18815221" }, { "database": "PubMed", "id": "19035551", "url": "https://pubmed.ncbi.nlm.nih.gov/19035551" }, { "database": "PubMed", "id": "19139380", "url": "https://pubmed.ncbi.nlm.nih.gov/19139380" }, { "database": "PubMed", "id": "19167463", "url": "https://pubmed.ncbi.nlm.nih.gov/19167463" }, { "database": "PubMed", "id": "19169352", "url": "https://pubmed.ncbi.nlm.nih.gov/19169352" }, { "database": "PubMed", "id": "19193202", "url": "https://pubmed.ncbi.nlm.nih.gov/19193202" }, { "database": "PubMed", "id": "19211711", "url": "https://pubmed.ncbi.nlm.nih.gov/19211711" }, { "database": "PubMed", "id": "19233842", "url": "https://pubmed.ncbi.nlm.nih.gov/19233842" }, { "database": "PubMed", "id": "19349976", "url": "https://pubmed.ncbi.nlm.nih.gov/19349976" }, { "database": "PubMed", "id": "19393628", "url": "https://pubmed.ncbi.nlm.nih.gov/19393628" }, { "database": "PubMed", "id": "19398659", "url": "https://pubmed.ncbi.nlm.nih.gov/19398659" }, { "database": "PubMed", "id": "19443198", "url": "https://pubmed.ncbi.nlm.nih.gov/19443198" }, { "database": "PubMed", "id": "19525380", "url": "https://pubmed.ncbi.nlm.nih.gov/19525380" }, { "database": "PubMed", "id": "19549072", "url": "https://pubmed.ncbi.nlm.nih.gov/19549072" }, { "database": "PubMed", "id": "19593440", "url": "https://pubmed.ncbi.nlm.nih.gov/19593440" }, { "database": "PubMed", "id": "19605547", "url": "https://pubmed.ncbi.nlm.nih.gov/19605547" }, { "database": "PubMed", "id": "19641606", "url": "https://pubmed.ncbi.nlm.nih.gov/19641606" }, { "database": "PubMed", "id": "19652884", "url": "https://pubmed.ncbi.nlm.nih.gov/19652884" }, { "database": "PubMed", "id": "19706162", "url": "https://pubmed.ncbi.nlm.nih.gov/19706162" }, { "database": "PubMed", "id": "19752164", "url": "https://pubmed.ncbi.nlm.nih.gov/19752164" }, { "database": "PubMed", "id": "19854228", "url": "https://pubmed.ncbi.nlm.nih.gov/19854228" }, { "database": "PubMed", "id": "19936256", "url": "https://pubmed.ncbi.nlm.nih.gov/19936256" }, { "database": "PubMed", "id": "19995565", "url": "https://pubmed.ncbi.nlm.nih.gov/19995565" }, { "database": "PubMed", "id": "20043814", "url": "https://pubmed.ncbi.nlm.nih.gov/20043814" }, { "database": "PubMed", "id": "20153736", "url": "https://pubmed.ncbi.nlm.nih.gov/20153736" }, { "database": "PubMed", "id": "20170632", "url": "https://pubmed.ncbi.nlm.nih.gov/20170632" }, { "database": "PubMed", "id": "20188769", "url": "https://pubmed.ncbi.nlm.nih.gov/20188769" }, { "database": "PubMed", "id": "20233453", "url": "https://pubmed.ncbi.nlm.nih.gov/20233453" }, { "database": "PubMed", "id": "20236230", "url": "https://pubmed.ncbi.nlm.nih.gov/20236230" }, { "database": "PubMed", "id": "20299475", "url": "https://pubmed.ncbi.nlm.nih.gov/20299475" }, { "database": "PubMed", "id": "20368999", "url": "https://pubmed.ncbi.nlm.nih.gov/20368999" }, { "database": "PubMed", "id": "20377997", "url": "https://pubmed.ncbi.nlm.nih.gov/20377997" }, { "database": "PubMed", "id": "20484011", "url": "https://pubmed.ncbi.nlm.nih.gov/20484011" }, { "database": "PubMed", "id": "20501641", "url": "https://pubmed.ncbi.nlm.nih.gov/20501641" }, { "database": "PubMed", "id": "20519555", "url": "https://pubmed.ncbi.nlm.nih.gov/20519555" }, { "database": "PubMed", "id": "20550678", "url": "https://pubmed.ncbi.nlm.nih.gov/20550678" }, { "database": "PubMed", "id": "20562516", "url": "https://pubmed.ncbi.nlm.nih.gov/20562516" }, { "database": "PubMed", "id": "20698860", "url": "https://pubmed.ncbi.nlm.nih.gov/20698860" }, { "database": "PubMed", "id": "20813549", "url": "https://pubmed.ncbi.nlm.nih.gov/20813549" }, { "database": "PubMed", "id": "20863371", "url": "https://pubmed.ncbi.nlm.nih.gov/20863371" }, { "database": "PubMed", "id": "20940001", "url": "https://pubmed.ncbi.nlm.nih.gov/20940001" }, { "database": "PubMed", "id": "20943770", "url": "https://pubmed.ncbi.nlm.nih.gov/20943770" }, { "database": "PubMed", "id": "21078165", "url": "https://pubmed.ncbi.nlm.nih.gov/21078165" }, { "database": "PubMed", "id": "21088934", "url": "https://pubmed.ncbi.nlm.nih.gov/21088934" }, { "database": "PubMed", "id": "21103992", "url": "https://pubmed.ncbi.nlm.nih.gov/21103992" }, { "database": "PubMed", "id": "21143387", "url": "https://pubmed.ncbi.nlm.nih.gov/21143387" }, { "database": "PubMed", "id": "21218507", "url": "https://pubmed.ncbi.nlm.nih.gov/21218507" }, { "database": "PubMed", "id": "21232147", "url": "https://pubmed.ncbi.nlm.nih.gov/21232147" }, { "database": "PubMed", "id": "21270262", "url": "https://pubmed.ncbi.nlm.nih.gov/21270262" }, { "database": "PubMed", "id": "21347252", "url": "https://pubmed.ncbi.nlm.nih.gov/21347252" }, { "database": "PubMed", "id": "21357504", "url": "https://pubmed.ncbi.nlm.nih.gov/21357504" }, { "database": "PubMed", "id": "21375752", "url": "https://pubmed.ncbi.nlm.nih.gov/21375752" }, { "database": "PubMed", "id": "21435395", "url": "https://pubmed.ncbi.nlm.nih.gov/21435395" }, { "database": "PubMed", "id": "21514684", "url": "https://pubmed.ncbi.nlm.nih.gov/21514684" }, { "database": "PubMed", "id": "21543456", "url": "https://pubmed.ncbi.nlm.nih.gov/21543456" }, { "database": "PubMed", "id": "21563965", "url": "https://pubmed.ncbi.nlm.nih.gov/21563965" }, { "database": "PubMed", "id": "21618539", "url": "https://pubmed.ncbi.nlm.nih.gov/21618539" }, { "database": "PubMed", "id": "21626435", "url": "https://pubmed.ncbi.nlm.nih.gov/21626435" }, { "database": "PubMed", "id": "21671887", "url": "https://pubmed.ncbi.nlm.nih.gov/21671887" }, { "database": "PubMed", "id": "21731709", "url": "https://pubmed.ncbi.nlm.nih.gov/21731709" }, { "database": "PubMed", "id": "21763267", "url": "https://pubmed.ncbi.nlm.nih.gov/21763267" }, { "database": "PubMed", "id": "21785619", "url": "https://pubmed.ncbi.nlm.nih.gov/21785619" }, { "database": "PubMed", "id": "21949832", "url": "https://pubmed.ncbi.nlm.nih.gov/21949832" }, { "database": "PubMed", "id": "21983076", "url": "https://pubmed.ncbi.nlm.nih.gov/21983076" }, { "database": "PubMed", "id": "22004361", "url": "https://pubmed.ncbi.nlm.nih.gov/22004361" }, { "database": "PubMed", "id": "22039465", "url": "https://pubmed.ncbi.nlm.nih.gov/22039465" }, { "database": "PubMed", "id": "22087313", "url": "https://pubmed.ncbi.nlm.nih.gov/22087313" }, { "database": "PubMed", "id": "22286902", "url": "https://pubmed.ncbi.nlm.nih.gov/22286902" }, { "database": "PubMed", "id": "22325092", "url": "https://pubmed.ncbi.nlm.nih.gov/22325092" }, { "database": "PubMed", "id": "22331547", "url": "https://pubmed.ncbi.nlm.nih.gov/22331547" }, { "database": "PubMed", "id": "22344624", "url": "https://pubmed.ncbi.nlm.nih.gov/22344624" }, { "database": "PubMed", "id": "22362362", "url": "https://pubmed.ncbi.nlm.nih.gov/22362362" }, { "database": "PubMed", "id": "22406051", "url": "https://pubmed.ncbi.nlm.nih.gov/22406051" }, { "database": "PubMed", "id": "22458687", "url": "https://pubmed.ncbi.nlm.nih.gov/22458687" }, { "database": "PubMed", "id": "22479390", "url": "https://pubmed.ncbi.nlm.nih.gov/22479390" }, { "database": "PubMed", "id": "22558198", "url": "https://pubmed.ncbi.nlm.nih.gov/22558198" }, { "database": "PubMed", "id": "22610671", "url": "https://pubmed.ncbi.nlm.nih.gov/22610671" }, { "database": "PubMed", "id": "22621761", "url": "https://pubmed.ncbi.nlm.nih.gov/22621761" }, { "database": "PubMed", "id": "22643085", "url": "https://pubmed.ncbi.nlm.nih.gov/22643085" }, { "database": "PubMed", "id": "22688333", "url": "https://pubmed.ncbi.nlm.nih.gov/22688333" }, { "database": "PubMed", "id": "22715398", "url": "https://pubmed.ncbi.nlm.nih.gov/22715398" }, { "database": "PubMed", "id": "22747981", "url": "https://pubmed.ncbi.nlm.nih.gov/22747981" }, { "database": "PubMed", "id": "22775214", "url": "https://pubmed.ncbi.nlm.nih.gov/22775214" }, { "database": "PubMed", "id": "22798709", "url": "https://pubmed.ncbi.nlm.nih.gov/22798709" }, { "database": "PubMed", "id": "22809512", "url": "https://pubmed.ncbi.nlm.nih.gov/22809512" }, { "database": "PubMed", "id": "22827965", "url": "https://pubmed.ncbi.nlm.nih.gov/22827965" }, { "database": "PubMed", "id": "22900166", "url": "https://pubmed.ncbi.nlm.nih.gov/22900166" }, { "database": "PubMed", "id": "22960175", "url": "https://pubmed.ncbi.nlm.nih.gov/22960175" }, { "database": "PubMed", "id": "22989629", "url": "https://pubmed.ncbi.nlm.nih.gov/22989629" }, { "database": "PubMed", "id": "23050041", "url": "https://pubmed.ncbi.nlm.nih.gov/23050041" }, { "database": "PubMed", "id": "23069112", "url": "https://pubmed.ncbi.nlm.nih.gov/23069112" }, { "database": "PubMed", "id": "23082275", "url": "https://pubmed.ncbi.nlm.nih.gov/23082275" }, { "database": "PubMed", "id": "23118851", "url": "https://pubmed.ncbi.nlm.nih.gov/23118851" }, { "database": "PubMed", "id": "23183538", "url": "https://pubmed.ncbi.nlm.nih.gov/23183538" }, { "database": "PubMed", "id": "23209733", "url": "https://pubmed.ncbi.nlm.nih.gov/23209733" }, { "database": "PubMed", "id": "23264564", "url": "https://pubmed.ncbi.nlm.nih.gov/23264564" }, { "database": "PubMed", "id": "23272147", "url": "https://pubmed.ncbi.nlm.nih.gov/23272147" }, { "database": "PubMed", "id": "23300590", "url": "https://pubmed.ncbi.nlm.nih.gov/23300590" }, { "database": "PubMed", "id": "23437791", "url": "https://pubmed.ncbi.nlm.nih.gov/23437791" }, { "database": "PubMed", "id": "23538529", "url": "https://pubmed.ncbi.nlm.nih.gov/23538529" }, { "database": "PubMed", "id": "23555802", "url": "https://pubmed.ncbi.nlm.nih.gov/23555802" }, { "database": "PubMed", "id": "23583603", "url": "https://pubmed.ncbi.nlm.nih.gov/23583603" }, { "database": "PubMed", "id": "23598645", "url": "https://pubmed.ncbi.nlm.nih.gov/23598645" }, { "database": "PubMed", "id": "23620811", "url": "https://pubmed.ncbi.nlm.nih.gov/23620811" }, { "database": "PubMed", "id": "23658701", "url": "https://pubmed.ncbi.nlm.nih.gov/23658701" }, { "database": "PubMed", "id": "23681769", "url": "https://pubmed.ncbi.nlm.nih.gov/23681769" }, { "database": "PubMed", "id": "23685141", "url": "https://pubmed.ncbi.nlm.nih.gov/23685141" }, { "database": "PubMed", "id": "23686980", "url": "https://pubmed.ncbi.nlm.nih.gov/23686980" }, { "database": "PubMed", "id": "23712282", "url": "https://pubmed.ncbi.nlm.nih.gov/23712282" }, { "database": "PubMed", "id": "23737849", "url": "https://pubmed.ncbi.nlm.nih.gov/23737849" }, { "database": "PubMed", "id": "23739679", "url": "https://pubmed.ncbi.nlm.nih.gov/23739679" }, { "database": "PubMed", "id": "23768545", "url": "https://pubmed.ncbi.nlm.nih.gov/23768545" }, { "database": "PubMed", "id": "23772401", "url": "https://pubmed.ncbi.nlm.nih.gov/23772401" }, { "database": "PubMed", "id": "23781144", "url": "https://pubmed.ncbi.nlm.nih.gov/23781144" }, { "database": "PubMed", "id": "23841996", "url": "https://pubmed.ncbi.nlm.nih.gov/23841996" }, { "database": "PubMed", "id": "23862227", "url": "https://pubmed.ncbi.nlm.nih.gov/23862227" }, { "database": "PubMed", "id": "23863813", "url": "https://pubmed.ncbi.nlm.nih.gov/23863813" }, { "database": "PubMed", "id": "24023607", "url": "https://pubmed.ncbi.nlm.nih.gov/24023607" }, { "database": "PubMed", "id": "24039875", "url": "https://pubmed.ncbi.nlm.nih.gov/24039875" }, { "database": "PubMed", "id": "24041262", "url": "https://pubmed.ncbi.nlm.nih.gov/24041262" }, { "database": "PubMed", "id": "24041947", "url": "https://pubmed.ncbi.nlm.nih.gov/24041947" }, { "database": "PubMed", "id": "24060216", "url": "https://pubmed.ncbi.nlm.nih.gov/24060216" }, { "database": "PubMed", "id": "24246222", "url": "https://pubmed.ncbi.nlm.nih.gov/24246222" }, { "database": "PubMed", "id": "24251870", "url": "https://pubmed.ncbi.nlm.nih.gov/24251870" }, { "database": "PubMed", "id": "24300170", "url": "https://pubmed.ncbi.nlm.nih.gov/24300170" }, { "database": "PubMed", "id": "24312605", "url": "https://pubmed.ncbi.nlm.nih.gov/24312605" }, { "database": "PubMed", "id": "24466133", "url": "https://pubmed.ncbi.nlm.nih.gov/24466133" }, { "database": "PubMed", "id": "24472754", "url": "https://pubmed.ncbi.nlm.nih.gov/24472754" }, { "database": "PubMed", "id": "24597762", "url": "https://pubmed.ncbi.nlm.nih.gov/24597762" }, { "database": "PubMed", "id": "24607498", "url": "https://pubmed.ncbi.nlm.nih.gov/24607498" }, { "database": "PubMed", "id": "24619883", "url": "https://pubmed.ncbi.nlm.nih.gov/24619883" }, { "database": "PubMed", "id": "24675471", "url": "https://pubmed.ncbi.nlm.nih.gov/24675471" }, { "database": "PubMed", "id": "24690900", "url": "https://pubmed.ncbi.nlm.nih.gov/24690900" }, { "database": "PubMed", "id": "24694591", "url": "https://pubmed.ncbi.nlm.nih.gov/24694591" }, { "database": "PubMed", "id": "24740573", "url": "https://pubmed.ncbi.nlm.nih.gov/24740573" }, { "database": "PubMed", "id": "24759991", "url": "https://pubmed.ncbi.nlm.nih.gov/24759991" }, { "database": "PubMed", "id": "24913014", "url": "https://pubmed.ncbi.nlm.nih.gov/24913014" }, { "database": "PubMed", "id": "24923557", "url": "https://pubmed.ncbi.nlm.nih.gov/24923557" }, { "database": "PubMed", "id": "24946090", "url": "https://pubmed.ncbi.nlm.nih.gov/24946090" }, { "database": "PubMed", "id": "24949720", "url": "https://pubmed.ncbi.nlm.nih.gov/24949720" }, { "database": "PubMed", "id": "24950409", "url": "https://pubmed.ncbi.nlm.nih.gov/24950409" }, { "database": "PubMed", "id": "24959678", "url": "https://pubmed.ncbi.nlm.nih.gov/24959678" }, { "database": "PubMed", "id": "24983010", "url": "https://pubmed.ncbi.nlm.nih.gov/24983010" }, { "database": "PubMed", "id": "25014216", "url": "https://pubmed.ncbi.nlm.nih.gov/25014216" }, { "database": "PubMed", "id": "25047034", "url": "https://pubmed.ncbi.nlm.nih.gov/25047034" }, { "database": "PubMed", "id": "25105067", "url": "https://pubmed.ncbi.nlm.nih.gov/25105067" }, { "database": "PubMed", "id": "25142208", "url": "https://pubmed.ncbi.nlm.nih.gov/25142208" }, { "database": "PubMed", "id": "25181477", "url": "https://pubmed.ncbi.nlm.nih.gov/25181477" }, { "database": "PubMed", "id": "25257559", "url": "https://pubmed.ncbi.nlm.nih.gov/25257559" }, { "database": "PubMed", "id": "25276168", "url": "https://pubmed.ncbi.nlm.nih.gov/25276168" }, { "database": "PubMed", "id": "25332063", "url": "https://pubmed.ncbi.nlm.nih.gov/25332063" }, { "database": "PubMed", "id": "25388834", "url": "https://pubmed.ncbi.nlm.nih.gov/25388834" }, { "database": "PubMed", "id": "25391857", "url": "https://pubmed.ncbi.nlm.nih.gov/25391857" }, { "database": "PubMed", "id": "25424428", "url": "https://pubmed.ncbi.nlm.nih.gov/25424428" }, { "database": "PubMed", "id": "25437926", "url": "https://pubmed.ncbi.nlm.nih.gov/25437926" }, { "database": "PubMed", "id": "25576887", "url": "https://pubmed.ncbi.nlm.nih.gov/25576887" }, { "database": "PubMed", "id": "25620135", "url": "https://pubmed.ncbi.nlm.nih.gov/25620135" }, { "database": "PubMed", "id": "25670830", "url": "https://pubmed.ncbi.nlm.nih.gov/25670830" }, { "database": "PubMed", "id": "25701358", "url": "https://pubmed.ncbi.nlm.nih.gov/25701358" }, { "database": "PubMed", "id": "25705234", "url": "https://pubmed.ncbi.nlm.nih.gov/25705234" }, { "database": "PubMed", "id": "25822413", "url": "https://pubmed.ncbi.nlm.nih.gov/25822413" }, { "database": "PubMed", "id": "25883115", "url": "https://pubmed.ncbi.nlm.nih.gov/25883115" }, { "database": "PubMed", "id": "25889299", "url": "https://pubmed.ncbi.nlm.nih.gov/25889299" }, { "database": "PubMed", "id": "25909895", "url": "https://pubmed.ncbi.nlm.nih.gov/25909895" }, { "database": "PubMed", "id": "25923322", "url": "https://pubmed.ncbi.nlm.nih.gov/25923322" }, { "database": "PubMed", "id": "25954164", "url": "https://pubmed.ncbi.nlm.nih.gov/25954164" }, { "database": "PubMed", "id": "26076958", "url": "https://pubmed.ncbi.nlm.nih.gov/26076958" }, { "database": "PubMed", "id": "26084330", "url": "https://pubmed.ncbi.nlm.nih.gov/26084330" }, { "database": "PubMed", "id": "26133970", "url": "https://pubmed.ncbi.nlm.nih.gov/26133970" }, { "database": "PubMed", "id": "26136193", "url": "https://pubmed.ncbi.nlm.nih.gov/26136193" }, { "database": "PubMed", "id": "26136414", "url": "https://pubmed.ncbi.nlm.nih.gov/26136414" }, { "database": "PubMed", "id": "26167913", "url": "https://pubmed.ncbi.nlm.nih.gov/26167913" }, { "database": "PubMed", "id": "26172834", "url": "https://pubmed.ncbi.nlm.nih.gov/26172834" }, { "database": "PubMed", "id": "26261541", "url": "https://pubmed.ncbi.nlm.nih.gov/26261541" }, { "database": "PubMed", "id": "26322248", "url": "https://pubmed.ncbi.nlm.nih.gov/26322248" }, { "database": "PubMed", "id": "26341783", "url": "https://pubmed.ncbi.nlm.nih.gov/26341783" }, { "database": "PubMed", "id": "26386043", "url": "https://pubmed.ncbi.nlm.nih.gov/26386043" }, { "database": "PubMed", "id": "26402755", "url": "https://pubmed.ncbi.nlm.nih.gov/26402755" }, { "database": "PubMed", "id": "26423232", "url": "https://pubmed.ncbi.nlm.nih.gov/26423232" }, { "database": "PubMed", "id": "26471759", "url": "https://pubmed.ncbi.nlm.nih.gov/26471759" }, { "database": "PubMed", "id": "26513344", "url": "https://pubmed.ncbi.nlm.nih.gov/26513344" }, { "database": "PubMed", "id": "26528797", "url": "https://pubmed.ncbi.nlm.nih.gov/26528797" }, { "database": "PubMed", "id": "26538265", "url": "https://pubmed.ncbi.nlm.nih.gov/26538265" }, { "database": "PubMed", "id": "26581389", "url": "https://pubmed.ncbi.nlm.nih.gov/26581389" }, { "database": "PubMed", "id": "26597376", "url": "https://pubmed.ncbi.nlm.nih.gov/26597376" }, { "database": "PubMed", "id": "26647069", "url": "https://pubmed.ncbi.nlm.nih.gov/26647069" }, { "database": "PubMed", "id": "26717963", "url": "https://pubmed.ncbi.nlm.nih.gov/26717963" }, { "database": "PubMed", "id": "26797604", "url": "https://pubmed.ncbi.nlm.nih.gov/26797604" }, { "database": "PubMed", "id": "26893473", "url": "https://pubmed.ncbi.nlm.nih.gov/26893473" }, { "database": "PubMed", "id": "26899575", "url": "https://pubmed.ncbi.nlm.nih.gov/26899575" }, { "database": "PubMed", "id": "26950279", "url": "https://pubmed.ncbi.nlm.nih.gov/26950279" }, { "database": "PubMed", "id": "26965244", "url": "https://pubmed.ncbi.nlm.nih.gov/26965244" }, { "database": "PubMed", "id": "26979522", "url": "https://pubmed.ncbi.nlm.nih.gov/26979522" }, { "database": "PubMed", "id": "27019292", "url": "https://pubmed.ncbi.nlm.nih.gov/27019292" }, { "database": "PubMed", "id": "27057269", "url": "https://pubmed.ncbi.nlm.nih.gov/27057269" }, { "database": "PubMed", "id": "27057277", "url": "https://pubmed.ncbi.nlm.nih.gov/27057277" }, { "database": "PubMed", "id": "27107885", "url": "https://pubmed.ncbi.nlm.nih.gov/27107885" }, { "database": "PubMed", "id": "27123039", "url": "https://pubmed.ncbi.nlm.nih.gov/27123039" }, { "database": "PubMed", "id": "27153053", "url": "https://pubmed.ncbi.nlm.nih.gov/27153053" }, { "database": "PubMed", "id": "27240156", "url": "https://pubmed.ncbi.nlm.nih.gov/27240156" }, { "database": "PubMed", "id": "27293459", "url": "https://pubmed.ncbi.nlm.nih.gov/27293459" }, { "database": "PubMed", "id": "27302964", "url": "https://pubmed.ncbi.nlm.nih.gov/27302964" }, { "database": "PubMed", "id": "27446335", "url": "https://pubmed.ncbi.nlm.nih.gov/27446335" }, { "database": "PubMed", "id": "27456523", "url": "https://pubmed.ncbi.nlm.nih.gov/27456523" }, { "database": "PubMed", "id": "27550988", "url": "https://pubmed.ncbi.nlm.nih.gov/27550988" }, { "database": "PubMed", "id": "27590139", "url": "https://pubmed.ncbi.nlm.nih.gov/27590139" }, { "database": "PubMed", "id": "27649243", "url": "https://pubmed.ncbi.nlm.nih.gov/27649243" }, { "database": "PubMed", "id": "27702882", "url": "https://pubmed.ncbi.nlm.nih.gov/27702882" }, { "database": "PubMed", "id": "27766036", "url": "https://pubmed.ncbi.nlm.nih.gov/27766036" }, { "database": "PubMed", "id": "27812679", "url": "https://pubmed.ncbi.nlm.nih.gov/27812679" }, { "database": "PubMed", "id": "27843952", "url": "https://pubmed.ncbi.nlm.nih.gov/27843952" }, { "database": "PubMed", "id": "27861620", "url": "https://pubmed.ncbi.nlm.nih.gov/27861620" }, { "database": "PubMed", "id": "27866373", "url": "https://pubmed.ncbi.nlm.nih.gov/27866373" }, { "database": "PubMed", "id": "27912206", "url": "https://pubmed.ncbi.nlm.nih.gov/27912206" }, { "database": "PubMed", "id": "27994511", "url": "https://pubmed.ncbi.nlm.nih.gov/27994511" }, { "database": "PubMed", "id": "28065941", "url": "https://pubmed.ncbi.nlm.nih.gov/28065941" }, { "database": "PubMed", "id": "28090201", "url": "https://pubmed.ncbi.nlm.nih.gov/28090201" }, { "database": "PubMed", "id": "28096436", "url": "https://pubmed.ncbi.nlm.nih.gov/28096436" }, { "database": "PubMed", "id": "28112209", "url": "https://pubmed.ncbi.nlm.nih.gov/28112209" }, { "database": "PubMed", "id": "28122357", "url": "https://pubmed.ncbi.nlm.nih.gov/28122357" }, { "database": "PubMed", "id": "28148930", "url": "https://pubmed.ncbi.nlm.nih.gov/28148930" }, { "database": "PubMed", "id": "28151484", "url": "https://pubmed.ncbi.nlm.nih.gov/28151484" }, { "database": "PubMed", "id": "28194115", "url": "https://pubmed.ncbi.nlm.nih.gov/28194115" }, { "database": "PubMed", "id": "28236211", "url": "https://pubmed.ncbi.nlm.nih.gov/28236211" }, { "database": "PubMed", "id": "28290047", "url": "https://pubmed.ncbi.nlm.nih.gov/28290047" }, { "database": "PubMed", "id": "28296942", "url": "https://pubmed.ncbi.nlm.nih.gov/28296942" }, { "database": "PubMed", "id": "28415692", "url": "https://pubmed.ncbi.nlm.nih.gov/28415692" }, { "database": "PubMed", "id": "28555033", "url": "https://pubmed.ncbi.nlm.nih.gov/28555033" }, { "database": "PubMed", "id": "28560002", "url": "https://pubmed.ncbi.nlm.nih.gov/28560002" }, { "database": "PubMed", "id": "28638224", "url": "https://pubmed.ncbi.nlm.nih.gov/28638224" }, { "database": "PubMed", "id": "28677618", "url": "https://pubmed.ncbi.nlm.nih.gov/28677618" }, { "database": "PubMed", "id": "28738535", "url": "https://pubmed.ncbi.nlm.nih.gov/28738535" }, { "database": "PubMed", "id": "28868045", "url": "https://pubmed.ncbi.nlm.nih.gov/28868045" }, { "database": "PubMed", "id": "28953236", "url": "https://pubmed.ncbi.nlm.nih.gov/28953236" }, { "database": "PubMed", "id": "28961505", "url": "https://pubmed.ncbi.nlm.nih.gov/28961505" }, { "database": "PubMed", "id": "29069833", "url": "https://pubmed.ncbi.nlm.nih.gov/29069833" }, { "database": "PubMed", "id": "29122552", "url": "https://pubmed.ncbi.nlm.nih.gov/29122552" }, { "database": "PubMed", "id": "29248832", "url": "https://pubmed.ncbi.nlm.nih.gov/29248832" }, { "database": "PubMed", "id": "29290948", "url": "https://pubmed.ncbi.nlm.nih.gov/29290948" }, { "database": "PubMed", "id": "29541403", "url": "https://pubmed.ncbi.nlm.nih.gov/29541403" }, { "database": "PubMed", "id": "29550832", "url": "https://pubmed.ncbi.nlm.nih.gov/29550832" }, { "database": "PubMed", "id": "29568075", "url": "https://pubmed.ncbi.nlm.nih.gov/29568075" }, { "database": "PubMed", "id": "29623928", "url": "https://pubmed.ncbi.nlm.nih.gov/29623928" }, { "database": "PubMed", "id": "29626425", "url": "https://pubmed.ncbi.nlm.nih.gov/29626425" }, { "database": "PubMed", "id": "29670524", "url": "https://pubmed.ncbi.nlm.nih.gov/29670524" }, { "database": "PubMed", "id": "29693586", "url": "https://pubmed.ncbi.nlm.nih.gov/29693586" }, { "database": "PubMed", "id": "29700212", "url": "https://pubmed.ncbi.nlm.nih.gov/29700212" }, { "database": "PubMed", "id": "29757673", "url": "https://pubmed.ncbi.nlm.nih.gov/29757673" }, { "database": "PubMed", "id": "29972829", "url": "https://pubmed.ncbi.nlm.nih.gov/29972829" }, { "database": "PubMed", "id": "29997510", "url": "https://pubmed.ncbi.nlm.nih.gov/29997510" }, { "database": "PubMed", "id": "30017543", "url": "https://pubmed.ncbi.nlm.nih.gov/30017543" }, { "database": "PubMed", "id": "30204501", "url": "https://pubmed.ncbi.nlm.nih.gov/30204501" }, { "database": "PubMed", "id": "30213025", "url": "https://pubmed.ncbi.nlm.nih.gov/30213025" }, { "database": "PubMed", "id": "30213108", "url": "https://pubmed.ncbi.nlm.nih.gov/30213108" }, { "database": "PubMed", "id": "30226217", "url": "https://pubmed.ncbi.nlm.nih.gov/30226217" }, { "database": "PubMed", "id": "30233281", "url": "https://pubmed.ncbi.nlm.nih.gov/30233281" }, { "database": "PubMed", "id": "30264903", "url": "https://pubmed.ncbi.nlm.nih.gov/30264903" }, { "database": "PubMed", "id": "30304029", "url": "https://pubmed.ncbi.nlm.nih.gov/30304029" }, { "database": "PubMed", "id": "30319352", "url": "https://pubmed.ncbi.nlm.nih.gov/30319352" }, { "database": "PubMed", "id": "30457911", "url": "https://pubmed.ncbi.nlm.nih.gov/30457911" }, { "database": "PubMed", "id": "30510624", "url": "https://pubmed.ncbi.nlm.nih.gov/30510624" }, { "database": "PubMed", "id": "30533546", "url": "https://pubmed.ncbi.nlm.nih.gov/30533546" }, { "database": "PubMed", "id": "30564278", "url": "https://pubmed.ncbi.nlm.nih.gov/30564278" }, { "database": "PubMed", "id": "30678072", "url": "https://pubmed.ncbi.nlm.nih.gov/30678072" }, { "database": "PubMed", "id": "30678506", "url": "https://pubmed.ncbi.nlm.nih.gov/30678506" }, { "database": "PubMed", "id": "30697602", "url": "https://pubmed.ncbi.nlm.nih.gov/30697602" }, { "database": "PubMed", "id": "30703614", "url": "https://pubmed.ncbi.nlm.nih.gov/30703614" }, { "database": "PubMed", "id": "30926678", "url": "https://pubmed.ncbi.nlm.nih.gov/30926678" }, { "database": "PubMed", "id": "30967498", "url": "https://pubmed.ncbi.nlm.nih.gov/30967498" }, { "database": "PubMed", "id": "30987105", "url": "https://pubmed.ncbi.nlm.nih.gov/30987105" }, { "database": "PubMed", "id": "31089370", "url": "https://pubmed.ncbi.nlm.nih.gov/31089370" }, { "database": "PubMed", "id": "31165412", "url": "https://pubmed.ncbi.nlm.nih.gov/31165412" }, { "database": "PubMed", "id": "31169194", "url": "https://pubmed.ncbi.nlm.nih.gov/31169194" }, { "database": "PubMed", "id": "31320660", "url": "https://pubmed.ncbi.nlm.nih.gov/31320660" }, { "database": "PubMed", "id": "31354241", "url": "https://pubmed.ncbi.nlm.nih.gov/31354241" }, { "database": "PubMed", "id": "31362343", "url": "https://pubmed.ncbi.nlm.nih.gov/31362343" }, { "database": "PubMed", "id": "31426858", "url": "https://pubmed.ncbi.nlm.nih.gov/31426858" }, { "database": "PubMed", "id": "31463398", "url": "https://pubmed.ncbi.nlm.nih.gov/31463398" }, { "database": "PubMed", "id": "31480394", "url": "https://pubmed.ncbi.nlm.nih.gov/31480394" }, { "database": "PubMed", "id": "31523188", "url": "https://pubmed.ncbi.nlm.nih.gov/31523188" }, { "database": "PubMed", "id": "31548435", "url": "https://pubmed.ncbi.nlm.nih.gov/31548435" }, { "database": "PubMed", "id": "31594751", "url": "https://pubmed.ncbi.nlm.nih.gov/31594751" }, { "database": "PubMed", "id": "31746373", "url": "https://pubmed.ncbi.nlm.nih.gov/31746373" }, { "database": "PubMed", "id": "31822702", "url": "https://pubmed.ncbi.nlm.nih.gov/31822702" }, { "database": "PubMed", "id": "31849609", "url": "https://pubmed.ncbi.nlm.nih.gov/31849609" }, { "database": "PubMed", "id": "31991719", "url": "https://pubmed.ncbi.nlm.nih.gov/31991719" }, { "database": "PubMed", "id": "31995605", "url": "https://pubmed.ncbi.nlm.nih.gov/31995605" }, { "database": "PubMed", "id": "32041182", "url": "https://pubmed.ncbi.nlm.nih.gov/32041182" }, { "database": "PubMed", "id": "32053588", "url": "https://pubmed.ncbi.nlm.nih.gov/32053588" }, { "database": "PubMed", "id": "32087746", "url": "https://pubmed.ncbi.nlm.nih.gov/32087746" }, { "database": "PubMed", "id": "32187996", "url": "https://pubmed.ncbi.nlm.nih.gov/32187996" }, { "database": "PubMed", "id": "32326050", "url": "https://pubmed.ncbi.nlm.nih.gov/32326050" }, { "database": "PubMed", "id": "32372957", "url": "https://pubmed.ncbi.nlm.nih.gov/32372957" }, { "database": "PubMed", "id": "32382683", "url": "https://pubmed.ncbi.nlm.nih.gov/32382683" }, { "database": "PubMed", "id": "32411219", "url": "https://pubmed.ncbi.nlm.nih.gov/32411219" }, { "database": "PubMed", "id": "32422127", "url": "https://pubmed.ncbi.nlm.nih.gov/32422127" }, { "database": "PubMed", "id": "32451116", "url": "https://pubmed.ncbi.nlm.nih.gov/32451116" }, { "database": "PubMed", "id": "32731484", "url": "https://pubmed.ncbi.nlm.nih.gov/32731484" }, { "database": "PubMed", "id": "32781725", "url": "https://pubmed.ncbi.nlm.nih.gov/32781725" }, { "database": "PubMed", "id": "32889520", "url": "https://pubmed.ncbi.nlm.nih.gov/32889520" }, { "database": "PubMed", "id": "32922198", "url": "https://pubmed.ncbi.nlm.nih.gov/32922198" }, { "database": "PubMed", "id": "32963694", "url": "https://pubmed.ncbi.nlm.nih.gov/32963694" }, { "database": "PubMed", "id": "33069157", "url": "https://pubmed.ncbi.nlm.nih.gov/33069157" }, { "database": "PubMed", "id": "33125603", "url": "https://pubmed.ncbi.nlm.nih.gov/33125603" }, { "database": "PubMed", "id": "33188203", "url": "https://pubmed.ncbi.nlm.nih.gov/33188203" }, { "database": "PubMed", "id": "33294293", "url": "https://pubmed.ncbi.nlm.nih.gov/33294293" }, { "database": "PubMed", "id": "33344690", "url": "https://pubmed.ncbi.nlm.nih.gov/33344690" }, { "database": "PubMed", "id": "33356018", "url": "https://pubmed.ncbi.nlm.nih.gov/33356018" }, { "database": "PubMed", "id": "33445612", "url": "https://pubmed.ncbi.nlm.nih.gov/33445612" }, { "database": "PubMed", "id": "33479375", "url": "https://pubmed.ncbi.nlm.nih.gov/33479375" }, { "database": "PubMed", "id": "33523568", "url": "https://pubmed.ncbi.nlm.nih.gov/33523568" }, { "database": "PubMed", "id": "33530478", "url": "https://pubmed.ncbi.nlm.nih.gov/33530478" }, { "database": "PubMed", "id": "33692686", "url": "https://pubmed.ncbi.nlm.nih.gov/33692686" }, { "database": "PubMed", "id": "33732083", "url": "https://pubmed.ncbi.nlm.nih.gov/33732083" }, { "database": "PubMed", "id": "33788626", "url": "https://pubmed.ncbi.nlm.nih.gov/33788626" }, { "database": "PubMed", "id": "33799501", "url": "https://pubmed.ncbi.nlm.nih.gov/33799501" }, { "database": "PubMed", "id": "33809219", "url": "https://pubmed.ncbi.nlm.nih.gov/33809219" }, { "database": "PubMed", "id": "33841146", "url": "https://pubmed.ncbi.nlm.nih.gov/33841146" }, { "database": "PubMed", "id": "33917810", "url": "https://pubmed.ncbi.nlm.nih.gov/33917810" }, { "database": "PubMed", "id": "33976931", "url": "https://pubmed.ncbi.nlm.nih.gov/33976931" }, { "database": "PubMed", "id": "34103557", "url": "https://pubmed.ncbi.nlm.nih.gov/34103557" }, { "database": "PubMed", "id": "34335915", "url": "https://pubmed.ncbi.nlm.nih.gov/34335915" }, { "database": "PubMed", "id": "34577062", "url": "https://pubmed.ncbi.nlm.nih.gov/34577062" }, { "database": "PubMed", "id": "36207218", "url": "https://pubmed.ncbi.nlm.nih.gov/36207218" }, { "database": "PubMed", "id": "9614064", "url": "https://pubmed.ncbi.nlm.nih.gov/9614064" }, { "database": "PubMed", "id": "10400692", "url": "https://pubmed.ncbi.nlm.nih.gov/10400692" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "P47196-1" } ], "record_id": "pubmed.27843952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Potential role of MG53 in the regulation of transforming-growth-factor-beta1-induced atrial fibrosis and vulnerability to atrial fibrillation.", "journal": "Experimental cell research", "date": "2018", "authors": "Guo J, Jia F, Jiang Y, Li Q, Yang Y, Xiao M, Xiao H", "reference": { "type": "PubMed", "id": "29233682", "url": "https://pubmed.ncbi.nlm.nih.gov/29233682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0JPQ4-1", "protein_name": "Tripartite motif-containing protein 72", "gene_name": "Trim72", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0JPQ4", "url": "https://www.uniprot.org/uniprotkb/A0JPQ4" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29233682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRIM72 mediates lung epithelial cell death upon hyperoxia exposure.", "journal": "Journal of the Chinese Medical Association : JCMA", "date": "2021", "authors": "Huang LT, Chou HC, Chen CM", "reference": { "type": "PubMed", "id": "32796321", "url": "https://pubmed.ncbi.nlm.nih.gov/32796321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0JPQ4-1", "protein_name": "Tripartite motif-containing protein 72", "gene_name": "Trim72", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0JPQ4", "url": "https://www.uniprot.org/uniprotkb/A0JPQ4" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32796321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MG53 ameliorates nerve injury induced neuropathic pain through the regulation of Nrf2/HO-1 signaling in rats.", "journal": "Behavioural brain research", "date": "2023-05-09", "authors": "Zhu Xuan-Zhi, Wang Jing-Qiong, Wu Yao-Hua", "reference": { "type": "PubMed", "id": "37169128", "url": "https://pubmed.ncbi.nlm.nih.gov/37169128" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0JPQ4-1", "protein_name": "Tripartite motif-containing protein 72", "gene_name": "Trim72", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6ZMU5-1", "protein_name": "Tripartite motif-containing protein 72", "gene_name": "TRIM72", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0JPQ4", "url": "https://www.uniprot.org/uniprotkb/A0JPQ4" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37169128", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Piccolo, a presynaptic zinc finger protein structurally related to bassoon.", "journal": "Neuron", "date": "2000", "authors": "Fenster SD, Chung WJ, Zhai R, Cases-Langhoff C, Voss B, Garner AM, Kaempf U, Kindler S, Gundelfinger ED, Garner CC", "reference": { "type": "PubMed", "id": "10707984", "url": "https://pubmed.ncbi.nlm.nih.gov/10707984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35394-1", "protein_name": "Prenylated Rab acceptor protein 1", "gene_name": "Rabac1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10707984", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An unusual C(2)-domain in the active-zone protein piccolo: implications for Ca(2+) regulation of neurotransmitter release.", "journal": "The EMBO journal", "date": "2001", "authors": "Gerber SH, Garcia J, Rizo J, Sudhof TC", "reference": { "type": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 4668, "end_pos": 4668, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of calcium-binding and calcium-dependent phospholipid binding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4674, "end_pos": 4674, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of calcium-binding and calcium-dependent phospholipid binding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4688, "end_pos": 4688, "sequence_org": "V", "sequence_mut": "S", "comment": "Small increase in affinity for calcium.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4688, "end_pos": 4689, "sequence_org": "VM", "sequence_mut": "SS", "comment": "10-fold increase in affinity for calcium.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4689, "end_pos": 4689, "sequence_org": "M", "sequence_mut": "S", "comment": "Increased affinity for calcium.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4690, "end_pos": 4691, "sequence_org": "VV", "sequence_mut": "SS", "comment": "10-fold increase in affinity for calcium.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4692, "end_pos": 4693, "sequence_org": "QN", "sequence_mut": "AA", "comment": "Moderate increase in affinity for calcium.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" }, { "start_pos": 4694, "end_pos": 4694, "sequence_org": "A", "sequence_mut": "S", "comment": "No effect on calcium-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" }, { "database": "PubMed", "id": "11285225", "url": "https://pubmed.ncbi.nlm.nih.gov/11285225" } ], "uniprot_canonical_ac": "Q9JKS6-1" } ], "record_id": "pubmed.11285225", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The GIT family of proteins forms multimers and associates with the presynaptic cytomatrix protein Piccolo.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kim S, Ko J, Shin H, Lee JR, Lim C, Han JH, Altrock WD, Garner CC, Gundelfinger ED, Premont RT, Kaang BK, Kim E", "reference": { "type": "PubMed", "id": "12473661", "url": "https://pubmed.ncbi.nlm.nih.gov/12473661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q66H91-1", "protein_name": "ARF GTPase-activating protein GIT2", "gene_name": "Git2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z272-1", "protein_name": "ARF GTPase-activating protein GIT1", "gene_name": "Git1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 285, "end_pos": 285, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of interaction with FAK1, decreased interaction with PCLO, no effect on interaction with ARHGEF7.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z272", "url": "https://www.uniprot.org/uniprotkb/Q9Z272" }, { "database": "PubMed", "id": "12473661", "url": "https://pubmed.ncbi.nlm.nih.gov/12473661" } ], "uniprot_canonical_ac": "Q9Z272-1" }, { "start_pos": 288, "end_pos": 288, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of interaction with PCLO and FAK1, no effect on interaction with ARHGEF7.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z272", "url": "https://www.uniprot.org/uniprotkb/Q9Z272" }, { "database": "PubMed", "id": "12473661", "url": "https://pubmed.ncbi.nlm.nih.gov/12473661" } ], "uniprot_canonical_ac": "Q9Z272-1" }, { "start_pos": 298, "end_pos": 298, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of interaction with FAK1, decreased interaction with PCLO, no effect on interaction with ARHGEF7.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z272", "url": "https://www.uniprot.org/uniprotkb/Q9Z272" }, { "database": "PubMed", "id": "12473661", "url": "https://pubmed.ncbi.nlm.nih.gov/12473661" } ], "uniprot_canonical_ac": "Q9Z272-1" }, { "start_pos": 299, "end_pos": 299, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of interaction with FAK1, decreased interaction with PCLO, no effect on interaction with ARHGEF7.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z272", "url": "https://www.uniprot.org/uniprotkb/Q9Z272" }, { "database": "PubMed", "id": "12473661", "url": "https://pubmed.ncbi.nlm.nih.gov/12473661" } ], "uniprot_canonical_ac": "Q9Z272-1" }, { "start_pos": 432, "end_pos": 483, "sequence_org": "LQEYLELKKALATSEAKVQQLMKVNSSLSDELRKLQREIHKLQAENLQLRQP", "sequence_mut": "", "comment": "Decreased homooligomerization and loss of formation of a ternary complex between GIT1, ARHGEF7 and PCLO. Does not affect ARHGEF7- and PCLO-binding to GIT1 monomer.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z272", "url": "https://www.uniprot.org/uniprotkb/Q9Z272" }, { "database": "PubMed", "id": "12473661", "url": "https://pubmed.ncbi.nlm.nih.gov/12473661" } ], "uniprot_canonical_ac": "Q9Z272-1" } ], "record_id": "pubmed.12473661", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conformational switch in the Piccolo C2A domain regulated by alternative splicing.", "journal": "Nat. Struct. Mol. Biol.", "date": "2004", "authors": "Garcia Jesus, Gerber Stefan H, Sugita Shuzo, S\u00fcdhof Thomas C, Rizo Josep", "reference": { "type": "PubMed", "id": "14718922", "url": "https://pubmed.ncbi.nlm.nih.gov/14718922" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14718922", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The presynaptic scaffolding protein Piccolo organizes the readily releasable pool at the calyx of Held.", "journal": "The Journal of physiology", "date": "2018", "authors": "Parthier D, Kuner T, Korber C", "reference": { "type": "PubMed", "id": "29194628", "url": "https://pubmed.ncbi.nlm.nih.gov/29194628" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29194628", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Critical role for Piccolo in synaptic vesicle retrieval.", "journal": "eLife", "date": "2019", "authors": "Ackermann F, Schink KO, Bruns C, Izsvak Z, Hamra FK, Rosenmund C, Garner CC", "reference": { "type": "PubMed", "id": "31074746", "url": "https://pubmed.ncbi.nlm.nih.gov/31074746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31074746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of Piccolo Function in Rats Induces Cerebellar Network Dysfunction and Pontocerebellar Hypoplasia Type 3-like Phenotypes.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2020", "authors": "Falck J, Bruns C, Hoffmann-Conaway S, Straub I, Plautz EJ, Orlando M, Munawar H, Rivalan M, Winter Y, Izsvak Z, Schmitz D, Hamra FK, Hallermann S, Garner CC, Ackermann F", "reference": { "type": "PubMed", "id": "32122952", "url": "https://pubmed.ncbi.nlm.nih.gov/32122952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JKS6-1", "protein_name": "Protein piccolo", "gene_name": "Pclo", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JKS6", "url": "https://www.uniprot.org/uniprotkb/Q9JKS6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32122952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rabconnectin-3, a novel protein that binds both GDP/GTP exchange protein and GTPase-activating protein for Rab3 small G protein family.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Nagano Fumiko, Kawabe Hiroshi, Nakanishi Hiroyuki, Shinohara Masahiko, Deguchi-Tawarada Maki, Takeuchi Masakazu, Sasaki Takuya, Takai Yoshimi", "reference": { "type": "PubMed", "id": "11809763", "url": "https://pubmed.ncbi.nlm.nih.gov/11809763" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5U1Z0-1", "protein_name": "Rab3 GTPase-activating protein non-catalytic subunit", "gene_name": "Rab3gap2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8TDJ6-1", "protein_name": "DmX-like protein 2", "gene_name": "DMXL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69735-1", "protein_name": "Rab3 GTPase-activating protein catalytic subunit", "gene_name": "Rab3gap1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5U1Z0", "url": "https://www.uniprot.org/uniprotkb/Q5U1Z0" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11809763", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel bifunctional calmodulin-binding and microtubule-stabilizing motifs in STOP proteins.", "journal": "The Journal of biological chemistry", "date": "2001-08-17", "authors": "Bosc C, Frank R, Denarier E, Ronjat M, Schweitzer A, Wehland J, Job D", "reference": { "type": "PubMed", "id": "11413126", "url": "https://pubmed.ncbi.nlm.nih.gov/11413126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11413126", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STOP (stable-tubule-only-polypeptide) is preferentially associated with the stable domain of axonal microtubules.", "journal": "J. Neurocytol.", "date": "2003", "authors": "Slaughter Theresa, Black Mark M", "reference": { "type": "PubMed", "id": "14724383", "url": "https://pubmed.ncbi.nlm.nih.gov/14724383" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14724383", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endocytic adaptor protein intersectin 1 forms a complex with microtubule stabilizer STOP in neurons.", "journal": "Gene", "date": "2012", "authors": "Morderer D, Nikolaienko O, Skrypkina I, Cherkas V, Tsyba L, Belan P, Rynditch A", "reference": { "type": "PubMed", "id": "22750298", "url": "https://pubmed.ncbi.nlm.nih.gov/22750298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22750298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for the association of MAP6 protein with microtubules and its regulation by calmodulin.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Lefevre J, Savarin P, Gans P, Hamon L, Clement MJ, David MO, Bosc C, Andrieux A, Curmi PA", "reference": { "type": "PubMed", "id": "23831686", "url": "https://pubmed.ncbi.nlm.nih.gov/23831686" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q96JE9-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "MAP6", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.23831686", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes.", "journal": "EMBO J.", "date": "2014", "authors": "Schwenk BM, Lang CM, Hogl S, Tahirovic S, Orozco D, Rentzsch K, Lichtenthaler SF, Hoogenraad CC, Capell A, Haass C, Edbauer D", "reference": { "type": "PubMed", "id": "24357581", "url": "https://pubmed.ncbi.nlm.nih.gov/24357581" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6AYA5-1", "protein_name": "Transmembrane protein 106B", "gene_name": "Tmem106b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9NUM4-1", "protein_name": "Transmembrane protein 106B", "gene_name": "TMEM106B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JE9-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "MAP6", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24357581", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic Palmitoylation Targets MAP6 to the Axon to Promote Microtubule Stabilization during Neuronal Polarization.", "journal": "Neuron", "date": "2017", "authors": "Tortosa E, Adolfs Y, Fukata M, Pasterkamp RJ, Kapitein LC, Hoogenraad CC", "reference": { "type": "PubMed", "id": "28521134", "url": "https://pubmed.ncbi.nlm.nih.gov/28521134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5XIJ5-1", "protein_name": "Alpha/beta hydrolase domain-containing protein 17A", "gene_name": "Abhd17a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7M759-1", "protein_name": "Alpha/beta hydrolase domain-containing protein 17B", "gene_name": "Abhd17b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q7TSJ2-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 11, "sequence_org": "CC", "sequence_mut": "GG", "comment": "Loss of Golgi and secretory vesicle localization; when associated with G-5. Loss of axonal polarization; when associated with G-5. Increased dendrite localization without affecting association with microtubules; when associated with G-5.", "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" }, { "database": "PubMed", "id": "28521134", "url": "https://pubmed.ncbi.nlm.nih.gov/28521134" } ], "uniprot_canonical_ac": "Q63560-1" }, { "start_pos": 5, "end_pos": 5, "sequence_org": "C", "sequence_mut": "G", "comment": "Loss of palmitoylation. Loss of Golgi and secretory vesicle localization; when associated with G-10 and G-11. Loss of axonal polarization; when associated with G-10 and G-11. Increased dendrite localization without affecting association with microtubules; when associated with G-10 and G-11.", "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" }, { "database": "PubMed", "id": "28521134", "url": "https://pubmed.ncbi.nlm.nih.gov/28521134" } ], "uniprot_canonical_ac": "Q63560-1" } ], "record_id": "pubmed.28521134", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and assay of a 145-kDa protein (STOP145) with microtubule-stabilizing and motility behavior.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986-02", "authors": "Margolis R L, Rauch C T, Job D", "reference": { "type": "PubMed", "id": "3456161", "url": "https://pubmed.ncbi.nlm.nih.gov/3456161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3456161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, expression, and properties of the microtubule-stabilizing protein STOP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Bosc C, Cronk JD, Pirollet F, Watterson DM, Haiech J, Job D, Margolis RL", "reference": { "type": "PubMed", "id": "8700896", "url": "https://pubmed.ncbi.nlm.nih.gov/8700896" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8700896", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STOP proteins are responsible for the high degree of microtubule stabilization observed in neuronal cells.", "journal": "The Journal of cell biology", "date": "1998-07-13", "authors": "Guillaud L, Bosc C, Fourest-Lieuvin A, Denarier E, Pirollet F, Lafanech\u00e8re L, Job D", "reference": { "type": "PubMed", "id": "9660871", "url": "https://pubmed.ncbi.nlm.nih.gov/9660871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63560-1", "protein_name": "Microtubule-associated protein 6", "gene_name": "Map6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63560", "url": "https://www.uniprot.org/uniprotkb/Q63560" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9660871", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The steroid receptor RNA activator is the first functional RNA encoding a protein.", "journal": "FEBS Lett.", "date": "2004", "authors": "Chooniedass-Kothari S, Emberley E, Hamedani M K, Troup S, Wang X, Czosnek A, Hube F, Mutawe M, Watson P H, Leygue E", "reference": { "type": "PubMed", "id": "15147866", "url": "https://pubmed.ncbi.nlm.nih.gov/15147866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6QGW5-1", "protein_name": "Steroid receptor RNA activator 1", "gene_name": "Sra1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9HD15-1", "protein_name": "Steroid receptor RNA activator 1", "gene_name": "SRA1", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6QGW5", "url": "https://www.uniprot.org/uniprotkb/Q6QGW5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15147866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Steroid receptor RNA activator affects the development of poststroke depression by regulating the peroxisome proliferator-activated receptor gamma signaling pathway.", "journal": "Neuroreport", "date": "2020", "authors": "Jiang B, Wang H, Xu H", "reference": { "type": "PubMed", "id": "31714481", "url": "https://pubmed.ncbi.nlm.nih.gov/31714481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6QGW5-1", "protein_name": "Steroid receptor RNA activator 1", "gene_name": "Sra1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q6QGW5", "url": "https://www.uniprot.org/uniprotkb/Q6QGW5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31714481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PNUTS, a protein phosphatase 1 (PP1) nuclear targeting subunit. Characterization of its PP1- and RNA-binding domains and regulation by phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kim YM, Watanabe T, Allen PB, Kim YM, Lee SJ, Greengard P, Nairn AC, Kwon YG", "reference": { "type": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55000-1", "protein_name": "Serine/threonine-protein phosphatase 1 regulatory subunit 10", "gene_name": "Ppp1r10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 396, "end_pos": 396, "sequence_org": "R", "sequence_mut": "A", "comment": "Does not abolish interaction with PPP1CA and does not reduce PPP1CA inhibition.", "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" }, { "database": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" } ], "uniprot_canonical_ac": "O55000-1" }, { "start_pos": 397, "end_pos": 397, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not abolish interaction with PPP1CA and reduces a little PPP1CA inhibition.", "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" }, { "database": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" } ], "uniprot_canonical_ac": "O55000-1" }, { "start_pos": 399, "end_pos": 399, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduces interaction with PPP1CA and reduces strongly PPP1CA inhibition.", "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" }, { "database": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" } ], "uniprot_canonical_ac": "O55000-1" }, { "start_pos": 401, "end_pos": 401, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes interaction with PPP1CA and PPP1CA inhibition.", "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" }, { "database": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" } ], "uniprot_canonical_ac": "O55000-1" }, { "start_pos": 445, "end_pos": 450, "sequence_org": "ETARRL", "sequence_mut": "", "comment": "Abolishes PPP1CA inhibition.", "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" }, { "database": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" } ], "uniprot_canonical_ac": "O55000-1" } ], "phosphorylation": [ { "start_pos": 398, "end_pos": 398, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" }, { "database": "iPTMnet", "id": "O55000", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O55000" }, { "database": "PubMed", "id": "12574161", "url": "https://pubmed.ncbi.nlm.nih.gov/12574161" } ], "site_lbl": "Thr398", "uniprot_canonical_ac": "O55000-1" } ], "record_id": "pubmed.12574161", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The MYC oncoprotein directly interacts with its chromatin cofactor PNUTS to recruit PP1 phosphatase.", "journal": "Nucleic Acids Res.", "date": "2022", "authors": "Wei Yong, Redel Cornelia, Ahlner Alexandra, Lemak Alexander, Johansson-\u00c5khe Isak, Houliston Scott, Kenney Tristan M G, Tamachi Aaliya, Morad Vivian, Duan Shili, Andrews David W, Wallner Bj\u00f6rn, Sunnerhagen Maria, Arrowsmith Cheryl H, Penn Linda Z", "reference": { "type": "PubMed", "id": "35244724", "url": "https://pubmed.ncbi.nlm.nih.gov/35244724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55000-1", "protein_name": "Serine/threonine-protein phosphatase 1 regulatory subunit 10", "gene_name": "Ppp1r10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P09416-1", "protein_name": "Myc proto-oncogene protein", "gene_name": "Myc", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35244724", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of PNUTS, a putative protein phosphatase 1 nuclear targeting subunit.", "journal": "The Journal of biological chemistry", "date": "1998-02-13", "authors": "Allen P B, Kwon Y G, Nairn A C, Greengard P", "reference": { "type": "PubMed", "id": "9461602", "url": "https://pubmed.ncbi.nlm.nih.gov/9461602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55000-1", "protein_name": "Serine/threonine-protein phosphatase 1 regulatory subunit 10", "gene_name": "Ppp1r10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O55000", "url": "https://www.uniprot.org/uniprotkb/O55000" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9461602", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Processing of thyrotropin-releasing hormone (TRH) prohormone in the rat olfactory bulb generates novel TRH-related peptides.", "journal": "Endocrinology", "date": "1990", "authors": "Bulant M, Beauvillain JC, Delfour A, Vaudry H, Nicolas P", "reference": { "type": "PubMed", "id": "2119297", "url": "https://pubmed.ncbi.nlm.nih.gov/2119297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2119297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization and expression of the gene-encoding rat thyrotropin-releasing hormone (TRH).", "journal": "Ann. N. Y. Acad. Sci.", "date": "1989", "authors": "Lee S L, Sevarino K, Roos B A, Goodman R H", "reference": { "type": "PubMed", "id": "2497670", "url": "https://pubmed.ncbi.nlm.nih.gov/2497670" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2497670", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mct8 and trh co-expression throughout the hypothalamic paraventricular nucleus is modified by dehydration-induced anorexia in rats.", "journal": "Neuropeptides", "date": "2016", "authors": "Alvarez-Salas E, Mengod G, Garcia-Luna C, Soberanes-Chavez P, Matamoros-Trejo G, de Gortari P", "reference": { "type": "PubMed", "id": "26626087", "url": "https://pubmed.ncbi.nlm.nih.gov/26626087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8K1P8-1", "protein_name": "Monocarboxylate transporter 8", "gene_name": "SLC16A2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.26626087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the gene encoding rat thyrotropin releasing hormone.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Lee S L, Stewart K, Goodman R H", "reference": { "type": "PubMed", "id": "2903153", "url": "https://pubmed.ncbi.nlm.nih.gov/2903153" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2903153", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intrauterine Zn Deficiency Favors Thyrotropin-Releasing Hormone-Increasing Effects on Thyrotropin Serum Levels and Induces Subclinical Hypothyroidism in Weaned Rats.", "journal": "Nutrients", "date": "2017", "authors": "Alcantara-Alonso V, Alvarez-Salas E, Matamoros-Trejo G, de Gortari P", "reference": { "type": "PubMed", "id": "29057835", "url": "https://pubmed.ncbi.nlm.nih.gov/29057835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29057835", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thyrotropin-releasing hormone precursor: characterization in rat brain.", "journal": "Science", "date": "1986", "authors": "Lechan RM, Wu P, Jackson IM, Wolf H, Cooperman S, Mandel G, Goodman RH", "reference": { "type": "PubMed", "id": "3079917", "url": "https://pubmed.ncbi.nlm.nih.gov/3079917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3079917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential activating effects of thyrotropin-releasing hormone and its analog taltirelin on motor output to the tongue musculature in vivo.", "journal": "Sleep", "date": "2020", "authors": "Liu WY, Liu H, Aggarwal J, Huang ZL, Horner RL", "reference": { "type": "PubMed", "id": "32227104", "url": "https://pubmed.ncbi.nlm.nih.gov/32227104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32227104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRH in the nucleus accumbens acts downstream to alpha-MSH to decrease food intake in rats.", "journal": "Neuroscience letters", "date": "2020", "authors": "Alvarez-Salas E, Gama F, Matamoros-Trejo G, Amaya MI, de Gortari P", "reference": { "type": "PubMed", "id": "32980456", "url": "https://pubmed.ncbi.nlm.nih.gov/32980456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32980456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sex Dimorphic Changes in Trh Gene Methylation and Thyroid-Axis Response to Energy Demands in Maternally Separated Rats.", "journal": "Endocrinology", "date": "2021", "authors": "Jaimes-Hoy L, Perez-Maldonado A, Narvaez Bahena E, de la Cruz Guarneros N, Rodriguez-Rodriguez A, Charli JL, Soberon X, Joseph-Bravo P", "reference": { "type": "PubMed", "id": "34043769", "url": "https://pubmed.ncbi.nlm.nih.gov/34043769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01150-1", "protein_name": "Pro-thyrotropin-releasing hormone", "gene_name": "Trh", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01150", "url": "https://www.uniprot.org/uniprotkb/P01150" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34043769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence of the rat protamine 2 gene.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Tanhauser SM, Hecht NB", "reference": { "type": "PubMed", "id": "2740236", "url": "https://pubmed.ncbi.nlm.nih.gov/2740236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11248-1", "protein_name": "Protamine-2", "gene_name": "Prm2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P11248", "url": "https://www.uniprot.org/uniprotkb/P11248" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2740236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of the conserved protamine gene cluster shows that it contains a fourth expressed gene.", "journal": "Mol. Reprod. Dev.", "date": "1996", "authors": "Schl\u00fcter G, Celik A, Obata R, Schlicker M, Hofferbert S, Schlung A, Adham I M, Engel W", "reference": { "type": "PubMed", "id": "8720108", "url": "https://pubmed.ncbi.nlm.nih.gov/8720108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11248-1", "protein_name": "Protamine-2", "gene_name": "Prm2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11101-1", "protein_name": "Nuclear transition protein 2", "gene_name": "Tnp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10118-1", "protein_name": "Sperm protamine P1", "gene_name": "Prm1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q62100-1", "protein_name": "Protamine-3", "gene_name": "Prm3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q64256-1", "protein_name": "Protamine-3", "gene_name": "Prm3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11378-1", "protein_name": "Nuclear transition protein 2", "gene_name": "Tnp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NNZ6-1", "protein_name": "Protamine-3", "gene_name": "PRM3", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P11248", "url": "https://www.uniprot.org/uniprotkb/P11248" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8720108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Casein kinase II is responsible for phosphorylation of NF-L at Ser-473.", "journal": "FEBS letters", "date": "1999", "authors": "Nakamura Y, Hashimoto R, Kashiwagi Y, Wada Y, Sakoda S, Miyamae Y, Kudo T, Takeda M", "reference": { "type": "PubMed", "id": "10428477", "url": "https://pubmed.ncbi.nlm.nih.gov/10428477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" }, { "database": "PubMed", "id": "22673903", "url": "https://pubmed.ncbi.nlm.nih.gov/22673903" }, { "database": "iPTMnet", "id": "P19527", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19527" }, { "database": "PubMed", "id": "10428477", "url": "https://pubmed.ncbi.nlm.nih.gov/10428477" }, { "database": "PubMed", "id": "2162386", "url": "https://pubmed.ncbi.nlm.nih.gov/2162386" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "P19527-1" } ], "record_id": "pubmed.10428477", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of serine 473 as a major phosphorylation site in the neurofilament polypeptide NF-L.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1990", "authors": "Xu ZS, Liu WS, Willard M", "reference": { "type": "PubMed", "id": "2162386", "url": "https://pubmed.ncbi.nlm.nih.gov/2162386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" }, { "database": "PubMed", "id": "22673903", "url": "https://pubmed.ncbi.nlm.nih.gov/22673903" }, { "database": "iPTMnet", "id": "P19527", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19527" }, { "database": "PubMed", "id": "10428477", "url": "https://pubmed.ncbi.nlm.nih.gov/10428477" }, { "database": "PubMed", "id": "2162386", "url": "https://pubmed.ncbi.nlm.nih.gov/2162386" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "P19527-1" } ], "record_id": "pubmed.2162386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of rat neurofilament proteins NF-L and NF-M in transfected non-neuronal cells.", "journal": "Eur. J. Cell Biol.", "date": "1989", "authors": "Chin SS, Liem RK", "reference": { "type": "PubMed", "id": "2516804", "url": "https://pubmed.ncbi.nlm.nih.gov/2516804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2516804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Optimization of 2-DE and multiplexed detection of O-GlcNAcome, phosphoproteome and whole proteome protocol of synapse-associated proteins within the rat sensorimotor cortex.", "journal": "Journal of neuroscience methods", "date": "2020", "authors": "Fourneau J, Cieniewski-Bernard C, Canu MH, Duban-Deweer S, Hachani J, Bastide B, Dupont E", "reference": { "type": "PubMed", "id": "32574643", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P21707-1", "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P60711-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "Actb; Actg1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z2L0-1", "protein_name": "Non-selective voltage-gated ion channel VDAC1", "gene_name": "Vdac1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8K3J1-1", "protein_name": "NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial", "gene_name": "Ndufs8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9DCJ5-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8", "gene_name": "Ndufa8", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "THR-20 AND SER-26", "icn3d_view": {}, "start_pos": 21, "start_aa": "Thr", "end_pos": 21, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr21", "evidence": [ { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" }, { "id": "431", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/431" } ], "filter_code": "000000000000000010000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 27, "start_aa": "Ser", "end_pos": 27, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser27", "evidence": [ { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" }, { "id": "431", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/431" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 34, "start_aa": "Ser", "end_pos": 34, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser34", "evidence": [ { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 48, "start_aa": "Ser", "end_pos": 48, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser48", "evidence": [ { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P21707", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P21707" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P21707-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 199, "start_aa": "Ser", "end_pos": 199, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser199", "evidence": [ { "id": "21933451", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21933451" }, { "id": "P60711", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P60711" }, { "id": "18683930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18683930" }, { "id": "31566433", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31566433" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P60711-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 240, "start_aa": "Ser", "end_pos": 240, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser240", "evidence": [ { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "Q9Z2L0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Z2L0" }, { "id": "27213235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27213235" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "23132757", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23132757" }, { "id": "26446791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26446791" }, { "id": "Q9Z2L0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Z2L0" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q9Z2L0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 260, "start_aa": "Ser", "end_pos": 260, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser260", "evidence": [ { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "Q9Z2L0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Z2L0" }, { "id": "27213235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27213235" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "23132757", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23132757" }, { "id": "26446791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26446791" }, { "id": "Q9Z2L0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Z2L0" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9Z2L0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "Q8K3J1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8K3J1" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q8K3J1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "Q9DCJ5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9DCJ5" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9DCJ5-1" } ], "record_id": "pubmed.32574643", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 7 }, { "field": "exact_o_linked_sites", "count": 7 }, { "field": "exact_o_linked_glycan_sites", "count": 7 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 3 }, { "field": "fuzzy_o_linked_sites", "count": 3 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 3 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 7 }, { "field": "exact_o_linked_sites", "count": 7 }, { "field": "exact_o_linked_glycan_sites", "count": 7 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 3 }, { "field": "fuzzy_o_linked_sites", "count": 3 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 3 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Temporal profile and utility of serum neurofilament light in a rat model of mild traumatic brain injury.", "journal": "Experimental neurology", "date": "2021", "authors": "O'Brien WT, Pham L, Brady RD, Bain J, Yamakawa GR, Sun M, Mychasiuk R, O'Brien TJ, Monif M, Shultz SR, McDonald SJ", "reference": { "type": "PubMed", "id": "33727100", "url": "https://pubmed.ncbi.nlm.nih.gov/33727100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33727100", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a cDNA encoding the smallest neurofilament protein from the rat.", "journal": "Biochim. Biophys. Acta", "date": "1985", "authors": "Julien J P, Ramachandran K, Grosveld F", "reference": { "type": "PubMed", "id": "3925999", "url": "https://pubmed.ncbi.nlm.nih.gov/3925999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3925999", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the rat light neurofilament (NF-L) gene promoter and identification of NGF and cAMP responsive regions.", "journal": "J. Neurosci. Res.", "date": "1995", "authors": "Reeben M, Neuman T, Palgi J, Palm K, Paalme V, Saarma M", "reference": { "type": "PubMed", "id": "7745611", "url": "https://pubmed.ncbi.nlm.nih.gov/7745611" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7745611", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycosylation of mammalian neurofilaments. Localization of multiple O-linked N-acetylglucosamine moieties on neurofilament polypeptides L and M.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Dong DL, Xu ZS, Chevrier MR, Cotter RJ, Cleveland DW, Hart GW", "reference": { "type": "PubMed", "id": "8344946", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12839-1", "protein_name": "Neurofilament medium polypeptide", "gene_name": "Nefm", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "THR-20 AND SER-26", "icn3d_view": {}, "start_pos": 21, "start_aa": "Thr", "end_pos": 21, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr21", "evidence": [ { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" }, { "id": "431", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/431" } ], "filter_code": "000000000000000010000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 21, "start_aa": "Thr", "end_pos": 21, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr21", "evidence": [ { "id": "P19527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P19527#ptm_processing" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 27, "start_aa": "Ser", "end_pos": 27, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser27", "evidence": [ { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" }, { "id": "431", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/431" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 27, "start_aa": "Ser", "end_pos": 27, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser27", "evidence": [ { "id": "P19527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P19527#ptm_processing" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" } ], "filter_code": "000000000000000100000.00000001000000.00.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 48, "start_aa": "Ser", "end_pos": 48, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser48", "evidence": [ { "id": "32574643", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574643" }, { "id": "P19527", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P19527" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 49, "start_aa": "Ser", "end_pos": 49, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser49", "evidence": [ { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 50, "start_aa": "Ser", "end_pos": 50, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser50", "evidence": [ { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "P19527", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P19527" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P19527-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 19, "start_aa": "Thr", "end_pos": 19, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr19", "evidence": [ { "id": "16006557", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16006557" }, { "id": "P12839", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12839" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P12839", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P12839" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P12839-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 34, "start_aa": "Ser", "end_pos": 34, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser34", "evidence": [ { "id": "16006557", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16006557" }, { "id": "P12839", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12839" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P12839", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P12839" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P12839-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 431, "start_aa": "Thr", "end_pos": 431, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr431", "evidence": [ { "id": "16006557", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16006557" }, { "id": "P12839", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12839" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P12839", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P12839" }, { "id": "432", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/432" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P12839-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 431, "start_aa": "Thr", "end_pos": 431, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr431", "evidence": [ { "id": "P12839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12839#ptm_processing" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P12839-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "THR-47 AND THR-430", "icn3d_view": {}, "start_pos": 48, "start_aa": "Thr", "end_pos": 48, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr48", "evidence": [ { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "16006557", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16006557" }, { "id": "P12839", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12839" }, { "id": "8702840", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8702840" }, { "id": "P12839", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P12839" }, { "id": "432", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/432" } ], "filter_code": "000000000000000010000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P12839-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 48, "start_aa": "Thr", "end_pos": 48, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr48", "evidence": [ { "id": "P12839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12839#ptm_processing" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P12839-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 452, "start_aa": "Ser", "end_pos": 452, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser452", "evidence": [ { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "O14639", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14639" }, { "id": "28580691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28580691" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29485866", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29485866" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "29237092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29237092" }, { "id": "20068230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20068230" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "37340703", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37340703" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "O14639", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14639" }, { "id": "34846842", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34846842" }, { "id": "31373491", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31373491" }, { "id": "8344946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8344946" }, { "id": "2904", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2904" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "O14639-1" } ], "glycan_expression": [ { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P12839-1", "residue": "Thr", "start_pos": 431, "end_pos": 431 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P12839-1", "residue": "Thr", "start_pos": 48, "end_pos": 48 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P19527-1", "residue": "Thr", "start_pos": 21, "end_pos": 21 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P19527-1", "residue": "Ser", "start_pos": 27, "end_pos": 27 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P19527-1", "residue": "Ser", "start_pos": 48, "end_pos": 48 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P19527-1", "residue": "Ser", "start_pos": 49, "end_pos": 49 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "spinal cord", "namespace": "UBERON", "id": "0002240", "url": "http://purl.obolibrary.org/obo/UBERON_0002240" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P19527-1", "residue": "Ser", "start_pos": 50, "end_pos": 50 } ], "record_id": "pubmed.8344946", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "exact_o_linked_glycan_sites", "count": 10 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "exact_o_linked_glycan_sites", "count": 10 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of cyclic AMP-dependent protein kinase in okadaic acid-treated neurons potentiates neurofilament fragmentation and stimulates phosphorylation of Ser2 in the low-molecular-mass neurofilament subunit.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Giasson BI, Cromlish JA, Athlan ES, Mushynski WE", "reference": { "type": "PubMed", "id": "8769885", "url": "https://pubmed.ncbi.nlm.nih.gov/8769885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P19527", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19527" }, { "database": "PubMed", "id": "8769885", "url": "https://pubmed.ncbi.nlm.nih.gov/8769885" }, { "database": "PubMed", "id": "9521713", "url": "https://pubmed.ncbi.nlm.nih.gov/9521713" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P19527-1" } ], "record_id": "pubmed.8769885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel in vitro PKA phosphorylation sites on the low and middle molecular mass neurofilament subunits by mass spectrometry.", "journal": "Biochemistry", "date": "1998", "authors": "Cleverley KE, Betts JC, Blackstock WP, Gallo JM, Anderton BH", "reference": { "type": "PubMed", "id": "9521713", "url": "https://pubmed.ncbi.nlm.nih.gov/9521713" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19527-1", "protein_name": "Neurofilament light polypeptide", "gene_name": "Nefl", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P19527", "url": "https://www.uniprot.org/uniprotkb/P19527" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P19527", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19527" }, { "database": "PubMed", "id": "8769885", "url": "https://pubmed.ncbi.nlm.nih.gov/8769885" }, { "database": "PubMed", "id": "9521713", "url": "https://pubmed.ncbi.nlm.nih.gov/9521713" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P19527-1" } ], "record_id": "pubmed.9521713", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phospholipase C(epsilon): a novel Ras effector.", "journal": "The EMBO journal", "date": "2001", "authors": "Kelley GG, Reks SE, Ondrako JM, Smrcka AV", "reference": { "type": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P62836-1", "protein_name": "Ras-related protein Rap-1A", "gene_name": "Rap1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99P84-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1", "gene_name": "Plce1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 186, "end_pos": 186, "sequence_org": "C", "sequence_mut": "S", "comment": "Interacts but does not stimulate PLCE1; when associated with L-61.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 26, "end_pos": 26, "sequence_org": "N", "sequence_mut": "G", "comment": "Interacts and partially stimulates PLCE1; when associated with L-61.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "S", "comment": "No interaction and stimulation of PLCE1; when associated with L-61.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 37, "end_pos": 37, "sequence_org": "E", "sequence_mut": "G", "comment": "Reduced interaction and stimulation of PLCE1; when associated with L-61.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 38, "end_pos": 38, "sequence_org": "D", "sequence_mut": "N", "comment": "Reduced interaction and stimulation of PLCE1; when associated with L-61.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 40, "end_pos": 40, "sequence_org": "Y", "sequence_mut": "C", "comment": "No interaction and stimulation of PLCE1; when associated with L-61.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 61, "end_pos": 61, "sequence_org": "Q", "sequence_mut": "L", "comment": "Constitutively active. Constitutively interacts and stimulates PLCE1 phospholipase activity. Reduced interaction and stimulation of PLCE1; when associated with G-37 and N-38. No interaction and stimulation of PLCE1; when associated with S-35 and C-40. Interacts and partially stimulates PLCE1; when associated with G-26. Interacts but does not stimulate PLCE1; when associated with S-186.", "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "P20171-1" }, { "start_pos": 2150, "end_pos": 2150, "sequence_org": "K", "sequence_mut": "A", "comment": "Inhibits binding to HRAS by 59% and phospholipase stimulation by HRAS by 51%. Inhibits binding to HRAS by 97% and phospholipase stimulation by HRAS by 86%; when associated with A-2152.", "evidence": [ { "database": "UniProtKB", "id": "Q99P84", "url": "https://www.uniprot.org/uniprotkb/Q99P84" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "Q99P84-1" }, { "start_pos": 2150, "end_pos": 2150, "sequence_org": "K", "sequence_mut": "E", "comment": "Inhibits binding to HRAS by 99% and phospholipase stimulation by HRAS by 94%. Inhibits binding to HRAS by 97% and phospholipase stimulation by HRAS by 94%; when associated with E-2152.", "evidence": [ { "database": "UniProtKB", "id": "Q99P84", "url": "https://www.uniprot.org/uniprotkb/Q99P84" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "Q99P84-1" }, { "start_pos": 2152, "end_pos": 2152, "sequence_org": "K", "sequence_mut": "A", "comment": "Inhibits binding to HRAS by 19% and phospholipase stimulation by HRAS by 30%. Inhibits binding to HRAS by 97% and phospholipase stimulation by HRAS by 86%; when associated with A-2150.", "evidence": [ { "database": "UniProtKB", "id": "Q99P84", "url": "https://www.uniprot.org/uniprotkb/Q99P84" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "Q99P84-1" }, { "start_pos": 2152, "end_pos": 2152, "sequence_org": "K", "sequence_mut": "E", "comment": "Inhibits binding to HRAS by 67% and phospholipase stimulation by HRAS by 47%. Inhibits binding to HRAS by 97% and phospholipase stimulation by HRAS by 94%; when associated with E-2150.", "evidence": [ { "database": "UniProtKB", "id": "Q99P84", "url": "https://www.uniprot.org/uniprotkb/Q99P84" }, { "database": "PubMed", "id": "11179219", "url": "https://pubmed.ncbi.nlm.nih.gov/11179219" } ], "uniprot_canonical_ac": "Q99P84-1" } ], "record_id": "pubmed.11179219", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS14 is a multifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.", "journal": "Cell. Signal.", "date": "2010", "authors": "Shu FJ, Ramineni S, Hepler JR", "reference": { "type": "PubMed", "id": "19878719", "url": "https://pubmed.ncbi.nlm.nih.gov/19878719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11345-1", "protein_name": "RAF proto-oncogene serine/threonine-protein kinase", "gene_name": "Raf1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O08773-1", "protein_name": "Regulator of G protein signaling 14", "gene_name": "Rgs14", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 333, "end_pos": 333, "sequence_org": "R", "sequence_mut": "L", "comment": "Abolishes the inhibition of PDGF-mediated ERK1/ERK2 phosphorylation. Inhibits interaction with HRAS and does not colocalize with active GTP-bound form of HRAS at membranes. Does not inhibit interaction with BRAF or RAF1.", "evidence": [ { "database": "UniProtKB", "id": "O08773", "url": "https://www.uniprot.org/uniprotkb/O08773" }, { "database": "PubMed", "id": "19878719", "url": "https://pubmed.ncbi.nlm.nih.gov/19878719" } ], "uniprot_canonical_ac": "O08773-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "H", "sequence_mut": "A", "comment": "Does not inhibit interaction and colocalization with active GTP-bound form of HRAS at membranes. Does not inhibit interaction with BRAF or RAF1.", "evidence": [ { "database": "UniProtKB", "id": "O08773", "url": "https://www.uniprot.org/uniprotkb/O08773" }, { "database": "PubMed", "id": "19878719", "url": "https://pubmed.ncbi.nlm.nih.gov/19878719" } ], "uniprot_canonical_ac": "O08773-1" } ], "record_id": "pubmed.19878719", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Antiapoptotic gene bcl-2 prevents cellular senescence program reactivation induced by histone deacetylase inhibitor sodium butyrate in E1A and cHa-ras transformed rat fibroblasts].", "journal": "Tsitologiia", "date": "2015", "authors": "Gordeev SA, Bykova TV, Zubova SG, Aksenov ND, Pospelova TV", "reference": { "type": "PubMed", "id": "26035971", "url": "https://pubmed.ncbi.nlm.nih.gov/26035971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11960-1", "protein_name": "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial", "gene_name": "Bckdha", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.26035971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenotypic Screening Identifies Protein Synthesis Inhibitors as H-Ras-Nanocluster-Increasing Tumor Growth Inducers.", "journal": "Biochemistry", "date": "2015", "authors": "Najumudeen AK, Posada IM, Lectez B, Zhou Y, Landor SK, Fallarero A, Vuorela P, Hancock J, Abankwa D", "reference": { "type": "PubMed", "id": "26568031", "url": "https://pubmed.ncbi.nlm.nih.gov/26568031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.26568031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PATZ1 is a target of miR-29b that is induced by Ha-Ras oncogene in rat thyroid cells.", "journal": "Scientific reports", "date": "2016", "authors": "Vitiello M, Valentino T, De Menna M, Crescenzi E, Francesca P, Rea D, Arra C, Fusco A, De Vita G, Cerchia L, Fedele M", "reference": { "type": "PubMed", "id": "27125250", "url": "https://pubmed.ncbi.nlm.nih.gov/27125250" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27125250", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "H-Ras Isoform Mediates Protection Against Pressure Overload-Induced Cardiac Dysfunction in Part Through Activation of AKT.", "journal": "Circulation. Heart failure", "date": "2017", "authors": "Matsuda T, Jeong JI, Ikeda S, Yamamoto T, Gao S, Babu GJ, Zhai P, Del Re DP", "reference": { "type": "PubMed", "id": "28193718", "url": "https://pubmed.ncbi.nlm.nih.gov/28193718" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28193718", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence of the two rat cellular rasH genes.", "journal": "Mol. Cell. Biol.", "date": "1986", "authors": "Ruta M, Wolford R, Dhar R, Defeo-Jones D, Ellis R W, Scolnick E M", "reference": { "type": "PubMed", "id": "3023901", "url": "https://pubmed.ncbi.nlm.nih.gov/3023901" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20171-1", "protein_name": "GTPase HRas", "gene_name": "Hras", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P20171", "url": "https://www.uniprot.org/uniprotkb/P20171" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3023901", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]