[ { "title": "Overexpression of CKIP-1 alleviates hypoxia-induced cardiomyocyte injury by up-regulating Nrf2 antioxidant signaling via Keap1 inhibition.", "journal": "Biochimie", "date": "2019", "authors": "Ren J, Li J, Hu J, Yu H, Yang Q, Mu J", "reference": { "type": "PubMed", "id": "31201843", "url": "https://pubmed.ncbi.nlm.nih.gov/31201843" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5BJM5-1", "protein_name": "Pleckstrin homology domain-containing family O member 1", "gene_name": "Plekho1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5BJM5", "url": "https://www.uniprot.org/uniprotkb/Q5BJM5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31201843", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation-dependent cleavage of p130cas in apoptotic rat-1 cells.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hoon Kim D, Jeon Choi S, Kook S, Kim W, Keun Song W", "reference": { "type": "PubMed", "id": "12480533", "url": "https://pubmed.ncbi.nlm.nih.gov/12480533" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63767-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "Bcar1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 751, "end_pos": 751, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q63767", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q63767" }, { "database": "PubMed", "id": "12480533", "url": "https://pubmed.ncbi.nlm.nih.gov/12480533" } ], "site_lbl": "Tyr751", "uniprot_canonical_ac": "Q63767-1" } ], "record_id": "pubmed.12480533", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for regulation of Src by the docking protein p130Cas.", "journal": "Journal of molecular recognition : JMR", "date": "2006", "authors": "Nasertorabi Fariborz, Tars Kaspars, Becherer Kathleen, Kodandapani Ramadurgam, Liljas Lars, Vuori Kristiina, Ely Kathryn R", "reference": { "type": "PubMed", "id": "16245368", "url": "https://pubmed.ncbi.nlm.nih.gov/16245368" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63767-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "Bcar1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 762, "end_pos": 762, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q63767", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q63767*" }, { "database": "iPTMnet", "id": "Q63767", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q63767" }, { "database": "PubMed", "id": "16245368", "url": "https://pubmed.ncbi.nlm.nih.gov/16245368" } ], "site_lbl": "Tyr762", "uniprot_canonical_ac": "Q63767-1" } ], "record_id": "pubmed.16245368", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p130Cas, Crk-associated substrate plays essential roles in liver development by regulating sinusoidal endothelial cell fenestration.", "journal": "Hepatology (Baltimore, Md.)", "date": "2010", "authors": "Tazaki T, Sasaki T, Uto K, Yamasaki N, Tashiro S, Sakai R, Tanaka M, Oda H, Honda Z, Honda H", "reference": { "type": "PubMed", "id": "20623582", "url": "https://pubmed.ncbi.nlm.nih.gov/20623582" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63767-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "Bcar1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20623582", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence that SH2 domains promote processive phosphorylation by protein-tyrosine kinases.", "journal": "Current biology : CB", "date": "1995", "authors": "Mayer BJ, Hirai H, Sakai R", "reference": { "type": "PubMed", "id": "7780740", "url": "https://pubmed.ncbi.nlm.nih.gov/7780740" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63767-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "Bcar1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P00520-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "Abl1", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 347, "end_pos": 347, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by ABL1", "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" }, { "database": "iPTMnet", "id": "Q63767", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q63767" }, { "database": "PubMed", "id": "7780740", "url": "https://pubmed.ncbi.nlm.nih.gov/7780740" } ], "site_lbl": "Tyr347", "uniprot_canonical_ac": "Q63767-1" } ], "record_id": "pubmed.7780740", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel signaling molecule, p130, forms stable complexes in vivo with v-Crk and v-Src in a tyrosine phosphorylation-dependent manner.", "journal": "EMBO J.", "date": "1994", "authors": "Sakai R, Iwamatsu A, Hirano N, Ogawa S, Tanaka T, Mano H, Yazaki Y, Hirai H", "reference": { "type": "PubMed", "id": "8070403", "url": "https://pubmed.ncbi.nlm.nih.gov/8070403" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63767-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "Bcar1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8070403", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation of Crk-associated substrates by focal adhesion kinase. A putative mechanism for the integrin-mediated tyrosine phosphorylation of Crk-associated substrates.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tachibana K, Urano T, Fujita H, Ohashi Y, Kamiguchi K, Iwata S, Hirai H, Morimoto C", "reference": { "type": "PubMed", "id": "9360983", "url": "https://pubmed.ncbi.nlm.nih.gov/9360983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63767-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "Bcar1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56945-1", "protein_name": "Breast cancer anti-estrogen resistance protein 1", "gene_name": "BCAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14511-1", "protein_name": "Enhancer of filamentation 1", "gene_name": "NEDD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63767", "url": "https://www.uniprot.org/uniprotkb/Q63767" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 397, "end_pos": 397, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes autophosphorylation. Abolishes interaction with SRC and activation of BMX. Reduces phosphorylation of NEDD9.", "evidence": [ { "database": "UniProtKB", "id": "Q05397", "url": "https://www.uniprot.org/uniprotkb/Q05397" }, { "database": "PubMed", "id": "11331870", "url": "https://pubmed.ncbi.nlm.nih.gov/11331870" }, { "database": "PubMed", "id": "9360983", "url": "https://pubmed.ncbi.nlm.nih.gov/9360983" } ], "uniprot_canonical_ac": "Q05397-1" } ], "phosphorylation": [ { "start_pos": 664, "end_pos": 664, "kinase_uniprot_canonical_ac": "Q05397-1", "kinase_gene_name": "PTK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P56945", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P56945" }, { "database": "PubMed", "id": "12119061", "url": "https://pubmed.ncbi.nlm.nih.gov/12119061" }, { "database": "PubMed", "id": "9360968", "url": "https://pubmed.ncbi.nlm.nih.gov/9360968" }, { "database": "PubMed", "id": "9360983", "url": "https://pubmed.ncbi.nlm.nih.gov/9360983" } ], "site_lbl": "Tyr664", "uniprot_canonical_ac": "P56945-1" }, { "start_pos": 664, "end_pos": 664, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "P56945", "url": "https://www.ebi.ac.uk/intact/interactors/id:P56945*" }, { "database": "iPTMnet", "id": "P56945", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P56945" }, { "database": "PubMed", "id": "10542110", "url": "https://pubmed.ncbi.nlm.nih.gov/10542110" }, { "database": "PubMed", "id": "9360983", "url": "https://pubmed.ncbi.nlm.nih.gov/9360983" }, { "database": "PRO", "id": "P56945", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P56945" } ], "site_lbl": "Tyr664", "uniprot_canonical_ac": "P56945-1" }, { "start_pos": 666, "end_pos": 666, "kinase_uniprot_canonical_ac": "Q05397-1", "kinase_gene_name": "PTK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P56945", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P56945" }, { "database": "PubMed", "id": "9360983", "url": "https://pubmed.ncbi.nlm.nih.gov/9360983" } ], "site_lbl": "Tyr666", "uniprot_canonical_ac": "P56945-1" } ], "record_id": "pubmed.9360983", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RIM1alpha forms a protein scaffold for regulating neurotransmitter release at the active zone.", "journal": "Nature", "date": "2002", "authors": "Schoch S, Castillo PE, Jo T, Mukherjee K, Geppert M, Wang Y, Schmitz F, Malenka RC, Sudhof TC", "reference": { "type": "PubMed", "id": "11797009", "url": "https://pubmed.ncbi.nlm.nih.gov/11797009" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q91Z79-1", "protein_name": "Liprin-alpha-3", "gene_name": "Ppfia3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q91Z80-1", "protein_name": "Liprin-alpha-4", "gene_name": "Ppfia4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JIR4-1", "protein_name": "Regulating synaptic membrane exocytosis protein 1", "gene_name": "Rims1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JIS1-1", "protein_name": "Regulating synaptic membrane exocytosis protein 2", "gene_name": "Rims2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99NE5-1", "protein_name": "Regulating synaptic membrane exocytosis protein 1", "gene_name": "Rims1", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q91Z79", "url": "https://www.uniprot.org/uniprotkb/Q91Z79" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11797009", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential proteomics leads to identification of domain specific epididymal sperm proteins.", "journal": "J. Androl.", "date": "2011", "authors": "Suryawanshi Amol R, Khan Shagufta A, Gajbhiye Rahul K, Gurav Mamta Y, Khole Vrinda V", "reference": { "type": "PubMed", "id": "20966424", "url": "https://pubmed.ncbi.nlm.nih.gov/20966424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q91Z79-1", "protein_name": "Liprin-alpha-3", "gene_name": "Ppfia3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9QXL7-1", "protein_name": "Nucleoside diphosphate kinase 7", "gene_name": "Nme7", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5FVK6-1", "protein_name": "Coiled-coil and C2 domain-containing protein 1B", "gene_name": "Cc2d1b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5I0K5-1", "protein_name": "Palmitoyl-protein thioesterase ABHD10, mitochondrial", "gene_name": "Abhd10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11240-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "Cox5a; LOC100361008", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5U4E6-1", "protein_name": "Golgin subfamily A member 4", "gene_name": "Golga4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P04182-1", "protein_name": "Ornithine aminotransferase, mitochondrial", "gene_name": "Oat", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q561S0-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial", "gene_name": "Ndufa10l1; Ndufa10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q02253-1", "protein_name": "Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial", "gene_name": "Aldh6a1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q91Z79", "url": "https://www.uniprot.org/uniprotkb/Q91Z79" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20966424", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MIR16, a putative membrane glycerophosphodiester phosphodiesterase, interacts with RGS16.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Zheng B, Chen D, Farquhar MG", "reference": { "type": "PubMed", "id": "10760272", "url": "https://pubmed.ncbi.nlm.nih.gov/10760272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JL55-1", "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JL56-1", "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6UWR7-1", "protein_name": "Glycerophosphocholine cholinephosphodiesterase ENPP6", "gene_name": "ENPP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZV29-1", "protein_name": "Patatin-like phospholipase domain-containing protein 7", "gene_name": "PNPLA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTR4-1", "protein_name": "Glycerophosphodiester phosphodiesterase 2", "gene_name": "GDPD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZC3-1", "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "GDE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY17-4", "protein_name": "Patatin-like phospholipase domain-containing protein 6", "gene_name": "PNPLA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5L3-2", "protein_name": "Lysophospholipase D GDPD3", "gene_name": "GDPD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9F7-1", "protein_name": "Lysophospholipase D GDPD1", "gene_name": "GDPD1", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JL55", "url": "https://www.uniprot.org/uniprotkb/Q9JL55" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10760272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GDE1/MIR16 is a glycerophosphoinositol phosphodiesterase regulated by stimulation of G protein-coupled receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Zheng B, Berrie CP, Corda D, Farquhar MG", "reference": { "type": "PubMed", "id": "12576545", "url": "https://pubmed.ncbi.nlm.nih.gov/12576545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JL55-1", "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JL56-1", "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "Gde1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6UWR7-1", "protein_name": "Glycerophosphocholine cholinephosphodiesterase ENPP6", "gene_name": "ENPP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZV29-1", "protein_name": "Patatin-like phospholipase domain-containing protein 7", "gene_name": "PNPLA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTR4-1", "protein_name": "Glycerophosphodiester phosphodiesterase 2", "gene_name": "GDPD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZC3-1", "protein_name": "Glycerophosphodiester phosphodiesterase 1", "gene_name": "GDE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY17-4", "protein_name": "Patatin-like phospholipase domain-containing protein 6", "gene_name": "PNPLA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L5L3-2", "protein_name": "Lysophospholipase D GDPD3", "gene_name": "GDPD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9F7-1", "protein_name": "Lysophospholipase D GDPD1", "gene_name": "GDPD1", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JL55", "url": "https://www.uniprot.org/uniprotkb/Q9JL55" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 112, "end_pos": 112, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9JL55", "url": "https://www.uniprot.org/uniprotkb/Q9JL55" }, { "database": "PubMed", "id": "12576545", "url": "https://pubmed.ncbi.nlm.nih.gov/12576545" } ], "uniprot_canonical_ac": "Q9JL55-1" }, { "start_pos": 97, "end_pos": 97, "sequence_org": "E", "sequence_mut": "A", "comment": "Strongly reduced activity; when associated with A-99.", "evidence": [ { "database": "UniProtKB", "id": "Q9JL55", "url": "https://www.uniprot.org/uniprotkb/Q9JL55" }, { "database": "PubMed", "id": "12576545", "url": "https://pubmed.ncbi.nlm.nih.gov/12576545" } ], "uniprot_canonical_ac": "Q9JL55-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduced activity; when associated with A-97.", "evidence": [ { "database": "UniProtKB", "id": "Q9JL55", "url": "https://www.uniprot.org/uniprotkb/Q9JL55" }, { "database": "PubMed", "id": "12576545", "url": "https://pubmed.ncbi.nlm.nih.gov/12576545" } ], "uniprot_canonical_ac": "Q9JL55-1" } ], "record_id": "pubmed.12576545", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAT protein mRNA expression in primary rat hepatocytes: Effects of exposure to fatty acids.", "journal": "International journal of molecular medicine", "date": "2010", "authors": "Grasselli E, Voci A, Pesce C, Canesi L, Fugassa E, Gallo G, Vergani L", "reference": { "type": "PubMed", "id": "20198297", "url": "https://pubmed.ncbi.nlm.nih.gov/20198297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20198297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Perilipin 5, a lipid droplet-associated protein, provides physical and metabolic linkage to mitochondria.", "journal": "Journal of lipid research", "date": "2011-12", "authors": "Wang Hong, Sreenivasan Urmilla, Hu Hong, Saladino Andrew, Polster Brian M, Lund Linda M, Gong Da-Wei, Stanley William C, Sztalryd Carole", "reference": { "type": "PubMed", "id": "21885430", "url": "https://pubmed.ncbi.nlm.nih.gov/21885430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8BVZ1-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.21885430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The lipid droplet coat protein perilipin 5 also localizes to muscle mitochondria.", "journal": "Histochemistry and cell biology", "date": "2012-02", "authors": "Bosma Madeleen, Minnaard Ronnie, Sparks Lauren M, Schaart Gert, Losen Mario, de Baets Marc H, Duimel Hans, Kersten Sander, Bickel Perry E, Schrauwen Patrick, Hesselink Matthijs K C", "reference": { "type": "PubMed", "id": "22127648", "url": "https://pubmed.ncbi.nlm.nih.gov/22127648" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22127648", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of PLIN5 in skeletal muscle promotes oxidative gene expression and intramyocellular lipid content without compromising insulin sensitivity.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Bosma M, Sparks LM, Hooiveld GJ, Jorgensen JA, Houten SM, Schrauwen P, Kersten S, Hesselink MK", "reference": { "type": "PubMed", "id": "23353597", "url": "https://pubmed.ncbi.nlm.nih.gov/23353597" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.23353597", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Skeletal muscle PLIN proteins, ATGL and CGI-58, interactions at rest and following stimulated contraction.", "journal": "Am. J. Physiol.", "date": "2013", "authors": "MacPherson RE, Ramos SV, Vandenboom R, Roy BD, Peters SJ", "reference": { "type": "PubMed", "id": "23408028", "url": "https://pubmed.ncbi.nlm.nih.gov/23408028" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P0C548-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "Pnpla2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6QA69-1", "protein_name": "1-acylglycerol-3-phosphate O-acyltransferase ABHD5", "gene_name": "Abhd5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.23408028", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Skeletal muscle PLIN3 and PLIN5 are serine phosphorylated at rest and following lipolysis during adrenergic or contractile stimulation.", "journal": "Physiological reports", "date": "2013", "authors": "Macpherson RE, Vandenboom R, Roy BD, Peters SJ", "reference": { "type": "PubMed", "id": "24303154", "url": "https://pubmed.ncbi.nlm.nih.gov/24303154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P15304-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "Lipe", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P0C548-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "Pnpla2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24303154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A maternal high fat diet has long-lasting effects on skeletal muscle lipid and PLIN protein content in rat offspring at young adulthood.", "journal": "Lipids", "date": "2015", "authors": "MacPherson RE, Castelli LM, Miotto PM, Frendo-Cumbo S, Milburn A, Roy BD, LeBlanc PJ, Ward WE, Peters SJ", "reference": { "type": "PubMed", "id": "25552350", "url": "https://pubmed.ncbi.nlm.nih.gov/25552350" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.25552350", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Perilipin 5 mediated lipid droplet remodelling revealed by coherent Raman imaging.", "journal": "Integrative biology : quantitative biosciences from nano to macro", "date": "2015", "authors": "Billecke N, Bosma M, Rock W, Fleissner F, Best G, Schrauwen P, Kersten S, Bonn M, Hesselink MK, Parekh SH", "reference": { "type": "PubMed", "id": "25804837", "url": "https://pubmed.ncbi.nlm.nih.gov/25804837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.25804837", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Perilipin 5 Reduces Oxidative Damage Associated With Lipotoxicity by Activating the PI3K/ERK-Mediated Nrf2-ARE Signaling Pathway in INS-1 Pancreatic beta-Cells.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Zhu Y, Ren C, Zhang M, Zhong Y", "reference": { "type": "PubMed", "id": "32296390", "url": "https://pubmed.ncbi.nlm.nih.gov/32296390" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32296390", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Perilipin 5 regulates hepatic stellate cell activation and high-fat diet-induced non-alcoholic fatty liver disease.", "journal": "Animal models and experimental medicine", "date": "2024-04", "authors": "Yin Xuecui, Dong Lin, Wang Xiaohan, Qin Zhenzhen, Ma Yuying, Ke Xiaofei, Li Ya, Wang Qingde, Mi Yang, Lyu Quanjun, Xu Xia, Zheng Pengyuan, Tang Youcai", "reference": { "type": "PubMed", "id": "37202925", "url": "https://pubmed.ncbi.nlm.nih.gov/37202925" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "M0R7Z9-1", "protein_name": "Perilipin-5", "gene_name": "Plin5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R7Z9", "url": "https://www.uniprot.org/uniprotkb/M0R7Z9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37202925", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression cloning of a novel farnesylated protein, RDJ2, encoding a DnaJ protein homologue.", "journal": "Arch. Biochem. Biophys.", "date": "1997", "authors": "Andres DA, Shao H, Crick DC, Finlin BS", "reference": { "type": "PubMed", "id": "9328291", "url": "https://pubmed.ncbi.nlm.nih.gov/9328291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35824-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35824", "url": "https://www.uniprot.org/uniprotkb/O35824" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9328291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PF4 induces inflammatory response through NF-kB signal pathway in rats with intracerebral haemorrhage.", "journal": "Folia neuropathologica", "date": "2023", "authors": "Hu Na, An Ran, Yu Kun, Chang Yanzhong, Gao Weijuan", "reference": { "type": "PubMed", "id": "38174673", "url": "https://pubmed.ncbi.nlm.nih.gov/38174673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06765-1", "protein_name": "Platelet factor 4", "gene_name": "Pf4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P06765", "url": "https://www.uniprot.org/uniprotkb/P06765" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.38174673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the rat platelet factor 4 gene: a marker for megakaryocyte differentiation.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Doi T, Greenberg SM, Rosenberg RD", "reference": { "type": "PubMed", "id": "3821732", "url": "https://pubmed.ncbi.nlm.nih.gov/3821732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06765-1", "protein_name": "Platelet factor 4", "gene_name": "Pf4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P06765", "url": "https://www.uniprot.org/uniprotkb/P06765" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3821732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rat platelets contain glycosylated and non-glycosylated forms of platelet factor 4. Identification and characterization by mass spectrometry.", "journal": "European journal of biochemistry", "date": "1994", "authors": "Ravanat C, Gachet C, Herbert JM, Schuhler S, Guillemot JC, Uzabiaga F, Picard C, Ferrara P, Freund M, Cazenave JP", "reference": { "type": "PubMed", "id": "8033893", "url": "https://pubmed.ncbi.nlm.nih.gov/8033893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06765-1", "protein_name": "Platelet factor 4", "gene_name": "Pf4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P06765", "url": "https://www.uniprot.org/uniprotkb/P06765" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 31, "start_aa": "Thr", "end_pos": 31, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr31", "evidence": [ { "id": "P06765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P06765#ptm_processing" }, { "id": "8033893", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8033893" }, { "id": "GLY_001157", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001157" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P06765-1" } ], "record_id": "pubmed.8033893", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Removal of Abnormal Myofilament O-GlcNAcylation Restores Ca2+ Sensitivity in Diabetic Cardiac Muscle.", "journal": "Diabetes", "date": "2015", "authors": "Ramirez-Correa GA, Ma J, Slawson C, Zeidan Q, Lugo-Fagundo NS, Xu M, Shen X, Gao WD, Caceres V, Chakir K, DeVine L, Cole RN, Marchionni L, Paolocci N, Hart GW, Murphy AM", "reference": { "type": "PubMed", "id": "26109417", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P56741-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "Mybpc3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P02563-1", "protein_name": "Myosin-6", "gene_name": "Myh6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P16409-1", "protein_name": "Myosin light chain 3", "gene_name": "Myl3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P04692-1", "protein_name": "Tropomyosin alpha-1 chain", "gene_name": "Tpm1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P68035-1", "protein_name": "Actin, alpha cardiac muscle 1", "gene_name": "Actc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56741", "url": "https://www.uniprot.org/uniprotkb/P56741" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 47, "start_aa": "Ser", "end_pos": 47, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser47", "evidence": [ { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P56741", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P56741" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P56741", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P56741" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P56741-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1038, "start_aa": "Ser", "end_pos": 1038, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1038", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1138, "start_aa": "Ser", "end_pos": 1138, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1138", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1148, "start_aa": "Ser", "end_pos": 1148, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1148", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1159, "start_aa": "Ser", "end_pos": 1159, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1159", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1189, "start_aa": "Thr", "end_pos": 1189, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1189", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1200, "start_aa": "Ser", "end_pos": 1200, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1200", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1275, "start_aa": "Thr", "end_pos": 1275, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1275", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1303, "start_aa": "Thr", "end_pos": 1303, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1303", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1308, "start_aa": "Ser", "end_pos": 1308, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1308", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1336, "start_aa": "Ser", "end_pos": 1336, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1336", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1367, "start_aa": "Ser", "end_pos": 1367, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1367", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1414, "start_aa": "Ser", "end_pos": 1414, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1414", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1436, "start_aa": "Ser", "end_pos": 1436, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1436", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1464, "start_aa": "Ser", "end_pos": 1464, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1464", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1466, "start_aa": "Ser", "end_pos": 1466, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1466", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1470, "start_aa": "Ser", "end_pos": 1470, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1470", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1471, "start_aa": "Ser", "end_pos": 1471, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1471", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1597, "start_aa": "Ser", "end_pos": 1597, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1597", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" }, { "id": "19322778", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19322778" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1600, "start_aa": "Thr", "end_pos": 1600, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1600", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1601, "start_aa": "Ser", "end_pos": 1601, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1601", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1606, "start_aa": "Thr", "end_pos": 1606, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1606", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1638, "start_aa": "Ser", "end_pos": 1638, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1638", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1696, "start_aa": "Thr", "end_pos": 1696, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1696", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1710, "start_aa": "Thr", "end_pos": 1710, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1710", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1711, "start_aa": "Ser", "end_pos": 1711, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1711", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" }, { "id": "19322778", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19322778" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 172, "start_aa": "Ser", "end_pos": 172, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser172", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 176, "start_aa": "Thr", "end_pos": 176, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr176", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1776, "start_aa": "Thr", "end_pos": 1776, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1776", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1777, "start_aa": "Ser", "end_pos": 1777, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1777", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 179, "start_aa": "Ser", "end_pos": 179, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser179", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1837, "start_aa": "Ser", "end_pos": 1837, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1837", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 18, "start_aa": "Ser", "end_pos": 18, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser18", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1916, "start_aa": "Ser", "end_pos": 1916, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1916", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 196, "start_aa": "Ser", "end_pos": 196, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser196", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 241, "start_aa": "Ser", "end_pos": 241, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser241", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 242, "start_aa": "Ser", "end_pos": 242, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser242", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 34, "start_aa": "Thr", "end_pos": 34, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr34", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 392, "start_aa": "Ser", "end_pos": 392, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser392", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 59, "start_aa": "Thr", "end_pos": 59, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr59", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 622, "start_aa": "Ser", "end_pos": 622, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser622", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 626, "start_aa": "Ser", "end_pos": 626, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser626", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 644, "start_aa": "Ser", "end_pos": 644, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser644", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 739, "start_aa": "Ser", "end_pos": 739, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser739", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 749, "start_aa": "Ser", "end_pos": 749, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser749", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 843, "start_aa": "Ser", "end_pos": 843, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser843", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 880, "start_aa": "Ser", "end_pos": 880, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser880", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P02563", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02563" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P02563", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02563" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02563-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 164, "start_aa": "Thr", "end_pos": 164, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr164", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P16409", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16409" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P16409", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16409" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P16409-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 45, "start_aa": "Ser", "end_pos": 45, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser45", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P16409", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16409" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P16409", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16409" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P16409-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 93, "start_aa": "Thr", "end_pos": 93, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr93", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P16409", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16409" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P16409", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16409" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P16409-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 123, "start_aa": "Ser", "end_pos": 123, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser123", "evidence": [ { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P04692", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04692" }, { "id": "P04692", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04692" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04692-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 132, "start_aa": "Ser", "end_pos": 132, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser132", "evidence": [ { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P04692", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04692" }, { "id": "P04692", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04692" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04692-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 186, "start_aa": "Ser", "end_pos": 186, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser186", "evidence": [ { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P04692", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04692" }, { "id": "P04692", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04692" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P04692-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 206, "start_aa": "Ser", "end_pos": 206, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser206", "evidence": [ { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P04692", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04692" }, { "id": "P04692", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04692" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P04692-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 87, "start_aa": "Ser", "end_pos": 87, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser87", "evidence": [ { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "P04692", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04692" }, { "id": "P04692", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04692" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04692-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 151, "start_aa": "Ser", "end_pos": 151, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser151", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P23693", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P23693" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 167, "start_aa": "Ser", "end_pos": 167, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser167", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P23693", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P23693" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P23693", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P23693" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 45, "start_aa": "Ser", "end_pos": 45, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser45", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 5, "start_aa": "Ser", "end_pos": 5, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser5", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P23693", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P23693" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 6, "start_aa": "Ser", "end_pos": 6, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser6", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P23693", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P23693" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 78, "start_aa": "Ser", "end_pos": 78, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser78", "evidence": [ { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "P23693", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P23693" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P23693", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P23693" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P23693-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 157, "start_aa": "Ser", "end_pos": 157, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser157", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 201, "start_aa": "Ser", "end_pos": 201, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser201", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 234, "start_aa": "Ser", "end_pos": 234, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser234", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 241, "start_aa": "Ser", "end_pos": 241, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser241", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 325, "start_aa": "Ser", "end_pos": 325, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser325", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 326, "start_aa": "Thr", "end_pos": 326, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr326", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 35, "start_aa": "Ser", "end_pos": 35, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser35", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 370, "start_aa": "Ser", "end_pos": 370, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser370", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 54, "start_aa": "Ser", "end_pos": 54, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser54", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 62, "start_aa": "Ser", "end_pos": 62, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser62", "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P68035", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68035" }, { "id": "18988896", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18988896" }, { "id": "26109417", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26109417" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "P68035", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68035" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P68035-1" } ], "glycan_expression": [ { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1138, "end_pos": 1138 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1148, "end_pos": 1148 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 1303, "end_pos": 1303 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1367, "end_pos": 1367 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1414, "end_pos": 1414 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1436, "end_pos": 1436 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1464, "end_pos": 1464 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1466, "end_pos": 1466 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1471, "end_pos": 1471 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1597, "end_pos": 1597 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 1600, "end_pos": 1600 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1601, "end_pos": 1601 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1638, "end_pos": 1638 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 1696, "end_pos": 1696 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 1710, "end_pos": 1710 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1711, "end_pos": 1711 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 172, "end_pos": 172 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 1776, "end_pos": 1776 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1777, "end_pos": 1777 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 179, "end_pos": 179 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1837, "end_pos": 1837 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 1916, "end_pos": 1916 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 196, "end_pos": 196 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 34, "end_pos": 34 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Thr", "start_pos": 59, "end_pos": 59 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 626, "end_pos": 626 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 739, "end_pos": 739 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P02563-1", "residue": "Ser", "start_pos": 843, "end_pos": 843 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P04692-1", "residue": "Ser", "start_pos": 123, "end_pos": 123 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P04692-1", "residue": "Ser", "start_pos": 132, "end_pos": 132 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P04692-1", "residue": "Ser", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P04692-1", "residue": "Ser", "start_pos": 206, "end_pos": 206 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P04692-1", "residue": "Ser", "start_pos": 87, "end_pos": 87 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P16409-1", "residue": "Ser", "start_pos": 45, "end_pos": 45 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P16409-1", "residue": "Thr", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P23693-1", "residue": "Ser", "start_pos": 167, "end_pos": 167 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P23693-1", "residue": "Ser", "start_pos": 43, "end_pos": 43 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P23693-1", "residue": "Ser", "start_pos": 5, "end_pos": 5 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P23693-1", "residue": "Ser", "start_pos": 6, "end_pos": 6 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P23693-1", "residue": "Ser", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P56741-1", "residue": "Ser", "start_pos": 47, "end_pos": 47 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 201, "end_pos": 201 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 234, "end_pos": 234 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 325, "end_pos": 325 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Thr", "start_pos": 326, "end_pos": 326 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 35, "end_pos": 35 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 370, "end_pos": 370 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 54, "end_pos": 54 }, { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "heart", "namespace": "UBERON", "id": "0000948", "url": "http://purl.obolibrary.org/obo/UBERON_0000948" }, "species": { "name": "Rattus norvegicus", "taxid": 10116, "reference_species": "Rattus norvegicus [10116]", "common_name": "Rat", "glygen_name": "Rat" }, "cell_line": {}, "uniprot_canonical_ac": "P68035-1", "residue": "Ser", "start_pos": 62, "end_pos": 62 } ], "record_id": "pubmed.26109417", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 72 }, { "field": "total_sites", "count": 72 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 72 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 72 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 72 }, { "field": "exact_o_linked_sites", "count": 72 }, { "field": "exact_o_linked_glycan_sites", "count": 72 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 72 }, { "field": "total_sites", "count": 72 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 72 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 72 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 72 }, { "field": "exact_o_linked_sites", "count": 72 }, { "field": "exact_o_linked_glycan_sites", "count": 72 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A post-MI power struggle: adaptations in cardiac power occur at the sarcomere level alongside MyBP-C and RLC phosphorylation.", "journal": "American journal of physiology. Heart and circulatory physiology", "date": "2016", "authors": "Toepfer CN, Sikkel MB, Caorsi V, Vydyanath A, Torre I, Copeland O, Lyon AR, Marston SB, Luther PK, Macleod KT, West TG, Ferenczi MA", "reference": { "type": "PubMed", "id": "27233767", "url": "https://pubmed.ncbi.nlm.nih.gov/27233767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56741-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "Mybpc3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P13832-1", "protein_name": "Myosin regulatory light chain RLC-A", "gene_name": "Rlc-a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P18666-1", "protein_name": "Myosin regulatory light chain 12B", "gene_name": "Myl12b", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56741", "url": "https://www.uniprot.org/uniprotkb/P56741" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27233767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contractile responses to endothelin-1 are regulated by PKC phosphorylation of cardiac myosin binding protein-C in rat ventricular myocytes.", "journal": "Journal of molecular and cellular cardiology", "date": "2018", "authors": "Smyrnias I, Goodwin N, Wachten D, Skogestad J, Aronsen JM, Robinson EL, Demydenko K, Segonds-Pichon A, Oxley D, Sadayappan S, Sipido K, Bootman MD, Roderick HL", "reference": { "type": "PubMed", "id": "29470978", "url": "https://pubmed.ncbi.nlm.nih.gov/29470978" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56741-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "Mybpc3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56741", "url": "https://www.uniprot.org/uniprotkb/P56741" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29470978", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional effects of myosin-binding protein-C phosphorylation in heart muscle are not mimicked by serine-to-aspartate substitutions.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Kampourakis T, Ponnam S, Sun YB, Sevrieva I, Irving M", "reference": { "type": "PubMed", "id": "30082313", "url": "https://pubmed.ncbi.nlm.nih.gov/30082313" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56741-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "Mybpc3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56741", "url": "https://www.uniprot.org/uniprotkb/P56741" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30082313", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Site-specific phosphorylation of myosin binding protein-C coordinates thin and thick filament activation in cardiac muscle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Ponnam S, Sevrieva I, Sun YB, Irving M, Kampourakis T", "reference": { "type": "PubMed", "id": "31308242", "url": "https://pubmed.ncbi.nlm.nih.gov/31308242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56741-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "Mybpc3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56741", "url": "https://www.uniprot.org/uniprotkb/P56741" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31308242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cardiac myosin-binding protein C (MyBP-C): identification of protein kinase A and protein kinase C phosphorylation sites.", "journal": "Arch. Biochem. Biophys.", "date": "1998", "authors": "Mohamed A S, Dignam J D, Schlender K K", "reference": { "type": "PubMed", "id": "9784245", "url": "https://pubmed.ncbi.nlm.nih.gov/9784245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56741-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "Mybpc3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q90688-1", "protein_name": "Myosin-binding protein C, cardiac-type", "gene_name": "MYBPC3", "tax_name": "Chicken" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56741", "url": "https://www.uniprot.org/uniprotkb/P56741" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 1169, "end_pos": 1169, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "Q90688", "url": "https://www.uniprot.org/uniprotkb/Q90688" }, { "database": "iPTMnet", "id": "Q90688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q90688" }, { "database": "PubMed", "id": "9784245", "url": "https://pubmed.ncbi.nlm.nih.gov/9784245" } ], "site_lbl": "Ser1169", "uniprot_canonical_ac": "Q90688-1" }, { "start_pos": 265, "end_pos": 265, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKC", "evidence": [ { "database": "UniProtKB", "id": "Q90688", "url": "https://www.uniprot.org/uniprotkb/Q90688" }, { "database": "iPTMnet", "id": "Q90688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q90688" }, { "database": "PubMed", "id": "9784245", "url": "https://pubmed.ncbi.nlm.nih.gov/9784245" } ], "site_lbl": "Ser265", "uniprot_canonical_ac": "Q90688-1" }, { "start_pos": 274, "end_pos": 274, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKA and PKC", "evidence": [ { "database": "UniProtKB", "id": "Q90688", "url": "https://www.uniprot.org/uniprotkb/Q90688" }, { "database": "iPTMnet", "id": "Q90688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q90688" }, { "database": "PubMed", "id": "9784245", "url": "https://pubmed.ncbi.nlm.nih.gov/9784245" } ], "site_lbl": "Thr274", "uniprot_canonical_ac": "Q90688-1" }, { "start_pos": 300, "end_pos": 300, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "Q90688", "url": "https://www.uniprot.org/uniprotkb/Q90688" }, { "database": "iPTMnet", "id": "Q90688", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q90688" }, { "database": "PubMed", "id": "9784245", "url": "https://pubmed.ncbi.nlm.nih.gov/9784245" } ], "site_lbl": "Ser300", "uniprot_canonical_ac": "Q90688-1" } ], "record_id": "pubmed.9784245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neuronal Ca(2+) sensor 1. Characterization of the myristoylated protein, its cellular effects in permeabilized adrenal chromaffin cells, Ca(2+)-independent membrane association, and interaction with binding proteins, suggesting a role in rapid Ca(2+) signal transduction.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "McFerran BW, Weiss JL, Burgoyne RD", "reference": { "type": "PubMed", "id": "10514519", "url": "https://pubmed.ncbi.nlm.nih.gov/10514519" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10514519", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of neuronal calcium sensor-1 (NCS-1) with phosphatidylinositol 4-kinase beta stimulates lipid kinase activity and affects membrane trafficking in COS-7 cells.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Zhao X, Varnai P, Tuymetova G, Balla A, Toth ZE, Oker-Blom C, Roder J, Jeromin A, Balla T", "reference": { "type": "PubMed", "id": "11526106", "url": "https://pubmed.ncbi.nlm.nih.gov/11526106" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O02810-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "PI4KB", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "O08561-1", "protein_name": "Phosphatidylinositol 4-kinase beta", "gene_name": "Pi4kb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q2V8Y7-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "NCS1", "tax_name": "Bovine" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11526106", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL1-receptor accessory protein-like 1 (IL1RAPL1), a protein involved in cognitive functions, regulates N-type Ca2+-channel and neurite elongation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gambino F, Pavlowsky A, Begle A, Dupont JL, Bahi N, Courjaret R, Gardette R, Hadjkacem H, Skala H, Poulain B, Chelly J, Vitale N, Humeau Y", "reference": { "type": "PubMed", "id": "17502602", "url": "https://pubmed.ncbi.nlm.nih.gov/17502602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P59824-1", "protein_name": "Interleukin-1 receptor accessory protein-like 1", "gene_name": "Il1rapl1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.17502602", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulatory and structural EF-hand motifs of neuronal calcium sensor-1: Mg 2+ modulates Ca 2+ binding, Ca 2+ -induced conformational changes, and equilibrium unfolding transitions.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Aravind P, Chandra K, Reddy PP, Jeromin A, Chary KV, Sharma Y", "reference": { "type": "PubMed", "id": "18199453", "url": "https://pubmed.ncbi.nlm.nih.gov/18199453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 109, "end_pos": 109, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of magnesium-binding; when associated with A-73, Q-84 and Q-120.", "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" }, { "database": "PubMed", "id": "18199453", "url": "https://pubmed.ncbi.nlm.nih.gov/18199453" } ], "uniprot_canonical_ac": "P62168-1" }, { "start_pos": 120, "end_pos": 120, "sequence_org": "E", "sequence_mut": "Q", "comment": "Loss of magnesium-binding; when associated with A-73, Q-84 and A-109.", "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" }, { "database": "PubMed", "id": "18199453", "url": "https://pubmed.ncbi.nlm.nih.gov/18199453" } ], "uniprot_canonical_ac": "P62168-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of magnesium-binding; when associated with Q-84, A-109 and Q-120.", "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" }, { "database": "PubMed", "id": "18199453", "url": "https://pubmed.ncbi.nlm.nih.gov/18199453" } ], "uniprot_canonical_ac": "P62168-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "E", "sequence_mut": "Q", "comment": "Loss of magnesium-binding; when associated with A-73, A-109 and Q-120.", "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" }, { "database": "PubMed", "id": "18199453", "url": "https://pubmed.ncbi.nlm.nih.gov/18199453" } ], "uniprot_canonical_ac": "P62168-1" } ], "record_id": "pubmed.18199453", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metabotropic glutamate receptor-mediated LTD involves two interacting Ca(2+) sensors, NCS-1 and PICK1.", "journal": "Neuron", "date": "2008", "authors": "Jo Jihoon, Heon Seok, Kim Myung Jong, Son Gi Hoon, Park Yunkyung, Henley Jeremy M, Weiss Jamie L, Sheng Morgan, Collingridge Graham L, Cho Kwangwook", "reference": { "type": "PubMed", "id": "19109914", "url": "https://pubmed.ncbi.nlm.nih.gov/19109914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9EP80-1", "protein_name": "PRKCA-binding protein", "gene_name": "Pick1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19109914", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of low-energy excited states in the native state ensemble of non-myristoylated and myristoylated neuronal calcium sensor-1.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Chandra K, Sharma Y, Chary KV", "reference": { "type": "PubMed", "id": "21035569", "url": "https://pubmed.ncbi.nlm.nih.gov/21035569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.21035569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential effects of swimming training on neuronal calcium sensor-1 expression in rat hippocampus/cortex and in object recognition memory tasks.", "journal": "Brain research bulletin", "date": "2012", "authors": "Drumond LE, Mourao FA, Leite HR, Abreu RV, Reis HJ, Moraes MF, Pereira GS, Massensini AR", "reference": { "type": "PubMed", "id": "22521426", "url": "https://pubmed.ncbi.nlm.nih.gov/22521426" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22521426", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluation of NCS-1, DARPP-32, and neurotrophins in hippocampus and prefrontal cortex in rats submitted to sepsis.", "journal": "Synapse (New York, N.Y.)", "date": "2014", "authors": "Comim CM, Silva NC, Mina F, Dominguini D, Scaini G, Morais MO, Rosa DV, Magno LA, Streck EL, Romano-Silva MA, Quevedo J, Dal-Pizzol F", "reference": { "type": "PubMed", "id": "24978930", "url": "https://pubmed.ncbi.nlm.nih.gov/24978930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24978930", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of critical amino acid residues and functional conservation of the Neurospora crassa and Rattus norvegicus orthologues of neuronal calcium sensor-1.", "journal": "Genetica", "date": "2016", "authors": "Gohain D, Deka R, Tamuli R", "reference": { "type": "PubMed", "id": "27796528", "url": "https://pubmed.ncbi.nlm.nih.gov/27796528" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27796528", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of rhodopsin phosphorylation by a family of neuronal calcium sensors.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "De Castro E, Nef S, Fiumelli H, Lenz S E, Kawamura S, Nef P", "reference": { "type": "PubMed", "id": "7488079", "url": "https://pubmed.ncbi.nlm.nih.gov/7488079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62168-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "Ncs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P62167-1", "protein_name": "Neuronal calcium sensor 1", "gene_name": "NCS1", "tax_name": "Chicken" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P62168", "url": "https://www.uniprot.org/uniprotkb/P62168" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7488079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In cardiac fibroblasts, interferon-beta attenuates differentiation, collagen synthesis, and TGF-beta1-induced collagen gel contraction.", "journal": "Cytokine", "date": "2021", "authors": "Bolivar S, Espitia-Corredor JA, Olivares-Silva F, Valenzuela P, Humeres C, Anfossi R, Castro E, Vivar R, Salas-Hernandez A, Pardo-Jimenez V, Diaz-Araya G", "reference": { "type": "PubMed", "id": "33160814", "url": "https://pubmed.ncbi.nlm.nih.gov/33160814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70499-1", "protein_name": "Interferon beta", "gene_name": "Ifnb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70499", "url": "https://www.uniprot.org/uniprotkb/P70499" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33160814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and expression of rat interferon beta gene and growth-inhibitory effect of its expression on rat glioma cells.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1997", "authors": "Yokoyama S, Ohishi N, Shamoto M, Watanabe Y, Yagi K", "reference": { "type": "PubMed", "id": "9126338", "url": "https://pubmed.ncbi.nlm.nih.gov/9126338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70499-1", "protein_name": "Interferon beta", "gene_name": "Ifnb1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70499", "url": "https://www.uniprot.org/uniprotkb/P70499" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9126338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The proximal portion of the COOH terminus of the oxytocin receptor is required for coupling to g(q), but not g(i). Independent mechanisms for elevating intracellular calcium concentrations from intracellular stores.", "journal": "The Journal of biological chemistry", "date": "1999-10-01", "authors": "Hoare S, Copland J A, Strakova Z, Ives K, Jeng Y J, Hellmich M R, Soloff M S", "reference": { "type": "PubMed", "id": "10497238", "url": "https://pubmed.ncbi.nlm.nih.gov/10497238" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 337, "end_pos": 388, "sequence_org": "HELVQRFFCCSARYLKGSRPGETSVSKKSNSSTFVLSRRSSSQRSCSQPSSA", "sequence_mut": "", "comment": "Reduced G(q)-dependent signaling.", "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" }, { "database": "PubMed", "id": "10497238", "url": "https://pubmed.ncbi.nlm.nih.gov/10497238" } ], "uniprot_canonical_ac": "P70536-1" } ], "record_id": "pubmed.10497238", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Naturally occurring variations in maternal behavior in the rat are associated with differences in estrogen-inducible central oxytocin receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-10-23", "authors": "Champagne F, Diorio J, Sharma S, Meaney M J", "reference": { "type": "PubMed", "id": "11606726", "url": "https://pubmed.ncbi.nlm.nih.gov/11606726" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11606726", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of the oxytocin receptor in the plasma membrane of rat myometrium.", "journal": "Eur. J. Biochem.", "date": "1978", "authors": "Branda L.A., Crankshaw D.J., Daniel E.E., Matlib M.A.", "reference": { "type": "PubMed", "id": "207528", "url": "https://pubmed.ncbi.nlm.nih.gov/207528" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.207528", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of oxytocin receptor gene expression in obsessive-compulsive disorder: a possible role for the microbiota-host epigenetic axis.", "journal": "Clinical epigenetics", "date": "2022", "authors": "D'Addario C, Pucci M, Bellia F, Girella A, Sabatucci A, Fanti F, Vismara M, Benatti B, Ferrara L, Fasciana F, Celebre L, Vigano C, Elli L, Sergi M, Maccarrone M, Buzzelli V, Trezza V, Dell'Osso B", "reference": { "type": "PubMed", "id": "35361281", "url": "https://pubmed.ncbi.nlm.nih.gov/35361281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35361281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Delivery-dependent shift in oxytocin-responsive cell population in the central amygdala of the female rat.", "journal": "Neuroendocrinology", "date": "2022-07-04", "authors": "Suzuki Jiro, Nagase Masashi, Sato Naoko, Takahashi Yukari, Okamoto Aikou, Kato Fusao", "reference": { "type": "PubMed", "id": "35785764", "url": "https://pubmed.ncbi.nlm.nih.gov/35785764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35785764", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brief versus long maternal separation in lactating rats: Consequences on maternal behavior, emotionality, and brain oxytocin receptor binding.", "journal": "Journal of neuroendocrinology", "date": "2023-07", "authors": "Demarchi Luisa, Sanson Alice, Bosch Oliver J", "reference": { "type": "PubMed", "id": "37002874", "url": "https://pubmed.ncbi.nlm.nih.gov/37002874" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37002874", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peripheral Branch Injury Induces Oxytocin Receptor Expression at the Central Axon Terminals of Primary Sensory Neurons.", "journal": "International journal of molecular sciences", "date": "2023-12-19", "authors": "El Heni Heni, Kemenesi-Gedei P\u00e9ter B\u00e1tor, P\u00e1lv\u00f6lgyi Laura, Kozma-Szeredi Ivett Dorina, Kis Gy\u00f6ngyi", "reference": { "type": "PubMed", "id": "38203176", "url": "https://pubmed.ncbi.nlm.nih.gov/38203176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.38203176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of oxytocin receptor concentration in rat uterine explants by estrogen and progesterone.", "journal": "Can. J. Biochem. Cell Biol.", "date": "1983", "authors": "Baldwin S., Periyasamy S., Fernstrom M.A., Soloff M.S., Soloff S., Wieder M.", "reference": { "type": "PubMed", "id": "6313158", "url": "https://pubmed.ncbi.nlm.nih.gov/6313158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.6313158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alteration of the myometrial plasma membrane cholesterol content with beta-cyclodextrin modulates the binding affinity of the oxytocin receptor.", "journal": "Biochemistry", "date": "1995", "authors": "Fahrenholz F., Gimpl G., Klein U.", "reference": { "type": "PubMed", "id": "7577971", "url": "https://pubmed.ncbi.nlm.nih.gov/7577971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7577971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure, characterization, and expression of the rat oxytocin receptor gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Rozen F, Russo C, Banville D, Zingg HH", "reference": { "type": "PubMed", "id": "7816817", "url": "https://pubmed.ncbi.nlm.nih.gov/7816817" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7816817", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of oxytocin receptor function by direct binding of progesterone.", "journal": "Nature", "date": "1998-04-02", "authors": "Grazzini E, Guillon G, Mouillac B, Zingg H H", "reference": { "type": "PubMed", "id": "9548257", "url": "https://pubmed.ncbi.nlm.nih.gov/9548257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P70536-1", "protein_name": "Oxytocin receptor", "gene_name": "Oxtr", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P70536", "url": "https://www.uniprot.org/uniprotkb/P70536" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9548257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N-Glycosylation in isolated rat nerve terminals", "journal": "Molecular Omics", "date": "2021", "authors": "Matthies I., Abrahams J.L., Jensen P., Oliveira T., Kolarich D., Larsen M.R.", "reference": { "type": "DOI", "id": "10.1039/D0MO00044B", "url": "https://doi.org/10.1039/D0MO00044B" }, "referenced_glycans": [ { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G79941IJ" }, { "glytoucan_ac": "G82364UA" }, { "glytoucan_ac": "G27622TD" }, { "glytoucan_ac": "G72961RM" }, { "glytoucan_ac": "G95678HJ" }, { "glytoucan_ac": "G95835XS" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G92050GC" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G31852PQ" }, { "glytoucan_ac": "G19379ID" }, { "glytoucan_ac": "G36670VW" }, { "glytoucan_ac": "G37818NZ" }, { "glytoucan_ac": "G27947YN" }, { "glytoucan_ac": "G67324HN" }, { "glytoucan_ac": "G60923RB" }, { "glytoucan_ac": "G80920RR" }, { "glytoucan_ac": "G81572SC" }, { "glytoucan_ac": "G53434XO" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G99679NM" }, { "glytoucan_ac": "G41044JW" }, { "glytoucan_ac": "G41247ZX" }, { "glytoucan_ac": "G15486FH" }, { "glytoucan_ac": "G93579XB" }, { "glytoucan_ac": "G94917XT" }, { "glytoucan_ac": "G09406IK" }, { "glytoucan_ac": "G49955PK" }, { "glytoucan_ac": "G50073PQ" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G00912UN" }, { "glytoucan_ac": "G11115RO" }, { "glytoucan_ac": "G85144OK" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G62765YT" }, { "glytoucan_ac": "G06247RL" }, { "glytoucan_ac": "G32926LW" }, { "glytoucan_ac": "G68318VE" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z1Y3-1", "protein_name": "Cadherin-2", "gene_name": "Cdh2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97846-1", "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97685-1", "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P17046-1", "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O88871-1", "protein_name": "Gamma-aminobutyric acid type B receptor subunit 2", "gene_name": "Gabbr2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97829-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97686-1", "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P63079-1", "protein_name": "Gamma-aminobutyric acid receptor subunit beta-3", "gene_name": "Gabrb3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05546-1", "protein_name": "Tenascin-R", "gene_name": "Tnr", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P29994-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "Itpr1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63259-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "Ptprn", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q66HD0-1", "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63564-1", "protein_name": "Synaptic vesicle glycoprotein 2B", "gene_name": "Sv2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P07825-1", "protein_name": "Synaptophysin", "gene_name": "Syp", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P22063-1", "protein_name": "Contactin-2", "gene_name": "Cntn2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P55280-1", "protein_name": "Cadherin-6", "gene_name": "Cdh6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P24268-1", "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6P7S1-1", "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JHS6-1", "protein_name": "Acid-sensing ion channel 4", "gene_name": "Asic4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q62682-1", "protein_name": "Contactin-3", "gene_name": "Cntn3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q91XT9-1", "protein_name": "Neutral ceramidase", "gene_name": "Asah2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35795-1", "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "Entpd2; Npdc1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P05371-1", "protein_name": "Clusterin", "gene_name": "Clu", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P14046-1", "protein_name": "Alpha-1-inhibitor 3", "gene_name": "A1i3; Mug5; Mug6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63198-1", "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P45479-1", "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "Ppt1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q62609-1", "protein_name": "Noelin", "gene_name": "Olfm1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P13638-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P32736-1", "protein_name": "Opioid-binding protein/cell adhesion molecule", "gene_name": "Opcml", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P46101-1", "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35112-1", "protein_name": "CD166 antigen", "gene_name": "Alcam", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P01186-1", "protein_name": "Vasopressin-neurophysin 2-copeptin", "gene_name": "Avp", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5FVI4-1", "protein_name": "Cell cycle exit and neuronal differentiation protein 1", "gene_name": "Cend1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q00959-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2A", "gene_name": "Grin2a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P24090-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "Ahsg", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q00960-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P01830-1", "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63604-1", "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12346-1", "protein_name": "Serotransferrin", "gene_name": "Tf", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P07340-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P06687-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-3", "gene_name": "Atp1a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q794F9-1", "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "Slc3a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05695-1", "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P04094-1", "protein_name": "Proenkephalin-A", "gene_name": "Penk", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P31596-1", "protein_name": "Excitatory amino acid transporter 2", "gene_name": "Slc1a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63633-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "Slc12a5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97546-2", "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5FVH2-1", "protein_name": "5'-3' exonuclease PLD3", "gene_name": "Pld3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6Q629-1", "protein_name": "Inactive dipeptidyl peptidase 10", "gene_name": "Dpp10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5PPI4-1", "protein_name": "Lysosome-associated membrane glycoprotein 5", "gene_name": "Lamp5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P09006-1", "protein_name": "Serine protease inhibitor A3N", "gene_name": "Serpina3n", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P27615-1", "protein_name": "Lysosome membrane protein 2", "gene_name": "Scarb2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q45R42-1", "protein_name": "Leucine-rich repeat-containing protein 4", "gene_name": "Lrrc4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9Z1Y3-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9Z1Y3-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 277, "start_aa": "Asn", "end_pos": 277, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn277", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97846-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1015, "start_aa": "Asn", "end_pos": 1015, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1015", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1015, "start_aa": "Asn", "end_pos": 1015, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1015", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 305, "start_aa": "Asn", "end_pos": 305, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn305", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 866, "start_aa": "Asn", "end_pos": 866, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn866", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 881, "start_aa": "Asn", "end_pos": 881, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn881", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 881, "start_aa": "Asn", "end_pos": 881, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn881", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 881, "start_aa": "Asn", "end_pos": 881, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn881", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P17046-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 34, "start_aa": "Asn", "end_pos": 34, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn34", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 223, "start_aa": "Asn", "end_pos": 223, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn223", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 507, "start_aa": "Asn", "end_pos": 507, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn507", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 858, "start_aa": "Asn", "end_pos": 858, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn858", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 993, "start_aa": "Asn", "end_pos": 993, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn993", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 993, "start_aa": "Asn", "end_pos": 993, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn993", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 105, "start_aa": "Asn", "end_pos": 105, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn105", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P63079-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 580, "start_aa": "Asn", "end_pos": 580, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn580", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q05546-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2504, "start_aa": "Asn", "end_pos": 2504, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2504", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P29994-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 528, "start_aa": "Asn", "end_pos": 528, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn528", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63259-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q66HD0-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q66HD0-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 441, "start_aa": "Asn", "end_pos": 441, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn441", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 441, "start_aa": "Asn", "end_pos": 441, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn441", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 441, "start_aa": "Asn", "end_pos": 441, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn441", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 516, "start_aa": "Asn", "end_pos": 516, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn516", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 516, "start_aa": "Asn", "end_pos": 516, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn516", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G95835XS", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0010000.1110100000.010001000001111100.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 463, "start_aa": "Asn", "end_pos": 463, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn463", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P22063-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P22063-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 399, "start_aa": "Asn", "end_pos": 399, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn399", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P55280-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 399, "start_aa": "Asn", "end_pos": 399, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn399", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P55280-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24268-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24268-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24268-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 243, "start_aa": "Asn", "end_pos": 243, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn243", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9JHS6-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q62682-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 668, "start_aa": "Asn", "end_pos": 668, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn668", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q91XT9-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O35795-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 327, "start_aa": "Asn", "end_pos": 327, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn327", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P05371-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 327, "start_aa": "Asn", "end_pos": 327, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn327", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P05371-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 393, "start_aa": "Asn", "end_pos": 393, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn393", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P14046-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 994, "start_aa": "Asn", "end_pos": 994, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn994", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P14046-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 473, "start_aa": "Asn", "end_pos": 473, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn473", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 593, "start_aa": "Asn", "end_pos": 593, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn593", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 935, "start_aa": "Asn", "end_pos": 935, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn935", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 935, "start_aa": "Asn", "end_pos": 935, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn935", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P45479-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P45479-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P45479-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q62609-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q62609-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q62609-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G53434XO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Asn", "end_pos": 96, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn96", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Asn", "end_pos": 96, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn96", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 313, "start_aa": "Asn", "end_pos": 313, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn313", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 313, "start_aa": "Asn", "end_pos": 313, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn313", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 167, "start_aa": "Asn", "end_pos": 167, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn167", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O35112-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 167, "start_aa": "Asn", "end_pos": 167, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn167", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "O35112-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 480, "start_aa": "Asn", "end_pos": 480, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn480", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O35112-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 135, "start_aa": "Asn", "end_pos": 135, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn135", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01186-1" }, { "glytoucan_ac": "G82364UA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100101111101.00010.01000", "uniprot_canonical_ac": "Q5FVI4-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 444, "start_aa": "Asn", "end_pos": 444, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn444", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q00959-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24090-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 341, "start_aa": "Asn", "end_pos": 341, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn341", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 348, "start_aa": "Asn", "end_pos": 348, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn348", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 348, "start_aa": "Asn", "end_pos": 348, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn348", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 444, "start_aa": "Asn", "end_pos": 444, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn444", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 688, "start_aa": "Asn", "end_pos": 688, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn688", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G53434XO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G27622TD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 254, "start_aa": "Asn", "end_pos": 254, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn254", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 254, "start_aa": "Asn", "end_pos": 254, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn254", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 95, "start_aa": "Asn", "end_pos": 95, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn95", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 512, "start_aa": "Asn", "end_pos": 512, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn512", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P12346-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G72961RM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000001.000011000001101101.00010.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 473, "start_aa": "Asn", "end_pos": 473, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn473", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01000", "uniprot_canonical_ac": "P06687-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 263, "start_aa": "Asn", "end_pos": 263, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn263", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1072, "start_aa": "Asn", "end_pos": 1072, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1072", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 968, "start_aa": "Asn", "end_pos": 968, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn968", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 968, "start_aa": "Asn", "end_pos": 968, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn968", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 968, "start_aa": "Asn", "end_pos": 968, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn968", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 978, "start_aa": "Asn", "end_pos": 978, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn978", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P04094-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P04094-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 196, "start_aa": "Asn", "end_pos": 196, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn196", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G49955PK", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 385, "start_aa": "Asn", "end_pos": 385, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn385", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q5FVH2-1" }, { "glytoucan_ac": "G93579XB", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 385, "start_aa": "Asn", "end_pos": 385, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn385", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.1000000.1110000000.110111100111111101.00010.01000", "uniprot_canonical_ac": "Q5FVH2-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 748, "start_aa": "Asn", "end_pos": 748, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn748", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6Q629-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q6Q629-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q6Q629-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q5PPI4-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q5PPI4-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q5PPI4-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P09006-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 122, "start_aa": "Asn", "end_pos": 122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn122", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P27615-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 122, "start_aa": "Asn", "end_pos": 122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn122", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P27615-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q45R42-1" } ], "record_id": "doi.10.1039/D0MO00044B", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 224 }, { "field": "total_sites", "count": 94 }, { "field": "n_linked_sites", "count": 53 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 53 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 38 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 94 }, { "field": "exact_n_linked;o_linked_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycans", "count": 15 }, { "field": "exact_n_linked_sites", "count": 53 }, { "field": "exact_n_linked_glycan_sites", "count": 53 }, { "field": "exact_n_linked_glycans", "count": 38 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 224 }, { "field": "total_sites", "count": 94 }, { "field": "n_linked_sites", "count": 53 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 53 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 38 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 94 }, { "field": "exact_n_linked;o_linked_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycans", "count": 15 }, { "field": "exact_n_linked_sites", "count": 53 }, { "field": "exact_n_linked_glycan_sites", "count": 53 }, { "field": "exact_n_linked_glycans", "count": 38 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thrombospondin-1 activation of signal-regulatory protein-alpha stimulates reactive oxygen species production and promotes renal ischemia reperfusion injury.", "journal": "J. Am. Soc. Nephrol.", "date": "2014", "authors": "Yao Mingyi, Rogers Natasha M, Cs\u00e1nyi G\u00e1bor, Rodriguez Andres I, Ross Mark A, St Croix Claudette, Knupp Heather, Novelli Enrico M, Thomson Angus W, Pagano Patrick J, Isenberg Jeffrey S", "reference": { "type": "PubMed", "id": "24511121", "url": "https://pubmed.ncbi.nlm.nih.gov/24511121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P07996-1", "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24511121", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N-Glycosylation in isolated rat nerve terminals.", "journal": "Molecular omics", "date": "2021", "authors": "Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR", "reference": { "type": "PubMed", "id": "34106099", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, "referenced_glycans": [ { "glytoucan_ac": "G00406II" }, { "glytoucan_ac": "G01367ZS" }, { "glytoucan_ac": "G59471TH" }, { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G89547PG" }, { "glytoucan_ac": "G59626AS" }, { "glytoucan_ac": "G79941IJ" }, { "glytoucan_ac": "G52361ZH" }, { "glytoucan_ac": "G82119TF" }, { "glytoucan_ac": "G82348BZ" }, { "glytoucan_ac": "G82364UA" }, { "glytoucan_ac": "G82942ZJ" }, { "glytoucan_ac": "G42713IF" }, { "glytoucan_ac": "G27622TD" }, { "glytoucan_ac": "G27783SY" }, { "glytoucan_ac": "G71917KP" }, { "glytoucan_ac": "G72667IM" }, { "glytoucan_ac": "G72961RM" }, { "glytoucan_ac": "G73196AS" }, { "glytoucan_ac": "G20297OI" }, { "glytoucan_ac": "G20732FY" }, { "glytoucan_ac": "G20966TZ" }, { "glytoucan_ac": "G95678HJ" }, { "glytoucan_ac": "G95835XS" }, { "glytoucan_ac": "G66538GV" }, { "glytoucan_ac": "G44215PV" }, { "glytoucan_ac": "G44413JJ" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G92050GC" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G12313PD" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G31852PQ" }, { "glytoucan_ac": "G74430RZ" }, { "glytoucan_ac": "G74724QE" }, { "glytoucan_ac": "G74961IU" }, { "glytoucan_ac": "G19379ID" }, { "glytoucan_ac": "G36670VW" }, { "glytoucan_ac": "G37818NZ" }, { "glytoucan_ac": "G27947YN" }, { "glytoucan_ac": "G67324HN" }, { "glytoucan_ac": "G60230HH" }, { "glytoucan_ac": "G60284TY" }, { "glytoucan_ac": "G60923RB" }, { "glytoucan_ac": "G80920RR" }, { "glytoucan_ac": "G80858MF" }, { "glytoucan_ac": "G80966KZ" }, { "glytoucan_ac": "G81198YO" }, { "glytoucan_ac": "G81572SC" }, { "glytoucan_ac": "G05724UK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06374YY" }, { "glytoucan_ac": "G53276NK" }, { "glytoucan_ac": "G53434XO" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G84467IZ" }, { "glytoucan_ac": "G84754BQ" }, { "glytoucan_ac": "G84820NF" }, { "glytoucan_ac": "G98611JV" }, { "glytoucan_ac": "G99679NM" }, { "glytoucan_ac": "G40673VG" }, { "glytoucan_ac": "G40806JH" }, { "glytoucan_ac": "G41044JW" }, { "glytoucan_ac": "G41437NK" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G41247ZX" }, { "glytoucan_ac": "G14994KB" }, { "glytoucan_ac": "G15486FH" }, { "glytoucan_ac": "G33609NS" }, { "glytoucan_ac": "G34730YF" }, { "glytoucan_ac": "G70101JE" }, { "glytoucan_ac": "G70418MS" }, { "glytoucan_ac": "G63628AV" }, { "glytoucan_ac": "G64139XJ" }, { "glytoucan_ac": "G64527OM" }, { "glytoucan_ac": "G56784JY" }, { "glytoucan_ac": "G93579XB" }, { "glytoucan_ac": "G93993PD" }, { "glytoucan_ac": "G94917XT" }, { "glytoucan_ac": "G09406IK" }, { "glytoucan_ac": "G09528DL" }, { "glytoucan_ac": "G49955PK" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G50073PQ" }, { "glytoucan_ac": "G86750HK" }, { "glytoucan_ac": "G87618BG" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G46902YN" }, { "glytoucan_ac": "G03382KH" }, { "glytoucan_ac": "G03595ET" }, { "glytoucan_ac": "G03717EM" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G55982TK" }, { "glytoucan_ac": "G92527PR" }, { "glytoucan_ac": "G92570PJ" }, { "glytoucan_ac": "G00912UN" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G10256JP" }, { "glytoucan_ac": "G10773YW" }, { "glytoucan_ac": "G11115RO" }, { "glytoucan_ac": "G85144OK" }, { "glytoucan_ac": "G30159WR" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G45775XU" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G39213VZ" }, { "glytoucan_ac": "G62765YT" }, { "glytoucan_ac": "G06247RL" }, { "glytoucan_ac": "G23294PN" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G75143LK" }, { "glytoucan_ac": "G17028OG" }, { "glytoucan_ac": "G17264LS" }, { "glytoucan_ac": "G17978LE" }, { "glytoucan_ac": "G31685JQ" }, { "glytoucan_ac": "G31936TA" }, { "glytoucan_ac": "G32072NY" }, { "glytoucan_ac": "G32926LW" }, { "glytoucan_ac": "G68318VE" }, { "glytoucan_ac": "G69148CH" }, { "glytoucan_ac": "G69812OF" }, { "glytoucan_ac": "G69963GQ" }, { "glytoucan_ac": "G61714PI" }, { "glytoucan_ac": "G62592GA" }, { "glytoucan_ac": "G62880PC" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z1Y3-1", "protein_name": "Cadherin-2", "gene_name": "Cdh2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97846-1", "protein_name": "Contactin-associated protein 1", "gene_name": "Cntnap1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97685-1", "protein_name": "Neurofascin", "gene_name": "Nfasc", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P17046-1", "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "Lamp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O88871-1", "protein_name": "Gamma-aminobutyric acid type B receptor subunit 2", "gene_name": "Gabbr2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97829-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "Cd47", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97686-1", "protein_name": "Neuronal cell adhesion molecule", "gene_name": "Nrcam", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P63079-1", "protein_name": "Gamma-aminobutyric acid receptor subunit beta-3", "gene_name": "Gabrb3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05546-1", "protein_name": "Tenascin-R", "gene_name": "Tnr", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P29994-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "Itpr1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63259-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "Ptprn", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q66HD0-1", "protein_name": "Endoplasmin", "gene_name": "Hsp90b1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63564-1", "protein_name": "Synaptic vesicle glycoprotein 2B", "gene_name": "Sv2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P07825-1", "protein_name": "Synaptophysin", "gene_name": "Syp", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P22063-1", "protein_name": "Contactin-2", "gene_name": "Cntn2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P55280-1", "protein_name": "Cadherin-6", "gene_name": "Cdh6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P24268-1", "protein_name": "Cathepsin D", "gene_name": "Ctsd", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6P7S1-1", "protein_name": "Acid ceramidase", "gene_name": "Asah1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JHS6-1", "protein_name": "Acid-sensing ion channel 4", "gene_name": "Asic4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q62682-1", "protein_name": "Contactin-3", "gene_name": "Cntn3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q91XT9-1", "protein_name": "Neutral ceramidase", "gene_name": "Asah2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35795-1", "protein_name": "Ectonucleoside triphosphate diphosphohydrolase 2", "gene_name": "Entpd2; Npdc1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P05371-1", "protein_name": "Clusterin", "gene_name": "Clu", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P14046-1", "protein_name": "Alpha-1-inhibitor 3", "gene_name": "A1i3; Mug5; Mug6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63198-1", "protein_name": "Contactin-1", "gene_name": "Cntn1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P45479-1", "protein_name": "Palmitoyl-protein thioesterase 1", "gene_name": "Ppt1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q62609-1", "protein_name": "Noelin", "gene_name": "Olfm1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P13638-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "Atp1b2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P32736-1", "protein_name": "Opioid-binding protein/cell adhesion molecule", "gene_name": "Opcml", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P46101-1", "protein_name": "A-type potassium channel modulatory protein DPP6", "gene_name": "Dpp6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35112-1", "protein_name": "CD166 antigen", "gene_name": "Alcam", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P01186-1", "protein_name": "Vasopressin-neurophysin 2-copeptin", "gene_name": "Avp", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5FVI4-1", "protein_name": "Cell cycle exit and neuronal differentiation protein 1", "gene_name": "Cend1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q00959-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2A", "gene_name": "Grin2a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P24090-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "Ahsg", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q00960-1", "protein_name": "Glutamate receptor ionotropic, NMDA 2B", "gene_name": "Grin2b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P01830-1", "protein_name": "Thy-1 membrane glycoprotein", "gene_name": "Thy1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63604-1", "protein_name": "BDNF/NT-3 growth factors receptor", "gene_name": "Ntrk2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12346-1", "protein_name": "Serotransferrin", "gene_name": "Tf", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P07340-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "Atp1b1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P06687-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-3", "gene_name": "Atp1a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q794F9-1", "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "Slc3a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05695-1", "protein_name": "Neural cell adhesion molecule L1", "gene_name": "L1cam", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P04094-1", "protein_name": "Proenkephalin-A", "gene_name": "Penk", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P31596-1", "protein_name": "Excitatory amino acid transporter 2", "gene_name": "Slc1a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63633-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "Slc12a5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97546-2", "protein_name": "Neuroplastin", "gene_name": "Nptn", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5FVH2-1", "protein_name": "5'-3' exonuclease PLD3", "gene_name": "Pld3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6Q629-1", "protein_name": "Inactive dipeptidyl peptidase 10", "gene_name": "Dpp10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5PPI4-1", "protein_name": "Lysosome-associated membrane glycoprotein 5", "gene_name": "Lamp5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P09006-1", "protein_name": "Serine protease inhibitor A3N", "gene_name": "Serpina3n", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P27615-1", "protein_name": "Lysosome membrane protein 2", "gene_name": "Scarb2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q45R42-1", "protein_name": "Leucine-rich repeat-containing protein 4", "gene_name": "Lrrc4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97710-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9Z1Y3-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9Z1Y3-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 277, "start_aa": "Asn", "end_pos": 277, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn277", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97846-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1015, "start_aa": "Asn", "end_pos": 1015, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1015", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1015, "start_aa": "Asn", "end_pos": 1015, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1015", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 305, "start_aa": "Asn", "end_pos": 305, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn305", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 866, "start_aa": "Asn", "end_pos": 866, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn866", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 881, "start_aa": "Asn", "end_pos": 881, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn881", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 881, "start_aa": "Asn", "end_pos": 881, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn881", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 881, "start_aa": "Asn", "end_pos": 881, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn881", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97685-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P17046-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "O88871-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 34, "start_aa": "Asn", "end_pos": 34, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn34", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P97829-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 223, "start_aa": "Asn", "end_pos": 223, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn223", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 314, "start_aa": "Asn", "end_pos": 314, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn314", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 507, "start_aa": "Asn", "end_pos": 507, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn507", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 858, "start_aa": "Asn", "end_pos": 858, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn858", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 993, "start_aa": "Asn", "end_pos": 993, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn993", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 993, "start_aa": "Asn", "end_pos": 993, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn993", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P97686-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 105, "start_aa": "Asn", "end_pos": 105, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn105", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P63079-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 580, "start_aa": "Asn", "end_pos": 580, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn580", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q05546-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2504, "start_aa": "Asn", "end_pos": 2504, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2504", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P29994-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 528, "start_aa": "Asn", "end_pos": 528, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn528", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63259-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q66HD0-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q66HD0-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 441, "start_aa": "Asn", "end_pos": 441, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn441", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 441, "start_aa": "Asn", "end_pos": 441, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn441", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 441, "start_aa": "Asn", "end_pos": 441, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn441", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 516, "start_aa": "Asn", "end_pos": 516, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn516", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 516, "start_aa": "Asn", "end_pos": 516, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn516", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q63564-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G95835XS", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0010000.1110100000.010001000001111100.00100.01000", "uniprot_canonical_ac": "P07825-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 463, "start_aa": "Asn", "end_pos": 463, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn463", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P22063-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P22063-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 399, "start_aa": "Asn", "end_pos": 399, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn399", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P55280-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 399, "start_aa": "Asn", "end_pos": 399, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn399", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P55280-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24268-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24268-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24268-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Asn", "end_pos": 258, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn258", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6P7S1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 243, "start_aa": "Asn", "end_pos": 243, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn243", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9JHS6-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q62682-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 668, "start_aa": "Asn", "end_pos": 668, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn668", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q91XT9-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O35795-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 327, "start_aa": "Asn", "end_pos": 327, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn327", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P05371-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 327, "start_aa": "Asn", "end_pos": 327, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn327", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P05371-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 393, "start_aa": "Asn", "end_pos": 393, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn393", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P14046-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 994, "start_aa": "Asn", "end_pos": 994, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn994", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P14046-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 473, "start_aa": "Asn", "end_pos": 473, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn473", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 593, "start_aa": "Asn", "end_pos": 593, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn593", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 935, "start_aa": "Asn", "end_pos": 935, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn935", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 935, "start_aa": "Asn", "end_pos": 935, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn935", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63198-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P45479-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P45479-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P45479-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q62609-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q62609-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q62609-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G53434XO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 118, "start_aa": "Asn", "end_pos": 118, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn118", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 159, "start_aa": "Asn", "end_pos": 159, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn159", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Asn", "end_pos": 96, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn96", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Asn", "end_pos": 96, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn96", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13638-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01000", "uniprot_canonical_ac": "P32736-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 313, "start_aa": "Asn", "end_pos": 313, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn313", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 313, "start_aa": "Asn", "end_pos": 313, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn313", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P46101-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 167, "start_aa": "Asn", "end_pos": 167, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn167", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O35112-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 167, "start_aa": "Asn", "end_pos": 167, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn167", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "O35112-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 480, "start_aa": "Asn", "end_pos": 480, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn480", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O35112-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 135, "start_aa": "Asn", "end_pos": 135, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn135", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01186-1" }, { "glytoucan_ac": "G82364UA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 73, "start_aa": "Asn", "end_pos": 73, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn73", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100101111101.00010.01000", "uniprot_canonical_ac": "Q5FVI4-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 444, "start_aa": "Asn", "end_pos": 444, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn444", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q00959-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P24090-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 341, "start_aa": "Asn", "end_pos": 341, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn341", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 348, "start_aa": "Asn", "end_pos": 348, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn348", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 348, "start_aa": "Asn", "end_pos": 348, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn348", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 444, "start_aa": "Asn", "end_pos": 444, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn444", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 688, "start_aa": "Asn", "end_pos": 688, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn688", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 74, "start_aa": "Asn", "end_pos": 74, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn74", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q00960-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G53434XO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G27622TD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01830-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 254, "start_aa": "Asn", "end_pos": 254, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn254", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 254, "start_aa": "Asn", "end_pos": 254, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn254", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 95, "start_aa": "Asn", "end_pos": 95, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn95", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q63604-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 512, "start_aa": "Asn", "end_pos": 512, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn512", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P12346-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G72961RM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000001.000011000001101101.00010.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P07340-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 473, "start_aa": "Asn", "end_pos": 473, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn473", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01000", "uniprot_canonical_ac": "P06687-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G81572SC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000000101000.00100.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 166, "start_aa": "Asn", "end_pos": 166, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn166", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 263, "start_aa": "Asn", "end_pos": 263, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn263", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q794F9-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1072, "start_aa": "Asn", "end_pos": 1072, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1072", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 968, "start_aa": "Asn", "end_pos": 968, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn968", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 968, "start_aa": "Asn", "end_pos": 968, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn968", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 968, "start_aa": "Asn", "end_pos": 968, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn968", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 978, "start_aa": "Asn", "end_pos": 978, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn978", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q05695-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P04094-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P04094-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G09406IK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01000", "uniprot_canonical_ac": "P31596-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01000", "uniprot_canonical_ac": "Q63633-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 196, "start_aa": "Asn", "end_pos": 196, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn196", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G49955PK", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P97546-2" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 385, "start_aa": "Asn", "end_pos": 385, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn385", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q5FVH2-1" }, { "glytoucan_ac": "G93579XB", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 385, "start_aa": "Asn", "end_pos": 385, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn385", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.1000000.1110000000.110111100111111101.00010.01000", "uniprot_canonical_ac": "Q5FVH2-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 748, "start_aa": "Asn", "end_pos": 748, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn748", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6Q629-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q6Q629-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q6Q629-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q5PPI4-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q5PPI4-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q5PPI4-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P09006-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 122, "start_aa": "Asn", "end_pos": 122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn122", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P27615-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 122, "start_aa": "Asn", "end_pos": 122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn122", "evidence": [ { "id": "24090084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24090084" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P27615-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "34106099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34106099" }, { "id": "GLY_000221", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000221" }, { "id": "10.1039/D0MO00044B", "database": "DOI", "url": "https://doi.org/10.1039/D0MO00044B" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q45R42-1" } ], "record_id": "pubmed.34106099", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 130 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 224 }, { "field": "total_sites", "count": 94 }, { "field": "n_linked_sites", "count": 53 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 53 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 38 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 94 }, { "field": "exact_n_linked;o_linked_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycans", "count": 15 }, { "field": "exact_n_linked_sites", "count": 53 }, { "field": "exact_n_linked_glycan_sites", "count": 53 }, { "field": "exact_n_linked_glycans", "count": 38 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 224 }, { "field": "total_sites", "count": 94 }, { "field": "n_linked_sites", "count": 53 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 53 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 38 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 94 }, { "field": "exact_n_linked;o_linked_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 59 }, { "field": "exact_n_linked;o_linked_glycans", "count": 15 }, { "field": "exact_n_linked_sites", "count": 53 }, { "field": "exact_n_linked_glycan_sites", "count": 53 }, { "field": "exact_n_linked_glycans", "count": 38 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel membrane glycoprotein, SHPS-1, that binds the SH2-domain-containing protein tyrosine phosphatase SHP-2 in response to mitogens and cell adhesion.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Fujioka Y, Matozaki T, Noguchi T, Iwamatsu A, Yamao T, Takahashi N, Tsuda M, Takada T, Kasuga M", "reference": { "type": "PubMed", "id": "8943344", "url": "https://pubmed.ncbi.nlm.nih.gov/8943344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8943344", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BIT, an immune antigen receptor-like molecule in the brain.", "journal": "FEBS letters", "date": "1997", "authors": "Sano S, Ohnishi H, Omori A, Hasegawa J, Kubota M", "reference": { "type": "PubMed", "id": "9271230", "url": "https://pubmed.ncbi.nlm.nih.gov/9271230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9271230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epidermal growth factor stimulates the tyrosine phosphorylation of SHPS-1 and association of SHPS-1 with SHP-2, a SH2 domain-containing protein tyrosine phosphatase.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Ochi F, Matozaki T, Noguchi T, Fujioka Y, Yamao T, Takada T, Tsuda M, Takeda H, Fukunaga K, Okabayashi Y, Kasuga M", "reference": { "type": "PubMed", "id": "9344856", "url": "https://pubmed.ncbi.nlm.nih.gov/9344856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9344856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Roles of the complex formation of SHPS-1 with SHP-2 in insulin-stimulated mitogen-activated protein kinase activation.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Takada T, Matozaki T, Takeda H, Fukunaga K, Noguchi T, Fujioka Y, Okazaki I, Tsuda M, Yamao T, Ochi F, Kasuga M", "reference": { "type": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 436, "end_pos": 436, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes tyrosine phosphorylation and PTPN11 binding; when associated with F-460; F-477 and F-501.", "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" }, { "database": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" } ], "uniprot_canonical_ac": "P97710-1" }, { "start_pos": 460, "end_pos": 460, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes tyrosine phosphorylation and PTPN11 binding; when associated with F-436; F-477 and F-501.", "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" }, { "database": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" } ], "uniprot_canonical_ac": "P97710-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "Y", "sequence_mut": "F", "comment": "Strongly reduces insulin-induced tyrosine phosphorylation and PTPN11 binding. Abolishes tyrosine phosphorylation and PTPN11 binding; when associated with F-436; F-460 and F-501.", "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" }, { "database": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" } ], "uniprot_canonical_ac": "P97710-1" }, { "start_pos": 501, "end_pos": 501, "sequence_org": "Y", "sequence_mut": "F", "comment": "Strongly reduces insulin-induced tyrosine phosphorylation and PTPN11 binding. Abolishes tyrosine phosphorylation and PTPN11 binding; when associated with F-436; F-460 and F-477.", "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" }, { "database": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" } ], "uniprot_canonical_ac": "P97710-1" } ], "phosphorylation": [ { "start_pos": 477, "end_pos": 477, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by Tyr-kinases", "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" }, { "database": "IntAct", "id": "P97710", "url": "https://www.ebi.ac.uk/intact/interactors/id:P97710*" }, { "database": "iPTMnet", "id": "P97710", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97710" }, { "database": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" } ], "site_lbl": "Tyr477", "uniprot_canonical_ac": "P97710-1" }, { "start_pos": 501, "end_pos": 501, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by Tyr-kinases", "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" }, { "database": "IntAct", "id": "P97710", "url": "https://www.ebi.ac.uk/intact/interactors/id:P97710*" }, { "database": "iPTMnet", "id": "P97710", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P97710" }, { "database": "PubMed", "id": "9535915", "url": "https://pubmed.ncbi.nlm.nih.gov/9535915" } ], "site_lbl": "Tyr501", "uniprot_canonical_ac": "P97710-1" } ], "record_id": "pubmed.9535915", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signal-regulatory protein is selectively expressed by myeloid and neuronal cells.", "journal": "J. Immunol.", "date": "1998", "authors": "Adams S, van der Laan L J, Vernon-Wilson E, Renardel de Lavalette C, D\u00f6pp E A, Dijkstra C D, Simmons D L, van den Berg T K", "reference": { "type": "PubMed", "id": "9712053", "url": "https://pubmed.ncbi.nlm.nih.gov/9712053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9712053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MFR, a putative receptor mediating the fusion of macrophages.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Saginario C, Sterling H, Beckers C, Kobayashi R, Solimena M, Ullu E, Vignery A", "reference": { "type": "PubMed", "id": "9774638", "url": "https://pubmed.ncbi.nlm.nih.gov/9774638" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97710-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "Sirpa", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97710", "url": "https://www.uniprot.org/uniprotkb/P97710" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9774638", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of 11 pseudogenes in the DNA methyltransferase gene family in rodents and humans and implications for the functional loci.", "journal": "Genomics", "date": "2004", "authors": "Lees-Murdock Diane J, McLoughlin Gerard A, McDaid Jennifer R, Quinn Lisa M, O'Doherty Alan, Hiripi L\u00e1szl\u00f3, Hack Catherine J, Walsh Colum P", "reference": { "type": "PubMed", "id": "15203217", "url": "https://pubmed.ncbi.nlm.nih.gov/15203217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ53-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "Dnmt3a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q1LZ50-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3-like", "gene_name": "Dnmt3l", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ53", "url": "https://www.uniprot.org/uniprotkb/Q1LZ53" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15203217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA Methyltransferase 3A Is Involved in the Sustained Effects of Chronic Stress on Synaptic Functions and Behaviors.", "journal": "Cerebral cortex (New York, N.Y. : 1991)", "date": "2021", "authors": "Wei J, Cheng J, Waddell NJ, Wang ZJ, Pang X, Cao Q, Liu A, Chitaman JM, Abreu K, Jasrotia RS, Duffney LJ, Zhang J, Dietz DM, Feng J, Yan Z", "reference": { "type": "PubMed", "id": "33230530", "url": "https://pubmed.ncbi.nlm.nih.gov/33230530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ53-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "Dnmt3a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ53", "url": "https://www.uniprot.org/uniprotkb/Q1LZ53" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33230530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Epigenetic Interactions between MicroRNA-30c-5p and DNA Methyltransferases in Neuropathic Pain.", "journal": "International journal of molecular sciences", "date": "2022-11-13", "authors": "Franc\u00e9s Raquel, Mata-Garrido Jorge, de la Fuente Roberto, Carcel\u00e9n Mar\u00eda, Lafarga Miguel, Berciano Mar\u00eda Teresa, Garc\u00eda Raquel, Hurl\u00e9 Mar\u00eda A, Tramullas M\u00f3nica", "reference": { "type": "PubMed", "id": "36430472", "url": "https://pubmed.ncbi.nlm.nih.gov/36430472" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ53-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "Dnmt3a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ53", "url": "https://www.uniprot.org/uniprotkb/Q1LZ53" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.36430472", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "POU2F1/DNMT3a Pathway Participates in Neuropathic Pain by Hypermethylation-Mediated LRFN4 Downregulation Following Oxaliplatin Treatment.", "journal": "Neurochemical research", "date": "2023-08-18", "authors": "Gu Yan-Hui, Wang Jing, Lu Wei-Cheng, Cheng Yong, Tao Rong, Zhang Shi-Jia, Xu Ting, Zhai Ke-Wei, Luo Su-Xia, Xin Wen-Jun", "reference": { "type": "PubMed", "id": "37592110", "url": "https://pubmed.ncbi.nlm.nih.gov/37592110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ53-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "Dnmt3a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P31503-1", "protein_name": "POU domain, class 2, transcription factor 1", "gene_name": "Pou2f1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "D4ABX8-1", "protein_name": "Leucine-rich repeat and fibronectin type-III domain-containing protein 4", "gene_name": "Lrfn4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ53", "url": "https://www.uniprot.org/uniprotkb/Q1LZ53" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37592110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-199a-3p mediates bone cancer pain through upregulation of dnmt3a expression in spinal dorsal horn neurons.", "journal": "Biochemical and biophysical research communications", "date": "2023-11-19", "authors": "Kuang Jiao, Xu Miao, Xu Chengfei, Wang Yahui, Ni Chaobo, Wei Shirong, Liu Zhihao, Kong Min, Zhou Qinghe, Yao Ming, Ni Huadong", "reference": { "type": "PubMed", "id": "37804593", "url": "https://pubmed.ncbi.nlm.nih.gov/37804593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ53-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "Dnmt3a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ53", "url": "https://www.uniprot.org/uniprotkb/Q1LZ53" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37804593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNMT3a-mediated methylation of PPAR\u03b3 promote intervertebral disc degeneration by regulating the NF-\u03baB pathway.", "journal": "Journal of cellular and molecular medicine", "date": "2024-01", "authors": "Cheng Peng, Wei Hang-Zhi, Chen Hai-Wei, Wang Zhi-Qiang, Mao Peng, Zhang Hai-Hong", "reference": { "type": "PubMed", "id": "37986543", "url": "https://pubmed.ncbi.nlm.nih.gov/37986543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ53-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "Dnmt3a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O88275-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "Pparg", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ53", "url": "https://www.uniprot.org/uniprotkb/Q1LZ53" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.37986543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct myoprotective roles of cardiac sarcolemmal and mitochondrial KATP channels during metabolic inhibition and recovery.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2001", "authors": "Light PE, Kanji HD, Fox JE, French RJ", "reference": { "type": "PubMed", "id": "11726534", "url": "https://pubmed.ncbi.nlm.nih.gov/11726534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11726534", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altered KATP Channel Subunits Expression and Vascular Reactivity in Spontaneously Hypertensive Rats With Age.", "journal": "Journal of cardiovascular pharmacology", "date": "2016", "authors": "Liu X, Duan P, Hu X, Li R, Zhu Q", "reference": { "type": "PubMed", "id": "27035370", "url": "https://pubmed.ncbi.nlm.nih.gov/27035370" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27035370", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conserved functional consequences of disease-associated mutations in the slide helix of Kir6.1 and Kir6.2 subunits of the ATP-sensitive potassium channel.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Cooper PE, McClenaghan C, Chen X, Stary-Weinzinger A, Nichols CG", "reference": { "type": "PubMed", "id": "28842488", "url": "https://pubmed.ncbi.nlm.nih.gov/28842488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70673-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 11", "gene_name": "Kcnj11", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q14654-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 11", "gene_name": "KCNJ11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15842-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "KCNJ8", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 64, "end_pos": 64, "sequence_org": "V", "sequence_mut": "M", "comment": "Displays gain of function; increased open state stability, reduced ATP sensitivity and increased channel activity; almost completely abolishes high affinity sensitivity to glibenclamide, an inhibitor of ATP-sensitive potassium channels.", "evidence": [ { "database": "UniProtKB", "id": "Q14654", "url": "https://www.uniprot.org/uniprotkb/Q14654" }, { "database": "PubMed", "id": "28842488", "url": "https://pubmed.ncbi.nlm.nih.gov/28842488" } ], "uniprot_canonical_ac": "Q14654-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "V", "sequence_mut": "L", "comment": "No effect on channel activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15842", "url": "https://www.uniprot.org/uniprotkb/Q15842" }, { "database": "PubMed", "id": "28842488", "url": "https://pubmed.ncbi.nlm.nih.gov/28842488" } ], "uniprot_canonical_ac": "Q15842-1" } ], "record_id": "pubmed.28842488", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial ATP-sensitive potassium channel regulates mitochondrial dynamics to participate in neurodegeneration of Parkinson's disease.", "journal": "Biochimica et biophysica acta. Molecular basis of disease", "date": "2018", "authors": "Peng K, Hu J, Xiao J, Dan G, Yang L, Ye F, Zou Z, Cao J, Sai Y", "reference": { "type": "PubMed", "id": "29353068", "url": "https://pubmed.ncbi.nlm.nih.gov/29353068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29353068", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KATP Opener Attenuates Diabetic-Induced Muller Gliosis and Inflammation by Modulating Kir6.1 in Microglia.", "journal": "Investigative ophthalmology & visual science", "date": "2021", "authors": "Li H, Chen D, Sun W, Chen J, Luo C, Xu H, Ma JH, Tang S", "reference": { "type": "PubMed", "id": "33523201", "url": "https://pubmed.ncbi.nlm.nih.gov/33523201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33523201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterisation of functional Kir6.1-containing ATP-sensitive potassium channels in the cardiac ventricular sarcolemmal membrane.", "journal": "British journal of pharmacology", "date": "2024-09", "authors": "Brennan Sean, Chen Shen, Makwana Samir, Esposito Simona, McGuinness Lauren R, Alnaimi Abrar I M, Sims Mark W, Patel Manish, Aziz Qadeer, Ojake Leona, Roberts James A, Sharma Parveen, Lodwick David, Tinker Andrew, Barrett-Jolley Richard, Dart Caroline, Rainbow Richard D", "reference": { "type": "PubMed", "id": "38763521", "url": "https://pubmed.ncbi.nlm.nih.gov/38763521" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.38763521", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and functional characterization of a novel ATP-sensitive potassium channel ubiquitously expressed in rat tissues, including pancreatic islets, pituitary, skeletal muscle, and heart.", "journal": "The Journal of biological chemistry", "date": "1995-03-17", "authors": "Inagaki N, Tsuura Y, Namba N, Masuda K, Gonoi T, Horie M, Seino Y, Mizuta M, Seino S", "reference": { "type": "PubMed", "id": "7890693", "url": "https://pubmed.ncbi.nlm.nih.gov/7890693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63664-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 8", "gene_name": "Kcnj8", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63664", "url": "https://www.uniprot.org/uniprotkb/Q63664" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7890693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting.", "journal": "Neuron", "date": "2002", "authors": "Wyszynski M, Kim E, Dunah AW, Passafaro M, Valtschanoff JG, Serra-Pages C, Streuli M, Weinberg RJ, Sheng M", "reference": { "type": "PubMed", "id": "11931740", "url": "https://pubmed.ncbi.nlm.nih.gov/11931740" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q91Z80-1", "protein_name": "Liprin-alpha-4", "gene_name": "Ppfia4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97879-1", "protein_name": "Glutamate receptor-interacting protein 1", "gene_name": "Grip1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q91Z80", "url": "https://www.uniprot.org/uniprotkb/Q91Z80" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11931740", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of the kinesin motor KIF1A with the multimodular protein liprin-alpha.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Shin H, Wyszynski M, Huh KH, Valtschanoff JG, Lee JR, Ko J, Streuli M, Weinberg RJ, Sheng M, Kim E", "reference": { "type": "PubMed", "id": "12522103", "url": "https://pubmed.ncbi.nlm.nih.gov/12522103" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q91Z80-1", "protein_name": "Liprin-alpha-4", "gene_name": "Ppfia4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q91Z80", "url": "https://www.uniprot.org/uniprotkb/Q91Z80" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12522103", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between liprin-alpha and GIT1 is required for AMPA receptor targeting.", "journal": "J. Neurosci.", "date": "2003", "authors": "Ko J, Kim S, Valtschanoff JG, Shin H, Lee JR, Sheng M, Premont RT, Weinberg RJ, Kim E", "reference": { "type": "PubMed", "id": "12629171", "url": "https://pubmed.ncbi.nlm.nih.gov/12629171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q91Z80-1", "protein_name": "Liprin-alpha-4", "gene_name": "Ppfia4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q66H91-1", "protein_name": "ARF GTPase-activating protein GIT2", "gene_name": "Git2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z272-1", "protein_name": "ARF GTPase-activating protein GIT1", "gene_name": "Git1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q91Z80", "url": "https://www.uniprot.org/uniprotkb/Q91Z80" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12629171", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NKIATRE is a novel conserved cdc2-related kinase.", "journal": "Genomics", "date": "2001", "authors": "Haq R, Randall S, Midmer M, Yee K, Zanke B", "reference": { "type": "PubMed", "id": "11161806", "url": "https://pubmed.ncbi.nlm.nih.gov/11161806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JM01-1", "protein_name": "Cyclin-dependent kinase-like 3", "gene_name": "Cdkl3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JM01", "url": "https://www.uniprot.org/uniprotkb/Q9JM01" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11161806", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altered gene expression of Na+/Ca2+ exchanger isoforms NCX1, NCX2 and NCX3 in chronic ischemic rat brain.", "journal": "Neuroscience letters", "date": "2002", "authors": "Lu J, Tong XY, Wang XL", "reference": { "type": "PubMed", "id": "12377375", "url": "https://pubmed.ncbi.nlm.nih.gov/12377375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70549-1", "protein_name": "Sodium/calcium exchanger 3", "gene_name": "Slc8a3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12377375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sodium-calcium exchanger NCX1, NCX2, and NCX3 transcripts in developing rat brain.", "journal": "Annals of the New York Academy of Sciences", "date": "2002", "authors": "Polumuri SK, Ruknudin A, McCarthy MM, Perrot-Sinal TS, Schulze DH", "reference": { "type": "PubMed", "id": "12502534", "url": "https://pubmed.ncbi.nlm.nih.gov/12502534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12502534", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cellular and subcellular localization of Na+-Ca2+ exchanger protein isoforms, NCX1, NCX2, and NCX3 in cerebral cortex and hippocampus of adult rat.", "journal": "Cell Calcium", "date": "2007", "authors": "Minelli Andrea, Castaldo Pasqualina, Gobbi Pietro, Salucci Sara, Magi Simona, Amoroso Salvatore", "reference": { "type": "PubMed", "id": "16914199", "url": "https://pubmed.ncbi.nlm.nih.gov/16914199" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70549-1", "protein_name": "Sodium/calcium exchanger 3", "gene_name": "Slc8a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q01728-1", "protein_name": "Sodium/calcium exchanger 1", "gene_name": "Slc8a1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.16914199", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-based dynamic arrays in regulatory domains of sodium-calcium exchanger (NCX) isoforms.", "journal": "Scientific reports", "date": "2017", "authors": "Giladi M, Lee SY, Ariely Y, Teldan Y, Granit R, Strulovich R, Haitin Y, Chung KY, Khananshvili D", "reference": { "type": "PubMed", "id": "28428550", "url": "https://pubmed.ncbi.nlm.nih.gov/28428550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70549-1", "protein_name": "Sodium/calcium exchanger 3", "gene_name": "Slc8a3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28428550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of the promoter and transcription factors regulating the expression of cerebral sodium/calcium exchanger 2 (NCX2) gene.", "journal": "Cell calcium", "date": "2022", "authors": "Calabrese L, Serani A, Natale S, Tedeschi V, Guida N, Valsecchi V, Secondo A, Formisano L, Annunziato L, Molinaro P", "reference": { "type": "PubMed", "id": "35114589", "url": "https://pubmed.ncbi.nlm.nih.gov/35114589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35114589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sodium-Calcium Exchanger 2: A Pivotal Role in Oxaliplatin Induced Peripheral Neurotoxicity and Axonal Damage?", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Ballarini E, Malacrida A, Rodriguez-Menendez V, Pozzi E, Canta A, Chiorazzi A, Monza L, Semperboni S, Meregalli C, Carozzi VA, Hashemi M, Nicolini G, Scuteri A, Housley SN, Cavaletti G, Alberti P", "reference": { "type": "PubMed", "id": "36077454", "url": "https://pubmed.ncbi.nlm.nih.gov/36077454" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8K596-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.36077454", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a third mammalian Na+-Ca2+ exchanger, NCX3.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Nicoll DA, Quednau BD, Qui Z, Xia YR, Lusis AJ, Philipson KD", "reference": { "type": "PubMed", "id": "8798769", "url": "https://pubmed.ncbi.nlm.nih.gov/8798769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70549-1", "protein_name": "Sodium/calcium exchanger 3", "gene_name": "Slc8a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q01728-1", "protein_name": "Sodium/calcium exchanger 1", "gene_name": "Slc8a1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8798769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional comparison of the three isoforms of the Na+/Ca2+ exchanger (NCX1, NCX2, NCX3).", "journal": "The American journal of physiology", "date": "1998", "authors": "Linck B, Qiu Z, He Z, Tong Q, Hilgemann DW, Philipson KD", "reference": { "type": "PubMed", "id": "9486131", "url": "https://pubmed.ncbi.nlm.nih.gov/9486131" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48768-1", "protein_name": "Sodium/calcium exchanger 2", "gene_name": "Slc8a2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70549-1", "protein_name": "Sodium/calcium exchanger 3", "gene_name": "Slc8a3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48768", "url": "https://www.uniprot.org/uniprotkb/P48768" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9486131", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rat sn-glycerol-3-phosphate acyltransferase: molecular cloning and characterization of the cDNA and expressed protein.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Ganesh Bhat B, Wang P, Kim JH, Black TM, Lewin TM, Fiedorek FT Jr, Coleman RA", "reference": { "type": "PubMed", "id": "10446428", "url": "https://pubmed.ncbi.nlm.nih.gov/10446428" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97564-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "Gpam", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97564", "url": "https://www.uniprot.org/uniprotkb/P97564" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10446428", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of two transmembrane regions and a cytosolic domain of rat mitochondrial glycerophosphate acyltransferase.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Balija VS, Chakraborty TR, Nikonov AV, Morimoto T, Haldar D", "reference": { "type": "PubMed", "id": "10924502", "url": "https://pubmed.ncbi.nlm.nih.gov/10924502" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97564-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "Gpam", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97564", "url": "https://www.uniprot.org/uniprotkb/P97564" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10924502", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coordinate regulation of malonyl-CoA decarboxylase, sn-glycerol-3-phosphate acyltransferase, and acetyl-CoA carboxylase by AMP-activated protein kinase in rat tissues in response to exercise.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Park H, Kaushik VK, Constant S, Prentki M, Przybytkowski E, Ruderman NB, Saha AK", "reference": { "type": "PubMed", "id": "12065578", "url": "https://pubmed.ncbi.nlm.nih.gov/12065578" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97564-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "Gpam", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97564", "url": "https://www.uniprot.org/uniprotkb/P97564" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12065578", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Casein kinase II stimulates rat liver mitochondrial glycerophosphate acyltransferase activity.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Onorato TM, Haldar D", "reference": { "type": "PubMed", "id": "12207885", "url": "https://pubmed.ncbi.nlm.nih.gov/12207885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97564-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "Gpam", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97564", "url": "https://www.uniprot.org/uniprotkb/P97564" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12207885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional regulation of mitochondrial glycerophosphate acyltransferase is mediated by distal promoter via ChREBP and SREBP-1.", "journal": "Archives of biochemistry and biophysics", "date": "2009", "authors": "Guha P, Aneja KK, Shilpi RY, Haldar D", "reference": { "type": "PubMed", "id": "19682972", "url": "https://pubmed.ncbi.nlm.nih.gov/19682972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P97564-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "Gpam", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P97564", "url": "https://www.uniprot.org/uniprotkb/P97564" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19682972", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Astrocytes increase exosomal secretion of oligodendrocyte precursor cells to promote their proliferation via integrin beta4-mediated cell adhesion.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Zhang W, Zhang X, Zhang L, Xu D, Cheng N, Tang Y, Peng Y", "reference": { "type": "PubMed", "id": "32220495", "url": "https://pubmed.ncbi.nlm.nih.gov/32220495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q64632-1", "protein_name": "Integrin beta-4", "gene_name": "Itgb4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q64632", "url": "https://www.uniprot.org/uniprotkb/Q64632" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32220495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and sequence of the cDNA encoding the beta 4 integrin subunit in rat peripheral nerve.", "journal": "Gene", "date": "1997", "authors": "Feltri ML, Arona M, Scherer SS, Wrabetz L", "reference": { "type": "PubMed", "id": "9074510", "url": "https://pubmed.ncbi.nlm.nih.gov/9074510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q64632-1", "protein_name": "Integrin beta-4", "gene_name": "Itgb4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q64632", "url": "https://www.uniprot.org/uniprotkb/Q64632" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9074510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fine-mapping and comprehensive transcript analysis reveals nonsynonymous variants within a novel 1.17 Mb blood pressure QTL region on rat chromosome 10.", "journal": "Genomics", "date": "2007", "authors": "Saad Y, Garrett MR, Manickavasagam E, Yerga-Woolwine S, Farms P, Radecki T, Joe B", "reference": { "type": "PubMed", "id": "17218081", "url": "https://pubmed.ncbi.nlm.nih.gov/17218081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A1EC95-1", "protein_name": "HEAT repeat-containing protein 6", "gene_name": "Heatr6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9JKC9-1", "protein_name": "Synergin gamma", "gene_name": "Synrg", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6AYE3-1", "protein_name": "Transcriptional adapter 2-alpha", "gene_name": "Tada2a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P50230-1", "protein_name": "C-C motif chemokine 4", "gene_name": "Ccl4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P50229-1", "protein_name": "C-C motif chemokine 3", "gene_name": "Ccl3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q68FP3-1", "protein_name": "C-C motif chemokine 6", "gene_name": "Ccl6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11497-1", "protein_name": "Acetyl-CoA carboxylase 1", "gene_name": "Acaca", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A1EC95", "url": "https://www.uniprot.org/uniprotkb/A1EC95" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.17218081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MEF2C DNA-binding activity is inhibited through its interaction with the regulatory protein Ki-1/57.", "journal": "FEBS letters", "date": "2005", "authors": "Kobarg CB, Kobarg J, Crosara-Alberto DP, Theizen TH, Franchini KG", "reference": { "type": "PubMed", "id": "15862299", "url": "https://pubmed.ncbi.nlm.nih.gov/15862299" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A1L1K8-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "Habp4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "A0A096MJY4-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "Mef2c", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5JVS0-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "HABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A1L1K8", "url": "https://www.uniprot.org/uniprotkb/A1L1K8" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15862299", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of the myosin X PH1(N)-PH2-PH1(C) tandem as a specific and acute cellular PI(3,4,5)P(3) sensor.", "journal": "Molecular biology of the cell", "date": "2011-11", "authors": "Lu Qing, Yu Jiang, Yan Jing, Wei Zhiyi, Zhang Mingjie", "reference": { "type": "PubMed", "id": "21965296", "url": "https://pubmed.ncbi.nlm.nih.gov/21965296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "D3ZJP6-1", "protein_name": "Unconventional myosin-X", "gene_name": "Myo10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D3ZJP6", "url": "https://www.uniprot.org/uniprotkb/D3ZJP6" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.21965296", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the linker histone H1 as a protein kinase Cepsilon-binding protein in vascular smooth muscle.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2004", "authors": "Zhao M, Sutherland C, Wilson DP, Deng J, Macdonald JA, Walsh MP", "reference": { "type": "PubMed", "id": "15499382", "url": "https://pubmed.ncbi.nlm.nih.gov/15499382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "D4A3K5-1", "protein_name": "Histone H1.1", "gene_name": "H1-1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A3K5", "url": "https://www.uniprot.org/uniprotkb/D4A3K5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15499382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of histone H1 to DNA is differentially modulated by redox state of HMGB1.", "journal": "PloS one", "date": "2014", "authors": "Polanska E, Pospisilova S, Stros M", "reference": { "type": "PubMed", "id": "24551219", "url": "https://pubmed.ncbi.nlm.nih.gov/24551219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "D4A3K5-1", "protein_name": "Histone H1.1", "gene_name": "H1-1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P63159-1", "protein_name": "High mobility group protein B1", "gene_name": "Hmgb1l2; Hmgb1; LOC134483981", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "D4A3K5", "url": "https://www.uniprot.org/uniprotkb/D4A3K5" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24551219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]