[ { "title": "Molecular pharmacological phenotyping of EBI2. An orphan seven-transmembrane receptor with constitutive activity.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Rosenkilde MM, Benned-Jensen T, Andersen H, Holst PJ, Kledal TN, Luttichau HR, Larsen JK, Christensen JP, Schwartz TW", "reference": { "type": "PubMed", "id": "16540462", "url": "https://pubmed.ncbi.nlm.nih.gov/16540462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16540462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a human cDNA that encodes a functional receptor for platelet activating factor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Ye RD, Prossnitz ER, Zou AH, Cochrane CG", "reference": { "type": "PubMed", "id": "1656963", "url": "https://pubmed.ncbi.nlm.nih.gov/1656963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1656963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kynurenic acid as a ligand for orphan G protein-coupled receptor GPR35.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wang J, Simonavicius N, Wu X, Swaminath G, Reagan J, Tian H, Ling L", "reference": { "type": "PubMed", "id": "16754668", "url": "https://pubmed.ncbi.nlm.nih.gov/16754668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ES90-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "Gpr35", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16754668", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of N-arachidonylglycine as the endogenous ligand for orphan G-protein-coupled receptor GPR18.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Kohno M, Hasegawa H, Inoue A, Muraoka M, Miyazaki T, Oka K, Yasukawa M", "reference": { "type": "PubMed", "id": "16844083", "url": "https://pubmed.ncbi.nlm.nih.gov/16844083" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16844083", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The emerging role of cannabinoid neuromodulators in symptom management.", "journal": "Supportive care in cancer : official journal of the Multinational Association of Supportive Care in Cancer", "date": "2007", "authors": "Davis M, Maida V, Daeninck P, Pergolizzi J", "reference": { "type": "PubMed", "id": "17139494", "url": "https://pubmed.ncbi.nlm.nih.gov/17139494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17139494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Resolvin E1 selectively interacts with leukotriene B4 receptor BLT1 and ChemR23 to regulate inflammation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Arita M, Ohira T, Sun YP, Elangovan S, Chiang N, Serhan CN", "reference": { "type": "PubMed", "id": "17339491", "url": "https://pubmed.ncbi.nlm.nih.gov/17339491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17339491", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Previously postulated `ligand-independent` signaling of GPR4 is mediated through proton-sensing mechanisms.", "journal": "Cellular signalling", "date": "2007", "authors": "Tobo M, Tomura H, Mogi C, Wang JQ, Liu JP, Komachi M, Damirin A, Kimura T, Murata N, Kurose H, Sato K, Okajima F", "reference": { "type": "PubMed", "id": "17462861", "url": "https://pubmed.ncbi.nlm.nih.gov/17462861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17462861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The orphan receptor GPR55 is a novel cannabinoid receptor.", "journal": "British journal of pharmacology", "date": "2007", "authors": "Ryberg E, Larsson N, Sjogren S, Hjorth S, Hermansson NO, Leonova J, Elebring T, Nilsson K, Drmota T, Greasley PJ", "reference": { "type": "PubMed", "id": "17876302", "url": "https://pubmed.ncbi.nlm.nih.gov/17876302" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17876302", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular mechanism of Zn2+ agonism in the extracellular domain of GPR39.", "journal": "FEBS letters", "date": "2008", "authors": "Storjohann L, Holst B, Schwartz TW", "reference": { "type": "PubMed", "id": "18588883", "url": "https://pubmed.ncbi.nlm.nih.gov/18588883" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 17, "end_pos": 17, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreases activation by Zn(2+). Abolishes activation by Zn(2+); when associated with A-19.", "evidence": [ { "database": "UniProtKB", "id": "O43194", "url": "https://www.uniprot.org/uniprotkb/O43194" }, { "database": "PubMed", "id": "18588883", "url": "https://pubmed.ncbi.nlm.nih.gov/18588883" } ], "uniprot_canonical_ac": "O43194-1" }, { "start_pos": 19, "end_pos": 19, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreases activation by Zn(2+). Abolishes activation by Zn(2+); when associated with A-17.", "evidence": [ { "database": "UniProtKB", "id": "O43194", "url": "https://www.uniprot.org/uniprotkb/O43194" }, { "database": "PubMed", "id": "18588883", "url": "https://pubmed.ncbi.nlm.nih.gov/18588883" } ], "uniprot_canonical_ac": "O43194-1" }, { "start_pos": 312, "end_pos": 312, "sequence_org": "H", "sequence_mut": "A", "comment": "Not affect constitutive or Zn(2+)-induced activation.", "evidence": [ { "database": "UniProtKB", "id": "O43194", "url": "https://www.uniprot.org/uniprotkb/O43194" }, { "database": "PubMed", "id": "18588883", "url": "https://pubmed.ncbi.nlm.nih.gov/18588883" } ], "uniprot_canonical_ac": "O43194-1" }, { "start_pos": 313, "end_pos": 313, "sequence_org": "D", "sequence_mut": "A", "comment": "Induces very high constitutive activity and eliminates Zn(2+)-induced activation.", "evidence": [ { "database": "UniProtKB", "id": "O43194", "url": "https://www.uniprot.org/uniprotkb/O43194" }, { "database": "PubMed", "id": "18588883", "url": "https://pubmed.ncbi.nlm.nih.gov/18588883" } ], "uniprot_canonical_ac": "O43194-1" } ], "record_id": "pubmed.18588883", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of chemerin receptor (ChemR23) in human endothelial cells: chemerin-induced endothelial angiogenesis.", "journal": "Biochemical and biophysical research communications", "date": "2010-01-22", "authors": "Kaur Jaspreet, Adya Raghu, Tan Bee K, Chen Jing, Randeva Harpal S", "reference": { "type": "PubMed", "id": "20044979", "url": "https://pubmed.ncbi.nlm.nih.gov/20044979" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20044979", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oxysterols direct immune cell migration via EBI2.", "journal": "Nature", "date": "2011", "authors": "Hannedouche S, Zhang J, Yi T, Shen W, Nguyen D, Pereira JP, Guerini D, Baumgarten BU, Roggo S, Wen B, Knochenmuss R, Noel S, Gessier F, Kelly LM, Vanek M, Laurent S, Preuss I, Miault C, Christen I, Karuna R, Li W, Koo DI, Suply T, Schmedt C, Peters EC, Falchetto R, Katopodis A, Spanka C, Roy MO, Detheux M, Chen YA, Schultz PG, Cho CY, Seuwen K, Cyster JG, Sailer AW", "reference": { "type": "PubMed", "id": "21796212", "url": "https://pubmed.ncbi.nlm.nih.gov/21796212" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3U6B2-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "Gpr183", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21796212", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence of a human cannabinoid receptor cDNA.", "journal": "Nucleic acids research", "date": "1990", "authors": "Gerard C, Mollereau C, Vassart G, Parmentier M", "reference": { "type": "PubMed", "id": "2263478", "url": "https://pubmed.ncbi.nlm.nih.gov/2263478" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2263478", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signaling Properties of Chemerin Receptors CMKLR1, GPR1 and CCRL2.", "journal": "PloS one", "date": "2016", "authors": "De Henau Olivier, Degroot Gaetan-Nagim, Imbault Virginie, Robert Virginie, De Poorter C\u00e9dric, Mcheik Saria, Gal\u00e9s C\u00e9line, Parmentier Marc, Springael Jean-Yves", "reference": { "type": "PubMed", "id": "27716822", "url": "https://pubmed.ncbi.nlm.nih.gov/27716822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46091-1", "protein_name": "Chemerin-like receptor 2", "gene_name": "CMKLR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27716822", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "International Union of Basic and Clinical Pharmacology CIII: Chemerin Receptors CMKLR1 (Chemerin1) and GPR1 (Chemerin2) Nomenclature, Pharmacology, and Function.", "journal": "Pharmacol. Rev.", "date": "2018", "authors": "Kennedy Amanda J, Davenport Anthony P", "reference": { "type": "PubMed", "id": "29279348", "url": "https://pubmed.ncbi.nlm.nih.gov/29279348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46091-1", "protein_name": "Chemerin-like receptor 2", "gene_name": "CMKLR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29279348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ChemR23 activation reprograms macrophages toward a less inflammatory phenotype and dampens carcinoma progression.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Lavy Margot, Gauttier Vanessa, Dumont Alison, Chocteau Florian, Deshayes Sophie, Fresquet Judith, Dehame Virginie, Girault Isabelle, Trilleaud Charl\u00e8ne, Neyton St\u00e9phanie, Mary Caroline, Juin Philippe, Poirier Nicolas, Barill\u00e9-Nion Sophie, Blanquart Christophe", "reference": { "type": "PubMed", "id": "37539056", "url": "https://pubmed.ncbi.nlm.nih.gov/37539056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37539056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of Single Nucleotide Polymorphisms (SNPs) of Chemoattractant Receptor23 (ChemR23) Gene with Susceptibility to Allergic Rhinitis.", "journal": "Biochemical genetics", "date": "2024-08", "authors": "Daneshfar Niloofar, Falahi Sara, Gorgin Karaji Ali, Rezaiemanesh Alireza, Mortazavi Seyed Hamid Reza, Akbari Bahman, Eivazi Atefeh, Salari Farhad", "reference": { "type": "PubMed", "id": "37993706", "url": "https://pubmed.ncbi.nlm.nih.gov/37993706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37993706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GPR1 and CMKLR1 Control Lipid Metabolism to Support the Development of Clear Cell Renal Cell Carcinoma.", "journal": "Cancer research", "date": "2024-07-02", "authors": "Wang Dazhi, Mahmud Iqbal, Thakur Vijay S, Tan Sze Kiat, Isom Daniel G, Lombard David B, Gonzalgo Mark L, Kryvenko Oleksandr N, Lorenzi Philip L, Tcheuyap Vanina T, Brugarolas James, Welford Scott M", "reference": { "type": "PubMed", "id": "38640229", "url": "https://pubmed.ncbi.nlm.nih.gov/38640229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38640229", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The peripheral cannabinoid receptor: adenylate cyclase inhibition and G protein coupling.", "journal": "FEBS letters", "date": "1995", "authors": "Bayewitch M, Avidor-Reiss T, Levy R, Barg J, Mechoulam R, Vogel Z", "reference": { "type": "PubMed", "id": "7498464", "url": "https://pubmed.ncbi.nlm.nih.gov/7498464" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7498464", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of a second melatonin receptor expressed in human retina and brain: the Mel1b melatonin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Reppert SM, Godson C, Mahle CD, Weaver DR, Slaugenhaupt SA, Gusella JF", "reference": { "type": "PubMed", "id": "7568007", "url": "https://pubmed.ncbi.nlm.nih.gov/7568007" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49287-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "Mtnr1b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7568007", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of a peripheral receptor for cannabinoids.", "journal": "Nature", "date": "1993", "authors": "Munro S, Thomas KL, Abu-Shaar M", "reference": { "type": "PubMed", "id": "7689702", "url": "https://pubmed.ncbi.nlm.nih.gov/7689702" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7689702", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stimulation of cannabinoid receptor CB1 induces krox-24 expression in human astrocytoma cells.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bouaboula M, Bourrie B, Rinaldi-Carmona M, Shire D, Le Fur G, Casellas P", "reference": { "type": "PubMed", "id": "7775459", "url": "https://pubmed.ncbi.nlm.nih.gov/7775459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7775459", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of a mammalian melatonin receptor that mediates reproductive and circadian responses.", "journal": "Neuron", "date": "1994", "authors": "Reppert SM, Weaver DR, Ebisawa T", "reference": { "type": "PubMed", "id": "7946354", "url": "https://pubmed.ncbi.nlm.nih.gov/7946354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49218-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "Mtnr1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7946354", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a novel receptor (CMKLR1) with homology to the chemotactic factor receptors.", "journal": "Cytogenet. Cell Genet.", "date": "1996", "authors": "Gantz I, Konda Y, Yang Y K, Miller D E, Dierick H A, Yamada T", "reference": { "type": "PubMed", "id": "8976386", "url": "https://pubmed.ncbi.nlm.nih.gov/8976386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8976386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ChemR23, a putative chemoattractant receptor, is expressed in monocyte-derived dendritic cells and macrophages and is a coreceptor for SIV and some primary HIV-1 strains.", "journal": "European journal of immunology", "date": "1998-05", "authors": "Samson M, Edinger A L, Stordeur P, Rucker J, Verhasselt V, Sharron M, Govaerts C, Mollereau C, Vassart G, Doms R W, Parmentier M", "reference": { "type": "PubMed", "id": "9603476", "url": "https://pubmed.ncbi.nlm.nih.gov/9603476" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9603476", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dimerization of CUL7 and PARC is not required for all CUL7 functions and mouse development.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Skaar JR, Arai T, DeCaprio JA", "reference": { "type": "PubMed", "id": "15964813", "url": "https://pubmed.ncbi.nlm.nih.gov/15964813" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWT3-1", "protein_name": "Cullin-9", "gene_name": "CUL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80TT8-1", "protein_name": "Cullin-9", "gene_name": "Cul9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14999-1", "protein_name": "Cullin-7", "gene_name": "CUL7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWT3", "url": "https://www.uniprot.org/uniprotkb/Q8IWT3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15964813", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of far upstream element-binding protein-1 as an authentic Parkin substrate.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Ko HS, Kim SW, Sriram SR, Dawson VL, Dawson TM", "reference": { "type": "PubMed", "id": "16672220", "url": "https://pubmed.ncbi.nlm.nih.gov/16672220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWT3-1", "protein_name": "Cullin-9", "gene_name": "CUL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80TT8-1", "protein_name": "Cullin-9", "gene_name": "Cul9", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWT3", "url": "https://www.uniprot.org/uniprotkb/Q8IWT3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16672220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytochrome c oxidase subassemblies in fibroblast cultures from patients carrying mutations in COX10, SCO1, or SURF1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Williams SL, Valnot I, Rustin P, Taanman JW", "reference": { "type": "PubMed", "id": "14607829", "url": "https://pubmed.ncbi.nlm.nih.gov/14607829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14607829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates.", "journal": "BMC Evol. Biol.", "date": "2008", "authors": "Uddin Monica, Opazo Juan C, Wildman Derek E, Sherwood Chet C, Hof Patrick R, Goodman Morris, Grossman Lawrence I", "reference": { "type": "PubMed", "id": "18197981", "url": "https://pubmed.ncbi.nlm.nih.gov/18197981" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18197981", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation in mitochondrial complex IV subunit COX5A causes pulmonary arterial hypertension, lactic acidemia, and failure to thrive.", "journal": "Human mutation", "date": "2017", "authors": "Baertling F, Al-Murshedi F, Sanchez-Caballero L, Al-Senaidi K, Joshi NP, Venselaar H, van den Brand MA, Nijtmans LG, Rodenburg RJ", "reference": { "type": "PubMed", "id": "28247525", "url": "https://pubmed.ncbi.nlm.nih.gov/28247525" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28247525", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subunit Va of human and bovine cytochrome c oxidase is highly conserved.", "journal": "Gene", "date": "1988", "authors": "Rizzuto R, Nakase H, Zeviani M, DiMauro S, Schon E A", "reference": { "type": "PubMed", "id": "2853101", "url": "https://pubmed.ncbi.nlm.nih.gov/2853101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2853101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the intact 14-subunit human cytochrome c oxidase.", "journal": "Cell Res.", "date": "2018", "authors": "Zong S, Wu M, Gu J, Liu T, Guo R, Yang M", "reference": { "type": "PubMed", "id": "30030519", "url": "https://pubmed.ncbi.nlm.nih.gov/30030519" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13073-1", "protein_name": "Cytochrome c oxidase subunit 4 isoform 1, mitochondrial", "gene_name": "COX4I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15954-1", "protein_name": "Cytochrome c oxidase subunit 7C, mitochondrial", "gene_name": "COX7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09669-1", "protein_name": "Cytochrome c oxidase subunit 6C", "gene_name": "COX6C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00483-1", "protein_name": "Cytochrome c oxidase subunit FA4", "gene_name": "COXFA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14406-1", "protein_name": "Cytochrome c oxidase subunit 7A2, mitochondrial", "gene_name": "COX7A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24311-1", "protein_name": "Cytochrome c oxidase subunit 7B, mitochondrial", "gene_name": "COX7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00395-1", "protein_name": "Cytochrome c oxidase subunit 1", "gene_name": "MT-CO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00414-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "MT-CO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00403-1", "protein_name": "Cytochrome c oxidase subunit 2", "gene_name": "MT-CO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10176-1", "protein_name": "Cytochrome c oxidase subunit 8A, mitochondrial", "gene_name": "COX8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12074-1", "protein_name": "Cytochrome c oxidase subunit 6A1, mitochondrial", "gene_name": "COX6A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14854-1", "protein_name": "Cytochrome c oxidase subunit 6B1", "gene_name": "COX6B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10606-1", "protein_name": "Cytochrome c oxidase subunit 5B, mitochondrial", "gene_name": "COX5B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30030519", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-204/COX5A axis contributes to invasion and chemotherapy resistance in estrogen receptor-positive breast cancers.", "journal": "Cancer letters", "date": "2020", "authors": "Zeng J, Li G, Xia Y, Wang F, Wang Y, Xu S, Zhou Y, Liu X, Xie X, Zhang J", "reference": { "type": "PubMed", "id": "32758616", "url": "https://pubmed.ncbi.nlm.nih.gov/32758616" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32758616", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COX5A Alleviates Doxorubicin-Induced Cardiotoxicity by Suppressing Oxidative Stress, Mitochondrial Dysfunction and Cardiomyocyte Apoptosis.", "journal": "International journal of molecular sciences", "date": "2023-06-20", "authors": "Zhang Peipei, Lu Hao, Wu Yuan, Lu Danbo, Li Chenguang, Yang Xiangdong, Chen Zhangwei, Qian Juying, Ge Junbo", "reference": { "type": "PubMed", "id": "37373547", "url": "https://pubmed.ncbi.nlm.nih.gov/37373547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37373547", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COX5A as a potential biomarker for disease activity and organ damage in lupus.", "journal": "Clinical and experimental medicine", "date": "2023-12", "authors": "Cai Minglong, Qin Yi, Wan An, Jin Huizhi, Tang Jun, Chen Zhu", "reference": { "type": "PubMed", "id": "37891386", "url": "https://pubmed.ncbi.nlm.nih.gov/37891386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37891386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stress response silencing by an E3 ligase mutated in neurodegeneration.", "journal": "Nature", "date": "2024-02", "authors": "Haakonsen Diane L, Heider Michael, Ingersoll Andrew J, Vodehnal Kayla, Witus Samuel R, Uenaka Takeshi, Wernig Marius, Rap\u00e9 Michael", "reference": { "type": "PubMed", "id": "38297121", "url": "https://pubmed.ncbi.nlm.nih.gov/38297121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0J7-1", "protein_name": "E3 ubiquitin-protein ligase KCMF1", "gene_name": "KCMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75390-1", "protein_name": "Citrate synthase, mitochondrial", "gene_name": "CS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP24-1", "protein_name": "Calmodulin-2", "gene_name": "CALM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP25-1", "protein_name": "Calmodulin-3", "gene_name": "CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14154-1", "protein_name": "DAP3-binding cell death enhancer 1", "gene_name": "DELE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05091-1", "protein_name": "Aldehyde dehydrogenase, mitochondrial", "gene_name": "ALDH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10176-1", "protein_name": "Cytochrome c oxidase subunit 8A, mitochondrial", "gene_name": "COX8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQI3-1", "protein_name": "Eukaryotic translation initiation factor 2-alpha kinase 1", "gene_name": "EIF2AK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49459-1", "protein_name": "Ubiquitin-conjugating enzyme E2 A", "gene_name": "UBE2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T4S7-1", "protein_name": "E3 ubiquitin-protein ligase UBR4", "gene_name": "UBR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BPW8-1", "protein_name": "Protein NipSnap homolog 1", "gene_name": "NIPSNAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48047-1", "protein_name": "ATP synthase peripheral stalk subunit OSCP, mitochondrial", "gene_name": "ATP5PO", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38297121", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The major protein expression profile and two-dimensional protein database of human heart.", "journal": "Electrophoresis", "date": "1995", "authors": "Kovalyov L I, Shishkin S S, Efimochkin A S, Kovalyova M A, Ershova E S, Egorov T A, Musalyamov A K", "reference": { "type": "PubMed", "id": "7498159", "url": "https://pubmed.ncbi.nlm.nih.gov/7498159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05413-1", "protein_name": "Fatty acid-binding protein, heart", "gene_name": "FABP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02511-1", "protein_name": "Alpha-crystallin B chain", "gene_name": "CRYAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45379-1", "protein_name": "Troponin T, cardiac muscle", "gene_name": "TNNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04406-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "GAPDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10916-1", "protein_name": "Myosin regulatory light chain 2, ventricular/cardiac muscle isoform", "gene_name": "MYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25705-1", "protein_name": "ATP synthase F(1) complex subunit alpha, mitochondrial", "gene_name": "ATP5F1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02787-1", "protein_name": "Serotransferrin", "gene_name": "TF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08590-1", "protein_name": "Myosin light chain 3", "gene_name": "MYL3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7498159", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human liver protein map: update 1993.", "journal": "Electrophoresis", "date": "1993", "authors": "Hughes GJ, Frutiger S, Paquet N, Pasquali C, Sanchez JC, Tissot JD, Bairoch A, Appel RD, Hochstrasser DF", "reference": { "type": "PubMed", "id": "8313870", "url": "https://pubmed.ncbi.nlm.nih.gov/8313870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30040-1", "protein_name": "Endoplasmic reticulum resident protein 29", "gene_name": "ERP29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31937-1", "protein_name": "3-hydroxyisobutyrate dehydrogenase, mitochondrial", "gene_name": "HIBADH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10606-1", "protein_name": "Cytochrome c oxidase subunit 5B, mitochondrial", "gene_name": "COX5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30085-1", "protein_name": "UMP-CMP kinase", "gene_name": "CMPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31930-1", "protein_name": "Cytochrome b-c1 complex subunit 1, mitochondrial", "gene_name": "UQCRC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20674", "url": "https://www.uniprot.org/uniprotkb/P20674" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8313870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cysteine 29 is the major palmitoylation site on stomatin.", "journal": "FEBS Lett.", "date": "1999", "authors": "Snyers L, Umlauf E, Prohaska R", "reference": { "type": "PubMed", "id": "10338112", "url": "https://pubmed.ncbi.nlm.nih.gov/10338112" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10338112", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin is a major lipid-raft component of platelet alpha granules.", "journal": "Blood", "date": "2002", "authors": "Mairhofer M, Steiner M, Mosgoeller W, Prohaska R, Salzer U", "reference": { "type": "PubMed", "id": "12130500", "url": "https://pubmed.ncbi.nlm.nih.gov/12130500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12130500", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of cDNA coding for an ubiquitous membrane protein deficient in high Na+, low K+ stomatocytic erythrocytes.", "journal": "Blood", "date": "1992", "authors": "Stewart GW, Hepworth-Jones BE, Keen JN, Dash BC, Argent AC, Casimir CM", "reference": { "type": "PubMed", "id": "1547348", "url": "https://pubmed.ncbi.nlm.nih.gov/1547348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1547348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the stomatin domain involved in homo-oligomerization and lipid raft association.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Umlauf E, Mairhofer M, Prohaska R", "reference": { "type": "PubMed", "id": "16766530", "url": "https://pubmed.ncbi.nlm.nih.gov/16766530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 182, "end_pos": 182, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" }, { "database": "PubMed", "id": "16766530", "url": "https://pubmed.ncbi.nlm.nih.gov/16766530" } ], "uniprot_canonical_ac": "P27105-1" }, { "start_pos": 185, "end_pos": 185, "sequence_org": "W", "sequence_mut": "A", "comment": "Complete loss of oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" }, { "database": "PubMed", "id": "16766530", "url": "https://pubmed.ncbi.nlm.nih.gov/16766530" } ], "uniprot_canonical_ac": "P27105-1" }, { "start_pos": 252, "end_pos": 252, "sequence_org": "Y", "sequence_mut": "A", "comment": "Complete loss of oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" }, { "database": "PubMed", "id": "16766530", "url": "https://pubmed.ncbi.nlm.nih.gov/16766530" } ], "uniprot_canonical_ac": "P27105-1" } ], "record_id": "pubmed.16766530", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and nucleotide sequence of cDNA encoding human erythrocyte band 7 integral membrane protein.", "journal": "Biochim. Biophys. Acta", "date": "1991", "authors": "Hiebl-Dirschmied C M, Entler B, Glotzmann C, Maurer-Fogy I, Stratowa C, Prohaska R", "reference": { "type": "PubMed", "id": "1883838", "url": "https://pubmed.ncbi.nlm.nih.gov/1883838" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1883838", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin-like protein-1 interacts with stomatin and is targeted to late endosomes.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Mairhofer M, Steiner M, Salzer U, Prohaska R", "reference": { "type": "PubMed", "id": "19696025", "url": "https://pubmed.ncbi.nlm.nih.gov/19696025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI4-1", "protein_name": "Stomatin-like protein 1", "gene_name": "STOML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 10, "sequence_org": "L", "sequence_mut": "S", "comment": "Plasma membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBI4", "url": "https://www.uniprot.org/uniprotkb/Q9UBI4" }, { "database": "PubMed", "id": "19696025", "url": "https://pubmed.ncbi.nlm.nih.gov/19696025" } ], "uniprot_canonical_ac": "Q9UBI4-1" }, { "start_pos": 7, "end_pos": 7, "sequence_org": "Y", "sequence_mut": "A", "comment": "Plasma membrane localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBI4", "url": "https://www.uniprot.org/uniprotkb/Q9UBI4" }, { "database": "PubMed", "id": "19696025", "url": "https://pubmed.ncbi.nlm.nih.gov/19696025" } ], "uniprot_canonical_ac": "Q9UBI4-1" } ], "record_id": "pubmed.19696025", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains.", "journal": "Biochim. Biophys. Acta", "date": "2013", "authors": "Rungaldier Stefanie, Oberwagner Walter, Salzer Ulrich, Csaszar Edina, Prohaska Rainer", "reference": { "type": "PubMed", "id": "23219802", "url": "https://pubmed.ncbi.nlm.nih.gov/23219802" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99808-1", "protein_name": "Equilibrative nucleoside transporter 1", "gene_name": "SLC29A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13336-1", "protein_name": "Urea transporter 1", "gene_name": "SLC14A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11166-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 1", "gene_name": "SLC2A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29972-1", "protein_name": "Aquaporin-1", "gene_name": "AQP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP59-1", "protein_name": "Ferroportin", "gene_name": "SLC40A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23219802", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin modulates the activity of the Anion Exchanger 1 (AE1, SLC4A1).", "journal": "Sci. Rep.", "date": "2017", "authors": "Genetet S, Desrames A, Chouali Y, Ripoche P, Lopez C, Mouro-Chanteloup I", "reference": { "type": "PubMed", "id": "28387307", "url": "https://pubmed.ncbi.nlm.nih.gov/28387307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28387307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanosensitive Pannexin 1 Activity Is Modulated by Stomatin in Human Red Blood Cells.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Rouge S, Genetet S, Leal Denis MF, Dussiot M, Schwarzbaum PJ, Ostuni MA, Mouro-Chanteloup I", "reference": { "type": "PubMed", "id": "36012667", "url": "https://pubmed.ncbi.nlm.nih.gov/36012667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36012667", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stomatin promotes neutrophil degranulation and vascular leakage in the early stage after severe burn via enhancement of the intracellular binding of neutrophil primary granules to F-actin.", "journal": "Burns : journal of the International Society for Burn Injuries", "date": "2023-12-30", "authors": "Zhu Zhechen, Guo Zaiwen, Gao Xi, Chen Yi, Huang Jiamin, Li Linbin, Sun Bingwei", "reference": { "type": "PubMed", "id": "38185615", "url": "https://pubmed.ncbi.nlm.nih.gov/38185615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54116-1", "protein_name": "Stomatin", "gene_name": "Stom", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38185615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure, organization, and expression of the human band 7.2b gene, a candidate gene for hereditary hydrocytosis.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Gallagher PG, Forget BG", "reference": { "type": "PubMed", "id": "7592848", "url": "https://pubmed.ncbi.nlm.nih.gov/7592848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7592848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the phosphorylation site on human erythrocyte band 7 integral membrane protein: implications for a monotopic protein structure.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Salzer U, Ahorn H, Prohaska R", "reference": { "type": "PubMed", "id": "8373790", "url": "https://pubmed.ncbi.nlm.nih.gov/8373790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" }, { "database": "iPTMnet", "id": "P27105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27105" }, { "database": "PubMed", "id": "8373790", "url": "https://pubmed.ncbi.nlm.nih.gov/8373790" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "P27105-1" } ], "record_id": "pubmed.8373790", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The organization of the gene (EPB72) encoding the human erythrocyte band 7 integral membrane protein (protein 7.2b).", "journal": "Genomics", "date": "1995", "authors": "Unfried I, Entler B, Prohaska R", "reference": { "type": "PubMed", "id": "8825639", "url": "https://pubmed.ncbi.nlm.nih.gov/8825639" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8825639", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Colocalization of stomatin (band 7.2b) and actin microfilaments in UAC epithelial cells.", "journal": "Eur. J. Cell Biol.", "date": "1997", "authors": "Snyers L, Thin\u00e8s-Sempoux D, Prohaska R", "reference": { "type": "PubMed", "id": "9243190", "url": "https://pubmed.ncbi.nlm.nih.gov/9243190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9243190", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation, molecular characterization, and tissue-specific expression of a novel putative G protein-coupled receptor.", "journal": "Biochim. Biophys. Acta", "date": "1998", "authors": "Mayer H, Salzer U, Breuss J, Ziegler S, Marchler-Bauer A, Prohaska R", "reference": { "type": "PubMed", "id": "9512664", "url": "https://pubmed.ncbi.nlm.nih.gov/9512664" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43813-1", "protein_name": "Glutathione S-transferase LANCL1", "gene_name": "LANCL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9512664", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oligomeric nature of the integral membrane protein stomatin.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Snyers L, Umlauf E, Prohaska R", "reference": { "type": "PubMed", "id": "9642292", "url": "https://pubmed.ncbi.nlm.nih.gov/9642292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P27105-1", "protein_name": "Stomatin", "gene_name": "STOM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P27105", "url": "https://www.uniprot.org/uniprotkb/P27105" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9642292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complete reconstitution of the human coenzyme A biosynthetic pathway via comparative genomics.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Daugherty M, Polanuyer B, Farrell M, Scholle M, Lykidis A, de Crecy-Lagard V, Osterman A", "reference": { "type": "PubMed", "id": "11923312", "url": "https://pubmed.ncbi.nlm.nih.gov/11923312" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11923312", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of the gene encoding the human phosphopantetheine adenylyltransferase and dephospho-CoA kinase bifunctional enzyme (CoA synthase).", "journal": "The Biochemical journal", "date": "2002", "authors": "Aghajanian S, Worrall DM", "reference": { "type": "PubMed", "id": "11994049", "url": "https://pubmed.ncbi.nlm.nih.gov/11994049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8MIR4-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Pig" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11994049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An isoform of hPANK2, deficient in pantothenate kinase-associated neurodegeneration, localizes to mitochondria.", "journal": "Human molecular genetics", "date": "2003", "authors": "Hortnagel K, Prokisch H, Meitinger T", "reference": { "type": "PubMed", "id": "12554685", "url": "https://pubmed.ncbi.nlm.nih.gov/12554685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12554685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of human phosphopantothenoylcysteine synthetase at 2.3 A resolution.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Manoj N, Strauss E, Begley TP, Ealick SE", "reference": { "type": "PubMed", "id": "12906824", "url": "https://pubmed.ncbi.nlm.nih.gov/12906824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12906824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unusual space-group pseudosymmetry in crystals of human phosphopantothenoylcysteine decarboxylase.", "journal": "Acta Crystallogr. D", "date": "2003", "authors": "Manoj N, Ealick SE", "reference": { "type": "PubMed", "id": "14501115", "url": "https://pubmed.ncbi.nlm.nih.gov/14501115" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14501115", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subcellular localization and regulation of coenzyme A synthase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhyvoloup A, Nemazanyy I, Panasyuk G, Valovka T, Fenton T, Rebholz H, Wang ML, Foxon R, Lyzogubov V, Usenko V, Kyyamova R, Gorbenko O, Matsuka G, Filonenko V, Gout IT", "reference": { "type": "PubMed", "id": "14514684", "url": "https://pubmed.ncbi.nlm.nih.gov/14514684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14514684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PPARalpha controls the intracellular coenzyme A concentration via regulation of PANK1alpha gene expression.", "journal": "Journal of lipid research", "date": "2004", "authors": "Ramaswamy G, Karim MA, Murti KG, Jackowski S", "reference": { "type": "PubMed", "id": "14523052", "url": "https://pubmed.ncbi.nlm.nih.gov/14523052" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14523052", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial localization of human PANK2 and hypotheses of secondary iron accumulation in pantothenate kinase-associated neurodegeneration.", "journal": "Annals of the New York Academy of Sciences", "date": "2004", "authors": "Johnson MA, Kuo YM, Westaway SK, Parker SM, Ching KH, Gitschier J, Hayflick SJ", "reference": { "type": "PubMed", "id": "15105273", "url": "https://pubmed.ncbi.nlm.nih.gov/15105273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15105273", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanistic studies on phosphopantothenoylcysteine decarboxylase: trapping of an enethiolate intermediate with a mechanism-based inactivating agent.", "journal": "Biochemistry", "date": "2004", "authors": "Strauss E, Zhai H, Brand LA, McLafferty FW, Begley TP", "reference": { "type": "PubMed", "id": "15581364", "url": "https://pubmed.ncbi.nlm.nih.gov/15581364" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 173, "end_pos": 173, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" }, { "database": "PubMed", "id": "15581364", "url": "https://pubmed.ncbi.nlm.nih.gov/15581364" } ], "uniprot_canonical_ac": "Q96CD2-1" } ], "record_id": "pubmed.15581364", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coenzyme A: back in action.", "journal": "Progress in lipid research", "date": "2005", "authors": "Leonardi Roberta, Zhang Yong-Mei, Rock Charles O, Jackowski Suzanne", "reference": { "type": "PubMed", "id": "15893380", "url": "https://pubmed.ncbi.nlm.nih.gov/15893380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15893380", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical properties of human pantothenate kinase 2 isoforms and mutations linked to pantothenate kinase-associated neurodegeneration.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zhang YM, Rock CO, Jackowski S", "reference": { "type": "PubMed", "id": "16272150", "url": "https://pubmed.ncbi.nlm.nih.gov/16272150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96CD2-1", "protein_name": "Phosphopantothenoylcysteine decarboxylase", "gene_name": "PPCDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13057-1", "protein_name": "Bifunctional coenzyme A synthase", "gene_name": "COASY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ23-1", "protein_name": "Pantothenate kinase 2, mitochondrial", "gene_name": "PANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAB8-1", "protein_name": "Phosphopantothenate--cysteine ligase", "gene_name": "PPCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H999-1", "protein_name": "Pantothenate kinase 3", "gene_name": "PANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TE04-1", "protein_name": "Pantothenate kinase 1", "gene_name": "PANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC6-1", "protein_name": "Dephospho-CoA kinase domain-containing protein", "gene_name": "DCAKD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96CD2", "url": "https://www.uniprot.org/uniprotkb/Q96CD2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16272150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLC39A9 (ZIP9) regulates zinc homeostasis in the secretory pathway: characterization of the ZIP subfamily I protein in vertebrate cells.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2009", "authors": "Matsuura W, Yamazaki T, Yamaguchi-Iwai Y, Masuda S, Nagao M, Andrews GK, Kambe T", "reference": { "type": "PubMed", "id": "19420709", "url": "https://pubmed.ncbi.nlm.nih.gov/19420709" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5ZIU9-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Chicken" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19420709", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Essential role of the zinc transporter ZIP9/SLC39A9 in regulating the activations of Akt and Erk in B-cell receptor signaling pathway in DT40 cells.", "journal": "PloS one", "date": "2013", "authors": "Taniguchi Masanari, Fukunaka Ayako, Hagihara Mitsue, Watanabe Keiko, Kamino Shinichiro, Kambe Taiho, Enomoto Shuichi, Hiromura Makoto", "reference": { "type": "PubMed", "id": "23505453", "url": "https://pubmed.ncbi.nlm.nih.gov/23505453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5ZIU9-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Chicken" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23505453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of membrane androgen receptors in the ZIP9 zinc transporter subfamily: II. Role of human ZIP9 in testosterone-induced prostate and breast cancer cell apoptosis.", "journal": "Endocrinology", "date": "2014", "authors": "Thomas P, Pang Y, Dong J, Berg AH", "reference": { "type": "PubMed", "id": "25014355", "url": "https://pubmed.ncbi.nlm.nih.gov/25014355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25014355", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane androgen receptor characteristics of human ZIP9 (SLC39A) zinc transporter in prostate cancer cells: Androgen-specific activation and involvement of an inhibitory G protein in zinc and MAP kinase signaling.", "journal": "Molecular and cellular endocrinology", "date": "2017", "authors": "Thomas P, Pang Y, Dong J", "reference": { "type": "PubMed", "id": "28219737", "url": "https://pubmed.ncbi.nlm.nih.gov/28219737" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28219737", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Androgen dihydrotestosterone (DHT) promotes the bladder cancer nuclear AR-negative cell invasion via a newly identified membrane androgen receptor (mAR-SLC39A9)-mediated Galphai protein/MAPK/MMP9 intracellular signaling.", "journal": "Oncogene", "date": "2020", "authors": "Chen J, Chou F, Yeh S, Ou Z, Shyr C, Huang C, Xiang Z, Sun Y, Messing E, Zu X, Chang C", "reference": { "type": "PubMed", "id": "31506605", "url": "https://pubmed.ncbi.nlm.nih.gov/31506605" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31506605", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Androgens promote vascular endothelial cell proliferation through activation of a ZIP9-dependent inhibitory G protein/PI3K-Akt/Erk/cyclin D1 pathway.", "journal": "Molecular and cellular endocrinology", "date": "2021", "authors": "Converse A, Thomas P", "reference": { "type": "PubMed", "id": "34555425", "url": "https://pubmed.ncbi.nlm.nih.gov/34555425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34555425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZIP9 Is a Druggable Determinant of Sex Differences in Melanoma.", "journal": "Cancer research", "date": "2021", "authors": "Aguirre-Portoles C, Payne R, Trautz A, Foskett JK, Natale CA, Seykora JT, Ridky TW", "reference": { "type": "PubMed", "id": "34706862", "url": "https://pubmed.ncbi.nlm.nih.gov/34706862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34706862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide CRISPR/Cas9 screen identifies SLC39A9 and PIK3C3 as crucial entry factors for Ebola virus infection.", "journal": "PLoS pathogens", "date": "2024-08", "authors": "Gong Mingli, Peng Cheng, Yang Chen, Wang Zhenhua, Qian Hongwu, Hu Xue, Zhou Peng, Shan Chao, Ding Qiang", "reference": { "type": "PubMed", "id": "39173055", "url": "https://pubmed.ncbi.nlm.nih.gov/39173055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUM3-1", "protein_name": "Zinc transporter ZIP9", "gene_name": "SLC39A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUM3", "url": "https://www.uniprot.org/uniprotkb/Q9NUM3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39173055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Hart KC, Robertson SC, Donoghue DJ", "reference": { "type": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42225-1", "protein_name": "Signal transducer and activator of transcription 1", "gene_name": "Stat1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P26450-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "Pik3r1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23352-1", "protein_name": "Anosmin-1", "gene_name": "ANOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42227-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "Stat3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22607-1", "protein_name": "Fibroblast growth factor receptor 3", "gene_name": "FGFR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAT2-1", "protein_name": "Fibroblast growth factor-binding protein 3", "gene_name": "FGFBP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYJ0-1", "protein_name": "Fibroblast growth factor-binding protein 2", "gene_name": "FGFBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14908-1", "protein_name": "PDZ domain-containing protein GIPC1", "gene_name": "GIPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14512-1", "protein_name": "Fibroblast growth factor-binding protein 1", "gene_name": "FGFBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FER and PTK6", "evidence": [ { "database": "UniProtKB", "id": "P42227", "url": "https://www.uniprot.org/uniprotkb/P42227" }, { "database": "IntAct", "id": "P42227", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42227*" }, { "database": "iPTMnet", "id": "P42227", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42227" }, { "database": "PubMed", "id": "27724964", "url": "https://pubmed.ncbi.nlm.nih.gov/27724964" }, { "database": "PubMed", "id": "23434585", "url": "https://pubmed.ncbi.nlm.nih.gov/23434585" }, { "database": "PRO", "id": "P42227", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42227" }, { "database": "PubMed", "id": "26026268", "url": "https://pubmed.ncbi.nlm.nih.gov/26026268" }, { "database": "PubMed", "id": "10896772", "url": "https://pubmed.ncbi.nlm.nih.gov/10896772" }, { "database": "PubMed", "id": "11591769", "url": "https://pubmed.ncbi.nlm.nih.gov/11591769" }, { "database": "PubMed", "id": "11830592", "url": "https://pubmed.ncbi.nlm.nih.gov/11830592" }, { "database": "PubMed", "id": "12049654", "url": "https://pubmed.ncbi.nlm.nih.gov/12049654" }, { "database": "PubMed", "id": "12637586", "url": "https://pubmed.ncbi.nlm.nih.gov/12637586" }, { "database": "PubMed", "id": "12684046", "url": "https://pubmed.ncbi.nlm.nih.gov/12684046" }, { "database": "PubMed", "id": "15007380", "url": "https://pubmed.ncbi.nlm.nih.gov/15007380" }, { "database": "PubMed", "id": "15328362", "url": "https://pubmed.ncbi.nlm.nih.gov/15328362" }, { "database": "PubMed", "id": "15705584", "url": "https://pubmed.ncbi.nlm.nih.gov/15705584" }, { "database": "PubMed", "id": "15781265", "url": "https://pubmed.ncbi.nlm.nih.gov/15781265" }, { "database": "PubMed", "id": "15936723", "url": "https://pubmed.ncbi.nlm.nih.gov/15936723" }, { "database": "PubMed", "id": "16377083", "url": "https://pubmed.ncbi.nlm.nih.gov/16377083" }, { "database": "PubMed", "id": "16417589", "url": "https://pubmed.ncbi.nlm.nih.gov/16417589" }, { "database": "PubMed", "id": "17283176", "url": "https://pubmed.ncbi.nlm.nih.gov/17283176" }, { "database": "PubMed", "id": "17401459", "url": "https://pubmed.ncbi.nlm.nih.gov/17401459" }, { "database": "PubMed", "id": "17683579", "url": "https://pubmed.ncbi.nlm.nih.gov/17683579" }, { "database": "PubMed", "id": "18025205", "url": "https://pubmed.ncbi.nlm.nih.gov/18025205" }, { "database": "PubMed", "id": "18158318", "url": "https://pubmed.ncbi.nlm.nih.gov/18158318" }, { "database": "PubMed", "id": "18403479", "url": "https://pubmed.ncbi.nlm.nih.gov/18403479" }, { "database": "PubMed", "id": "18489773", "url": "https://pubmed.ncbi.nlm.nih.gov/18489773" }, { "database": "PubMed", "id": "18500982", "url": "https://pubmed.ncbi.nlm.nih.gov/18500982" }, { "database": "PubMed", "id": "18794085", "url": "https://pubmed.ncbi.nlm.nih.gov/18794085" }, { "database": "PubMed", "id": "18795895", "url": "https://pubmed.ncbi.nlm.nih.gov/18795895" }, { "database": "PubMed", "id": "19071214", "url": "https://pubmed.ncbi.nlm.nih.gov/19071214" }, { "database": "PubMed", "id": "19284588", "url": "https://pubmed.ncbi.nlm.nih.gov/19284588" }, { "database": "PubMed", "id": "19299019", "url": "https://pubmed.ncbi.nlm.nih.gov/19299019" }, { "database": "PubMed", "id": "19696070", "url": "https://pubmed.ncbi.nlm.nih.gov/19696070" }, { "database": "PubMed", "id": "20107108", "url": "https://pubmed.ncbi.nlm.nih.gov/20107108" }, { "database": "PubMed", "id": "20151299", "url": "https://pubmed.ncbi.nlm.nih.gov/20151299" }, { "database": "PubMed", "id": "20300524", "url": "https://pubmed.ncbi.nlm.nih.gov/20300524" }, { "database": "PubMed", "id": "20484139", "url": "https://pubmed.ncbi.nlm.nih.gov/20484139" }, { "database": "PubMed", "id": "20959490", "url": "https://pubmed.ncbi.nlm.nih.gov/20959490" }, { "database": "PubMed", "id": "21056997", "url": "https://pubmed.ncbi.nlm.nih.gov/21056997" }, { "database": "PubMed", "id": "21354226", "url": "https://pubmed.ncbi.nlm.nih.gov/21354226" }, { "database": "PubMed", "id": "21486047", "url": "https://pubmed.ncbi.nlm.nih.gov/21486047" }, { "database": "PubMed", "id": "21518725", "url": "https://pubmed.ncbi.nlm.nih.gov/21518725" }, { "database": "PubMed", "id": "21617181", "url": "https://pubmed.ncbi.nlm.nih.gov/21617181" }, { "database": "PubMed", "id": "21809363", "url": "https://pubmed.ncbi.nlm.nih.gov/21809363" }, { "database": "PubMed", "id": "21810913", "url": "https://pubmed.ncbi.nlm.nih.gov/21810913" }, { "database": "PubMed", "id": "21997191", "url": "https://pubmed.ncbi.nlm.nih.gov/21997191" }, { "database": "PubMed", "id": "22074622", "url": "https://pubmed.ncbi.nlm.nih.gov/22074622" }, { "database": "PubMed", "id": "22206672", "url": "https://pubmed.ncbi.nlm.nih.gov/22206672" }, { "database": "PubMed", "id": "22348200", "url": "https://pubmed.ncbi.nlm.nih.gov/22348200" }, { "database": "PubMed", "id": "22511936", "url": "https://pubmed.ncbi.nlm.nih.gov/22511936" }, { "database": "PubMed", "id": "22614008", "url": "https://pubmed.ncbi.nlm.nih.gov/22614008" }, { "database": "PubMed", "id": "22824293", "url": "https://pubmed.ncbi.nlm.nih.gov/22824293" }, { "database": "PubMed", "id": "22844518", "url": "https://pubmed.ncbi.nlm.nih.gov/22844518" }, { "database": "PubMed", "id": "22907754", "url": "https://pubmed.ncbi.nlm.nih.gov/22907754" }, { "database": "PubMed", "id": "22911886", "url": "https://pubmed.ncbi.nlm.nih.gov/22911886" }, { "database": "PubMed", "id": "22992748", "url": "https://pubmed.ncbi.nlm.nih.gov/22992748" }, { "database": "PubMed", "id": "23109669", "url": "https://pubmed.ncbi.nlm.nih.gov/23109669" }, { "database": "PubMed", "id": "23114963", "url": "https://pubmed.ncbi.nlm.nih.gov/23114963" }, { "database": "PubMed", "id": "23118721", "url": "https://pubmed.ncbi.nlm.nih.gov/23118721" }, { "database": "PubMed", "id": "23166634", "url": "https://pubmed.ncbi.nlm.nih.gov/23166634" }, { "database": "PubMed", "id": "23216800", "url": "https://pubmed.ncbi.nlm.nih.gov/23216800" }, { "database": "PubMed", "id": "23416975", "url": "https://pubmed.ncbi.nlm.nih.gov/23416975" }, { "database": "PubMed", "id": "23530005", "url": "https://pubmed.ncbi.nlm.nih.gov/23530005" }, { "database": "PubMed", "id": "23531921", "url": "https://pubmed.ncbi.nlm.nih.gov/23531921" }, { "database": "PubMed", "id": "23533666", "url": "https://pubmed.ncbi.nlm.nih.gov/23533666" }, { "database": "PubMed", "id": "23589566", "url": "https://pubmed.ncbi.nlm.nih.gov/23589566" }, { "database": "PubMed", "id": "23593315", "url": "https://pubmed.ncbi.nlm.nih.gov/23593315" }, { "database": "PubMed", "id": "23693126", "url": "https://pubmed.ncbi.nlm.nih.gov/23693126" }, { "database": "PubMed", "id": "23750710", "url": "https://pubmed.ncbi.nlm.nih.gov/23750710" }, { "database": "PubMed", "id": "23811270", "url": "https://pubmed.ncbi.nlm.nih.gov/23811270" }, { "database": "PubMed", "id": "23842188", "url": "https://pubmed.ncbi.nlm.nih.gov/23842188" }, { "database": "PubMed", "id": "23979021", "url": "https://pubmed.ncbi.nlm.nih.gov/23979021" }, { "database": "PubMed", "id": "24093616", "url": "https://pubmed.ncbi.nlm.nih.gov/24093616" }, { "database": "PubMed", "id": "24130924", "url": "https://pubmed.ncbi.nlm.nih.gov/24130924" }, { "database": "PubMed", "id": "24132923", "url": "https://pubmed.ncbi.nlm.nih.gov/24132923" }, { "database": "PubMed", "id": "24152426", "url": "https://pubmed.ncbi.nlm.nih.gov/24152426" }, { "database": "PubMed", "id": "24223854", "url": "https://pubmed.ncbi.nlm.nih.gov/24223854" }, { "database": "PubMed", "id": "24260381", "url": "https://pubmed.ncbi.nlm.nih.gov/24260381" }, { "database": "PubMed", "id": "24286865", "url": "https://pubmed.ncbi.nlm.nih.gov/24286865" }, { "database": "PubMed", "id": "24302476", "url": "https://pubmed.ncbi.nlm.nih.gov/24302476" }, { "database": "PubMed", "id": "24323291", "url": "https://pubmed.ncbi.nlm.nih.gov/24323291" }, { "database": "PubMed", "id": "24376586", "url": "https://pubmed.ncbi.nlm.nih.gov/24376586" }, { "database": "PubMed", "id": "24410832", "url": "https://pubmed.ncbi.nlm.nih.gov/24410832" }, { "database": "PubMed", "id": "24416452", "url": "https://pubmed.ncbi.nlm.nih.gov/24416452" }, { "database": "PubMed", "id": "24449804", "url": "https://pubmed.ncbi.nlm.nih.gov/24449804" }, { "database": "PubMed", "id": "24508558", "url": "https://pubmed.ncbi.nlm.nih.gov/24508558" }, { "database": "PubMed", "id": "24606867", "url": "https://pubmed.ncbi.nlm.nih.gov/24606867" }, { "database": "PubMed", "id": "24619572", "url": "https://pubmed.ncbi.nlm.nih.gov/24619572" }, { "database": "PubMed", "id": "24655440", "url": "https://pubmed.ncbi.nlm.nih.gov/24655440" }, { "database": "PubMed", "id": "24681959", "url": "https://pubmed.ncbi.nlm.nih.gov/24681959" }, { "database": "PubMed", "id": "24682898", "url": "https://pubmed.ncbi.nlm.nih.gov/24682898" }, { "database": "PubMed", "id": "24744866", "url": "https://pubmed.ncbi.nlm.nih.gov/24744866" }, { "database": "PubMed", "id": "24789104", "url": "https://pubmed.ncbi.nlm.nih.gov/24789104" }, { "database": "PubMed", "id": "24806510", "url": "https://pubmed.ncbi.nlm.nih.gov/24806510" }, { "database": "PubMed", "id": "24819473", "url": "https://pubmed.ncbi.nlm.nih.gov/24819473" }, { "database": "PubMed", "id": "24850910", "url": "https://pubmed.ncbi.nlm.nih.gov/24850910" }, { "database": "PubMed", "id": "24887420", "url": "https://pubmed.ncbi.nlm.nih.gov/24887420" }, { "database": "PubMed", "id": "25025494", "url": "https://pubmed.ncbi.nlm.nih.gov/25025494" }, { "database": "PubMed", "id": "25147435", "url": "https://pubmed.ncbi.nlm.nih.gov/25147435" }, { "database": "PubMed", "id": "25200186", "url": "https://pubmed.ncbi.nlm.nih.gov/25200186" }, { "database": "PubMed", "id": "25216522", "url": "https://pubmed.ncbi.nlm.nih.gov/25216522" }, { "database": "PubMed", "id": "25275304", "url": "https://pubmed.ncbi.nlm.nih.gov/25275304" }, { "database": "PubMed", "id": "25331984", "url": "https://pubmed.ncbi.nlm.nih.gov/25331984" }, { "database": "PubMed", "id": "25337545", "url": "https://pubmed.ncbi.nlm.nih.gov/25337545" }, { "database": "PubMed", "id": "25412315", "url": "https://pubmed.ncbi.nlm.nih.gov/25412315" }, { "database": "PubMed", "id": "25432886", "url": "https://pubmed.ncbi.nlm.nih.gov/25432886" }, { "database": "PubMed", "id": "25512545", "url": "https://pubmed.ncbi.nlm.nih.gov/25512545" }, { "database": "PubMed", "id": "25581158", "url": "https://pubmed.ncbi.nlm.nih.gov/25581158" }, { "database": "PubMed", "id": "25611086", "url": "https://pubmed.ncbi.nlm.nih.gov/25611086" }, { "database": "PubMed", "id": "25741592", "url": "https://pubmed.ncbi.nlm.nih.gov/25741592" }, { "database": "PubMed", "id": "25788267", "url": "https://pubmed.ncbi.nlm.nih.gov/25788267" }, { "database": "PubMed", "id": "25868979", "url": "https://pubmed.ncbi.nlm.nih.gov/25868979" }, { "database": "PubMed", "id": "25880134", "url": "https://pubmed.ncbi.nlm.nih.gov/25880134" }, { "database": "PubMed", "id": "26061710", "url": "https://pubmed.ncbi.nlm.nih.gov/26061710" }, { "database": "PubMed", "id": "26075036", "url": "https://pubmed.ncbi.nlm.nih.gov/26075036" }, { "database": "PubMed", "id": "26247733", "url": "https://pubmed.ncbi.nlm.nih.gov/26247733" }, { "database": "PubMed", "id": "26317647", "url": "https://pubmed.ncbi.nlm.nih.gov/26317647" }, { "database": "PubMed", "id": "26378915", "url": "https://pubmed.ncbi.nlm.nih.gov/26378915" }, { "database": "PubMed", "id": "26380299", "url": "https://pubmed.ncbi.nlm.nih.gov/26380299" }, { "database": "PubMed", "id": "26398946", "url": "https://pubmed.ncbi.nlm.nih.gov/26398946" }, { "database": "PubMed", "id": "26413468", "url": "https://pubmed.ncbi.nlm.nih.gov/26413468" }, { "database": "PubMed", "id": "26444028", "url": "https://pubmed.ncbi.nlm.nih.gov/26444028" }, { "database": "PubMed", "id": "26491103", "url": "https://pubmed.ncbi.nlm.nih.gov/26491103" }, { "database": "PubMed", "id": "26512963", "url": "https://pubmed.ncbi.nlm.nih.gov/26512963" }, { "database": "PubMed", "id": "26556875", "url": "https://pubmed.ncbi.nlm.nih.gov/26556875" }, { "database": "PubMed", "id": "26573296", "url": "https://pubmed.ncbi.nlm.nih.gov/26573296" }, { "database": "PubMed", "id": "26575024", "url": "https://pubmed.ncbi.nlm.nih.gov/26575024" }, { "database": "PubMed", "id": "26612419", "url": "https://pubmed.ncbi.nlm.nih.gov/26612419" }, { "database": "PubMed", "id": "26633714", "url": "https://pubmed.ncbi.nlm.nih.gov/26633714" }, { "database": "PubMed", "id": "26764350", "url": "https://pubmed.ncbi.nlm.nih.gov/26764350" }, { "database": "PubMed", "id": "26775702", "url": "https://pubmed.ncbi.nlm.nih.gov/26775702" }, { "database": "PubMed", "id": "26789017", "url": "https://pubmed.ncbi.nlm.nih.gov/26789017" }, { "database": "PubMed", "id": "26823495", "url": "https://pubmed.ncbi.nlm.nih.gov/26823495" }, { "database": "PubMed", "id": "26826115", "url": "https://pubmed.ncbi.nlm.nih.gov/26826115" }, { "database": "PubMed", "id": "26830149", "url": "https://pubmed.ncbi.nlm.nih.gov/26830149" }, { "database": "PubMed", "id": "26848037", "url": "https://pubmed.ncbi.nlm.nih.gov/26848037" }, { "database": "PubMed", "id": "26892021", "url": "https://pubmed.ncbi.nlm.nih.gov/26892021" }, { "database": "PubMed", "id": "26910359", "url": "https://pubmed.ncbi.nlm.nih.gov/26910359" }, { "database": "PubMed", "id": "26911838", "url": "https://pubmed.ncbi.nlm.nih.gov/26911838" }, { "database": "PubMed", "id": "26919063", "url": "https://pubmed.ncbi.nlm.nih.gov/26919063" }, { "database": "PubMed", "id": "26923837", "url": "https://pubmed.ncbi.nlm.nih.gov/26923837" }, { "database": "PubMed", "id": "27021905", "url": "https://pubmed.ncbi.nlm.nih.gov/27021905" }, { "database": "PubMed", "id": "27050378", "url": "https://pubmed.ncbi.nlm.nih.gov/27050378" }, { "database": "PubMed", "id": "27050391", "url": "https://pubmed.ncbi.nlm.nih.gov/27050391" }, { "database": "PubMed", "id": "27080032", "url": "https://pubmed.ncbi.nlm.nih.gov/27080032" }, { "database": "PubMed", "id": "27102301", "url": "https://pubmed.ncbi.nlm.nih.gov/27102301" }, { "database": "PubMed", "id": "27215660", "url": "https://pubmed.ncbi.nlm.nih.gov/27215660" }, { "database": "PubMed", "id": "27217982", "url": "https://pubmed.ncbi.nlm.nih.gov/27217982" }, { "database": "PubMed", "id": "27306323", "url": "https://pubmed.ncbi.nlm.nih.gov/27306323" }, { "database": "PubMed", "id": "27384491", "url": "https://pubmed.ncbi.nlm.nih.gov/27384491" }, { "database": "PubMed", "id": "27430527", "url": "https://pubmed.ncbi.nlm.nih.gov/27430527" }, { "database": "PubMed", "id": "27449092", "url": "https://pubmed.ncbi.nlm.nih.gov/27449092" }, { "database": "PubMed", "id": "27524110", "url": "https://pubmed.ncbi.nlm.nih.gov/27524110" }, { "database": "PubMed", "id": "27537526", "url": "https://pubmed.ncbi.nlm.nih.gov/27537526" }, { "database": "PubMed", "id": "27582544", "url": "https://pubmed.ncbi.nlm.nih.gov/27582544" }, { "database": "PubMed", "id": "27589562", "url": "https://pubmed.ncbi.nlm.nih.gov/27589562" }, { "database": "PubMed", "id": "27641629", "url": "https://pubmed.ncbi.nlm.nih.gov/27641629" }, { "database": "PubMed", "id": "27706259", "url": "https://pubmed.ncbi.nlm.nih.gov/27706259" }, { "database": "PubMed", "id": "27779705", "url": "https://pubmed.ncbi.nlm.nih.gov/27779705" }, { "database": "PubMed", "id": "27795451", "url": "https://pubmed.ncbi.nlm.nih.gov/27795451" }, { "database": "PubMed", "id": "27829437", "url": "https://pubmed.ncbi.nlm.nih.gov/27829437" }, { "database": "PubMed", "id": "27835873", "url": "https://pubmed.ncbi.nlm.nih.gov/27835873" }, { "database": "PubMed", "id": "27840174", "url": "https://pubmed.ncbi.nlm.nih.gov/27840174" }, { "database": "PubMed", "id": "27886188", "url": "https://pubmed.ncbi.nlm.nih.gov/27886188" }, { "database": "PubMed", "id": "28066259", "url": "https://pubmed.ncbi.nlm.nih.gov/28066259" }, { "database": "PubMed", "id": "28101184", "url": "https://pubmed.ncbi.nlm.nih.gov/28101184" }, { "database": "PubMed", "id": "28106119", "url": "https://pubmed.ncbi.nlm.nih.gov/28106119" }, { "database": "PubMed", "id": "28162277", "url": "https://pubmed.ncbi.nlm.nih.gov/28162277" }, { "database": "PubMed", "id": "28178326", "url": "https://pubmed.ncbi.nlm.nih.gov/28178326" }, { "database": "PubMed", "id": "28273928", "url": "https://pubmed.ncbi.nlm.nih.gov/28273928" }, { "database": "PubMed", "id": "28320842", "url": "https://pubmed.ncbi.nlm.nih.gov/28320842" }, { "database": "PubMed", "id": "28338101", "url": "https://pubmed.ncbi.nlm.nih.gov/28338101" }, { "database": "PubMed", "id": "28383060", "url": "https://pubmed.ncbi.nlm.nih.gov/28383060" }, { "database": "PubMed", "id": "28383063", "url": "https://pubmed.ncbi.nlm.nih.gov/28383063" }, { "database": "PubMed", "id": "28386145", "url": "https://pubmed.ncbi.nlm.nih.gov/28386145" }, { "database": "PubMed", "id": "28400195", "url": "https://pubmed.ncbi.nlm.nih.gov/28400195" }, { "database": "PubMed", "id": "28415722", "url": "https://pubmed.ncbi.nlm.nih.gov/28415722" }, { "database": "PubMed", "id": "28445952", "url": "https://pubmed.ncbi.nlm.nih.gov/28445952" }, { "database": "PubMed", "id": "28453725", "url": "https://pubmed.ncbi.nlm.nih.gov/28453725" }, { "database": "PubMed", "id": "28508871", "url": "https://pubmed.ncbi.nlm.nih.gov/28508871" }, { "database": "PubMed", "id": "28542400", "url": "https://pubmed.ncbi.nlm.nih.gov/28542400" }, { "database": "PubMed", "id": "28554144", "url": "https://pubmed.ncbi.nlm.nih.gov/28554144" }, { "database": "PubMed", "id": "28591717", "url": "https://pubmed.ncbi.nlm.nih.gov/28591717" }, { "database": "PubMed", "id": "28596565", "url": "https://pubmed.ncbi.nlm.nih.gov/28596565" }, { "database": "PubMed", "id": "28625915", "url": "https://pubmed.ncbi.nlm.nih.gov/28625915" }, { "database": "PubMed", "id": "28642132", "url": "https://pubmed.ncbi.nlm.nih.gov/28642132" }, { "database": "PubMed", "id": "28642362", "url": "https://pubmed.ncbi.nlm.nih.gov/28642362" }, { "database": "PubMed", "id": "28706517", "url": "https://pubmed.ncbi.nlm.nih.gov/28706517" }, { "database": "PubMed", "id": "28750090", "url": "https://pubmed.ncbi.nlm.nih.gov/28750090" }, { "database": "PubMed", "id": "28848431", "url": "https://pubmed.ncbi.nlm.nih.gov/28848431" }, { "database": "PubMed", "id": "28849098", "url": "https://pubmed.ncbi.nlm.nih.gov/28849098" }, { "database": "PubMed", "id": "28870220", "url": "https://pubmed.ncbi.nlm.nih.gov/28870220" }, { "database": "PubMed", "id": "28903339", "url": "https://pubmed.ncbi.nlm.nih.gov/28903339" }, { "database": "PubMed", "id": "28938568", "url": "https://pubmed.ncbi.nlm.nih.gov/28938568" }, { "database": "PubMed", "id": "29016674", "url": "https://pubmed.ncbi.nlm.nih.gov/29016674" }, { "database": "PubMed", "id": "29047406", "url": "https://pubmed.ncbi.nlm.nih.gov/29047406" }, { "database": "PubMed", "id": "29074644", "url": "https://pubmed.ncbi.nlm.nih.gov/29074644" }, { "database": "PubMed", "id": "29079839", "url": "https://pubmed.ncbi.nlm.nih.gov/29079839" }, { "database": "PubMed", "id": "29202102", "url": "https://pubmed.ncbi.nlm.nih.gov/29202102" }, { "database": "PubMed", "id": "29238104", "url": "https://pubmed.ncbi.nlm.nih.gov/29238104" }, { "database": "PubMed", "id": "29254203", "url": "https://pubmed.ncbi.nlm.nih.gov/29254203" }, { "database": "PubMed", "id": "29262585", "url": "https://pubmed.ncbi.nlm.nih.gov/29262585" }, { "database": "PubMed", "id": "29263930", "url": "https://pubmed.ncbi.nlm.nih.gov/29263930" }, { "database": "PubMed", "id": "29284516", "url": "https://pubmed.ncbi.nlm.nih.gov/29284516" }, { "database": "PubMed", "id": "29304053", "url": "https://pubmed.ncbi.nlm.nih.gov/29304053" }, { "database": "PubMed", "id": "29382715", "url": "https://pubmed.ncbi.nlm.nih.gov/29382715" }, { "database": "PubMed", "id": "29458077", "url": "https://pubmed.ncbi.nlm.nih.gov/29458077" }, { "database": "PubMed", "id": "29507229", "url": "https://pubmed.ncbi.nlm.nih.gov/29507229" }, { "database": "PubMed", "id": "29729074", "url": "https://pubmed.ncbi.nlm.nih.gov/29729074" }, { "database": "PubMed", "id": "29743632", "url": "https://pubmed.ncbi.nlm.nih.gov/29743632" }, { "database": "PubMed", "id": "29797458", "url": "https://pubmed.ncbi.nlm.nih.gov/29797458" }, { "database": "PubMed", "id": "29867489", "url": "https://pubmed.ncbi.nlm.nih.gov/29867489" }, { "database": "PubMed", "id": "30070632", "url": "https://pubmed.ncbi.nlm.nih.gov/30070632" }, { "database": "PubMed", "id": "30107531", "url": "https://pubmed.ncbi.nlm.nih.gov/30107531" }, { "database": "PubMed", "id": "30108694", "url": "https://pubmed.ncbi.nlm.nih.gov/30108694" }, { "database": "PubMed", "id": "30143645", "url": "https://pubmed.ncbi.nlm.nih.gov/30143645" }, { "database": "PubMed", "id": "30224299", "url": "https://pubmed.ncbi.nlm.nih.gov/30224299" }, { "database": "PubMed", "id": "30266298", "url": "https://pubmed.ncbi.nlm.nih.gov/30266298" }, { "database": "PubMed", "id": "30333721", "url": "https://pubmed.ncbi.nlm.nih.gov/30333721" }, { "database": "PubMed", "id": "30353167", "url": "https://pubmed.ncbi.nlm.nih.gov/30353167" }, { "database": "PubMed", "id": "30364083", "url": "https://pubmed.ncbi.nlm.nih.gov/30364083" }, { "database": "PubMed", "id": "30528455", "url": "https://pubmed.ncbi.nlm.nih.gov/30528455" }, { "database": "PubMed", "id": "30542122", "url": "https://pubmed.ncbi.nlm.nih.gov/30542122" }, { "database": "PubMed", "id": "30559339", "url": "https://pubmed.ncbi.nlm.nih.gov/30559339" }, { "database": "PubMed", "id": "30606233", "url": "https://pubmed.ncbi.nlm.nih.gov/30606233" }, { "database": "PubMed", "id": "30648776", "url": "https://pubmed.ncbi.nlm.nih.gov/30648776" }, { "database": "PubMed", "id": "30741923", "url": "https://pubmed.ncbi.nlm.nih.gov/30741923" }, { "database": "PubMed", "id": "30791634", "url": "https://pubmed.ncbi.nlm.nih.gov/30791634" }, { "database": "PubMed", "id": "30818341", "url": "https://pubmed.ncbi.nlm.nih.gov/30818341" }, { "database": "PubMed", "id": "30870482", "url": "https://pubmed.ncbi.nlm.nih.gov/30870482" }, { "database": "PubMed", "id": "30899259", "url": "https://pubmed.ncbi.nlm.nih.gov/30899259" }, { "database": "PubMed", "id": "30918582", "url": "https://pubmed.ncbi.nlm.nih.gov/30918582" }, { "database": "PubMed", "id": "30953001", "url": "https://pubmed.ncbi.nlm.nih.gov/30953001" }, { "database": "PubMed", "id": "30988739", "url": "https://pubmed.ncbi.nlm.nih.gov/30988739" }, { "database": "PubMed", "id": "30993885", "url": "https://pubmed.ncbi.nlm.nih.gov/30993885" }, { "database": "PubMed", "id": "31049028", "url": "https://pubmed.ncbi.nlm.nih.gov/31049028" }, { "database": "PubMed", "id": "31066230", "url": "https://pubmed.ncbi.nlm.nih.gov/31066230" }, { "database": "PubMed", "id": "31072360", "url": "https://pubmed.ncbi.nlm.nih.gov/31072360" }, { "database": "PubMed", "id": "31073117", "url": "https://pubmed.ncbi.nlm.nih.gov/31073117" }, { "database": "PubMed", "id": "31115390", "url": "https://pubmed.ncbi.nlm.nih.gov/31115390" }, { "database": "PubMed", "id": "31161238", "url": "https://pubmed.ncbi.nlm.nih.gov/31161238" }, { "database": "PubMed", "id": "31176371", "url": "https://pubmed.ncbi.nlm.nih.gov/31176371" }, { "database": "PubMed", "id": "31217524", "url": "https://pubmed.ncbi.nlm.nih.gov/31217524" }, { "database": "PubMed", "id": "31292446", "url": "https://pubmed.ncbi.nlm.nih.gov/31292446" }, { "database": "PubMed", "id": "31315045", "url": "https://pubmed.ncbi.nlm.nih.gov/31315045" }, { "database": "PubMed", "id": "31474764", "url": "https://pubmed.ncbi.nlm.nih.gov/31474764" }, { "database": "PubMed", "id": "31474988", "url": "https://pubmed.ncbi.nlm.nih.gov/31474988" }, { "database": "PubMed", "id": "31506552", "url": "https://pubmed.ncbi.nlm.nih.gov/31506552" }, { "database": "PubMed", "id": "31552035", "url": "https://pubmed.ncbi.nlm.nih.gov/31552035" }, { "database": "PubMed", "id": "31581535", "url": "https://pubmed.ncbi.nlm.nih.gov/31581535" }, { "database": "PubMed", "id": "31601900", "url": "https://pubmed.ncbi.nlm.nih.gov/31601900" }, { "database": "PubMed", "id": "31683879", "url": "https://pubmed.ncbi.nlm.nih.gov/31683879" }, { "database": "PubMed", "id": "31699972", "url": "https://pubmed.ncbi.nlm.nih.gov/31699972" }, { "database": "PubMed", "id": "31770366", "url": "https://pubmed.ncbi.nlm.nih.gov/31770366" }, { "database": "PubMed", "id": "31780948", "url": "https://pubmed.ncbi.nlm.nih.gov/31780948" }, { "database": "PubMed", "id": "31803051", "url": "https://pubmed.ncbi.nlm.nih.gov/31803051" }, { "database": "PubMed", "id": "31819365", "url": "https://pubmed.ncbi.nlm.nih.gov/31819365" }, { "database": "PubMed", "id": "31862381", "url": "https://pubmed.ncbi.nlm.nih.gov/31862381" }, { "database": "PubMed", "id": "31885639", "url": "https://pubmed.ncbi.nlm.nih.gov/31885639" }, { "database": "PubMed", "id": "31924750", "url": "https://pubmed.ncbi.nlm.nih.gov/31924750" }, { "database": "PubMed", "id": "32025217", "url": "https://pubmed.ncbi.nlm.nih.gov/32025217" }, { "database": "PubMed", "id": "32041943", "url": "https://pubmed.ncbi.nlm.nih.gov/32041943" }, { "database": "PubMed", "id": "32064174", "url": "https://pubmed.ncbi.nlm.nih.gov/32064174" }, { "database": "PubMed", "id": "32183406", "url": "https://pubmed.ncbi.nlm.nih.gov/32183406" }, { "database": "PubMed", "id": "32210977", "url": "https://pubmed.ncbi.nlm.nih.gov/32210977" }, { "database": "PubMed", "id": "32286285", "url": "https://pubmed.ncbi.nlm.nih.gov/32286285" }, { "database": "PubMed", "id": "32308756", "url": "https://pubmed.ncbi.nlm.nih.gov/32308756" }, { "database": "PubMed", "id": "32312954", "url": "https://pubmed.ncbi.nlm.nih.gov/32312954" }, { "database": "PubMed", "id": "32467752", "url": "https://pubmed.ncbi.nlm.nih.gov/32467752" }, { "database": "PubMed", "id": "32483468", "url": "https://pubmed.ncbi.nlm.nih.gov/32483468" }, { "database": "PubMed", "id": "32527985", "url": "https://pubmed.ncbi.nlm.nih.gov/32527985" }, { "database": "PubMed", "id": "32627301", "url": "https://pubmed.ncbi.nlm.nih.gov/32627301" }, { "database": "PubMed", "id": "32694788", "url": "https://pubmed.ncbi.nlm.nih.gov/32694788" }, { "database": "PubMed", "id": "32732870", "url": "https://pubmed.ncbi.nlm.nih.gov/32732870" }, { "database": "PubMed", "id": "32871210", "url": "https://pubmed.ncbi.nlm.nih.gov/32871210" }, { "database": "PubMed", "id": "32943679", "url": "https://pubmed.ncbi.nlm.nih.gov/32943679" }, { "database": "PubMed", "id": "32999332", "url": "https://pubmed.ncbi.nlm.nih.gov/32999332" }, { "database": "PubMed", "id": "33040485", "url": "https://pubmed.ncbi.nlm.nih.gov/33040485" }, { "database": "PubMed", "id": "33082817", "url": "https://pubmed.ncbi.nlm.nih.gov/33082817" }, { "database": "PubMed", "id": "33287358", "url": "https://pubmed.ncbi.nlm.nih.gov/33287358" }, { "database": "PubMed", "id": "33294147", "url": "https://pubmed.ncbi.nlm.nih.gov/33294147" }, { "database": "PubMed", "id": "33298620", "url": "https://pubmed.ncbi.nlm.nih.gov/33298620" }, { "database": "PubMed", "id": "33332446", "url": "https://pubmed.ncbi.nlm.nih.gov/33332446" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33413536", "url": "https://pubmed.ncbi.nlm.nih.gov/33413536" }, { "database": "PubMed", "id": "33428604", "url": "https://pubmed.ncbi.nlm.nih.gov/33428604" }, { "database": "PubMed", "id": "33491667", "url": "https://pubmed.ncbi.nlm.nih.gov/33491667" }, { "database": "PubMed", "id": "33500396", "url": "https://pubmed.ncbi.nlm.nih.gov/33500396" }, { "database": "PubMed", "id": "33539470", "url": "https://pubmed.ncbi.nlm.nih.gov/33539470" }, { "database": "PubMed", "id": "33672392", "url": "https://pubmed.ncbi.nlm.nih.gov/33672392" }, { "database": "PubMed", "id": "33758164", "url": "https://pubmed.ncbi.nlm.nih.gov/33758164" }, { "database": "PubMed", "id": "33803551", "url": "https://pubmed.ncbi.nlm.nih.gov/33803551" }, { "database": "PubMed", "id": "33824326", "url": "https://pubmed.ncbi.nlm.nih.gov/33824326" }, { "database": "PubMed", "id": "33828598", "url": "https://pubmed.ncbi.nlm.nih.gov/33828598" }, { "database": "PubMed", "id": "33859760", "url": "https://pubmed.ncbi.nlm.nih.gov/33859760" }, { "database": "PubMed", "id": "33985537", "url": "https://pubmed.ncbi.nlm.nih.gov/33985537" }, { "database": "PubMed", "id": "35411090", "url": "https://pubmed.ncbi.nlm.nih.gov/35411090" }, { "database": "PubMed", "id": "35585990", "url": "https://pubmed.ncbi.nlm.nih.gov/35585990" }, { "database": "PubMed", "id": "35732128", "url": "https://pubmed.ncbi.nlm.nih.gov/35732128" }, { "database": "PubMed", "id": "35806005", "url": "https://pubmed.ncbi.nlm.nih.gov/35806005" }, { "database": "PubMed", "id": "35917766", "url": "https://pubmed.ncbi.nlm.nih.gov/35917766" }, { "database": "PubMed", "id": "35983049", "url": "https://pubmed.ncbi.nlm.nih.gov/35983049" }, { "database": "PubMed", "id": "36010614", "url": "https://pubmed.ncbi.nlm.nih.gov/36010614" }, { "database": "PubMed", "id": "11553624", "url": "https://pubmed.ncbi.nlm.nih.gov/11553624" }, { "database": "PubMed", "id": "18034455", "url": "https://pubmed.ncbi.nlm.nih.gov/18034455" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P42227-1" }, { "start_pos": 577, "end_pos": 577, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22607", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" } ], "site_lbl": "Tyr577", "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 647, "end_pos": 647, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22607", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "8754806", "url": "https://pubmed.ncbi.nlm.nih.gov/8754806" } ], "site_lbl": "Tyr647", "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 648, "end_pos": 648, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22607", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "8754806", "url": "https://pubmed.ncbi.nlm.nih.gov/8754806" } ], "site_lbl": "Tyr648", "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 724, "end_pos": 724, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22607", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" } ], "site_lbl": "Tyr724", "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 760, "end_pos": 760, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22607", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "19286672", "url": "https://pubmed.ncbi.nlm.nih.gov/19286672" } ], "site_lbl": "Tyr760", "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 770, "end_pos": 770, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22607", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" } ], "site_lbl": "Tyr770", "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "O60674-1", "kinase_gene_name": "JAK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" }, { "database": "PubMed", "id": "9575217", "url": "https://pubmed.ncbi.nlm.nih.gov/9575217" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "P08631-1", "kinase_gene_name": "HCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "P22455-1", "kinase_gene_name": "FGFR4", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "P23458-1", "kinase_gene_name": "JAK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" }, { "database": "PubMed", "id": "19723038", "url": "https://pubmed.ncbi.nlm.nih.gov/19723038" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "P29320-1", "kinase_gene_name": "EPHA3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FER and PTK6", "evidence": [ { "database": "UniProtKB", "id": "P40763", "url": "https://www.uniprot.org/uniprotkb/P40763" }, { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" }, { "database": "IntAct", "id": "P40763", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40763*" }, { "database": "PubMed", "id": "7510216", "url": "https://pubmed.ncbi.nlm.nih.gov/7510216" }, { "database": "PubMed", "id": "8662591", "url": "https://pubmed.ncbi.nlm.nih.gov/8662591" }, { "database": "PubMed", "id": "10446219", "url": "https://pubmed.ncbi.nlm.nih.gov/10446219" }, { "database": "PubMed", "id": "10537060", "url": "https://pubmed.ncbi.nlm.nih.gov/10537060" }, { "database": "PubMed", "id": "10623619", "url": "https://pubmed.ncbi.nlm.nih.gov/10623619" }, { "database": "PubMed", "id": "10660304", "url": "https://pubmed.ncbi.nlm.nih.gov/10660304" }, { "database": "PubMed", "id": "10845908", "url": "https://pubmed.ncbi.nlm.nih.gov/10845908" }, { "database": "PubMed", "id": "11278353", "url": "https://pubmed.ncbi.nlm.nih.gov/11278353" }, { "database": "PubMed", "id": "11278729", "url": "https://pubmed.ncbi.nlm.nih.gov/11278729" }, { "database": "PubMed", "id": "11322950", "url": "https://pubmed.ncbi.nlm.nih.gov/11322950" }, { "database": "PubMed", "id": "11335711", "url": "https://pubmed.ncbi.nlm.nih.gov/11335711" }, { "database": "PubMed", "id": "11378264", "url": "https://pubmed.ncbi.nlm.nih.gov/11378264" }, { "database": "PubMed", "id": "11429693", "url": "https://pubmed.ncbi.nlm.nih.gov/11429693" }, { "database": "PubMed", "id": "11470914", "url": "https://pubmed.ncbi.nlm.nih.gov/11470914" }, { "database": "PubMed", "id": "11553624", "url": "https://pubmed.ncbi.nlm.nih.gov/11553624" }, { "database": "PubMed", "id": "11777539", "url": "https://pubmed.ncbi.nlm.nih.gov/11777539" }, { "database": "PubMed", "id": "12061840", "url": "https://pubmed.ncbi.nlm.nih.gov/12061840" }, { "database": "PubMed", "id": "12208879", "url": "https://pubmed.ncbi.nlm.nih.gov/12208879" }, { "database": "PubMed", "id": "12474230", "url": "https://pubmed.ncbi.nlm.nih.gov/12474230" }, { "database": "PubMed", "id": "12494267", "url": "https://pubmed.ncbi.nlm.nih.gov/12494267" }, { "database": "PubMed", "id": "12670499", "url": "https://pubmed.ncbi.nlm.nih.gov/12670499" }, { "database": "PubMed", "id": "12763138", "url": "https://pubmed.ncbi.nlm.nih.gov/12763138" }, { "database": "PubMed", "id": "12842895", "url": "https://pubmed.ncbi.nlm.nih.gov/12842895" }, { "database": "PubMed", "id": "13678425", "url": "https://pubmed.ncbi.nlm.nih.gov/13678425" }, { "database": "PubMed", "id": "14701810", "url": "https://pubmed.ncbi.nlm.nih.gov/14701810" }, { "database": "PubMed", "id": "14963038", "url": "https://pubmed.ncbi.nlm.nih.gov/14963038" }, { "database": "PubMed", "id": "14996842", "url": "https://pubmed.ncbi.nlm.nih.gov/14996842" }, { "database": "PubMed", "id": "14999683", "url": "https://pubmed.ncbi.nlm.nih.gov/14999683" }, { "database": "PubMed", "id": "15030166", "url": "https://pubmed.ncbi.nlm.nih.gov/15030166" }, { "database": "PubMed", "id": "15143062", "url": "https://pubmed.ncbi.nlm.nih.gov/15143062" }, { "database": "PubMed", "id": "15155836", "url": "https://pubmed.ncbi.nlm.nih.gov/15155836" }, { "database": "PubMed", "id": "15173005", "url": "https://pubmed.ncbi.nlm.nih.gov/15173005" }, { "database": "PubMed", "id": "15174071", "url": "https://pubmed.ncbi.nlm.nih.gov/15174071" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15527783", "url": "https://pubmed.ncbi.nlm.nih.gov/15527783" }, { "database": "PubMed", "id": "15705894", "url": "https://pubmed.ncbi.nlm.nih.gov/15705894" }, { "database": "PubMed", "id": "15753368", "url": "https://pubmed.ncbi.nlm.nih.gov/15753368" }, { "database": "PubMed", "id": "15864742", "url": "https://pubmed.ncbi.nlm.nih.gov/15864742" }, { "database": "PubMed", "id": "16048438", "url": "https://pubmed.ncbi.nlm.nih.gov/16048438" }, { "database": "PubMed", "id": "16081048", "url": "https://pubmed.ncbi.nlm.nih.gov/16081048" }, { "database": "PubMed", "id": "16150460", "url": "https://pubmed.ncbi.nlm.nih.gov/16150460" }, { "database": "PubMed", "id": "16247467", "url": "https://pubmed.ncbi.nlm.nih.gov/16247467" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16384639", "url": "https://pubmed.ncbi.nlm.nih.gov/16384639" }, { "database": "PubMed", "id": "16401721", "url": "https://pubmed.ncbi.nlm.nih.gov/16401721" }, { "database": "PubMed", "id": "16413037", "url": "https://pubmed.ncbi.nlm.nih.gov/16413037" }, { "database": "PubMed", "id": "16427042", "url": "https://pubmed.ncbi.nlm.nih.gov/16427042" }, { "database": "PubMed", "id": "16455651", "url": "https://pubmed.ncbi.nlm.nih.gov/16455651" }, { "database": "PubMed", "id": "16463269", "url": "https://pubmed.ncbi.nlm.nih.gov/16463269" }, { "database": "PubMed", "id": "16603078", "url": "https://pubmed.ncbi.nlm.nih.gov/16603078" }, { "database": "PubMed", "id": "16613491", "url": "https://pubmed.ncbi.nlm.nih.gov/16613491" }, { "database": "PubMed", "id": "16619044", "url": "https://pubmed.ncbi.nlm.nih.gov/16619044" }, { "database": "PubMed", "id": "16651438", "url": "https://pubmed.ncbi.nlm.nih.gov/16651438" }, { "database": "PubMed", "id": "16669628", "url": "https://pubmed.ncbi.nlm.nih.gov/16669628" }, { "database": "PubMed", "id": "16801397", "url": "https://pubmed.ncbi.nlm.nih.gov/16801397" }, { "database": "PubMed", "id": "16846476", "url": "https://pubmed.ncbi.nlm.nih.gov/16846476" }, { "database": "PubMed", "id": "16849418", "url": "https://pubmed.ncbi.nlm.nih.gov/16849418" }, { "database": "PubMed", "id": "16951338", "url": "https://pubmed.ncbi.nlm.nih.gov/16951338" }, { "database": "PubMed", "id": "17008315", "url": "https://pubmed.ncbi.nlm.nih.gov/17008315" }, { "database": "PubMed", "id": "17173857", "url": "https://pubmed.ncbi.nlm.nih.gov/17173857" }, { "database": "PubMed", "id": "17176261", "url": "https://pubmed.ncbi.nlm.nih.gov/17176261" }, { "database": "PubMed", "id": "17202361", "url": "https://pubmed.ncbi.nlm.nih.gov/17202361" }, { "database": "PubMed", "id": "17204573", "url": "https://pubmed.ncbi.nlm.nih.gov/17204573" }, { "database": "PubMed", "id": "17237271", "url": "https://pubmed.ncbi.nlm.nih.gov/17237271" }, { "database": "PubMed", "id": "17311011", "url": "https://pubmed.ncbi.nlm.nih.gov/17311011" }, { "database": "PubMed", "id": "17341659", "url": "https://pubmed.ncbi.nlm.nih.gov/17341659" }, { "database": "PubMed", "id": "17432718", "url": "https://pubmed.ncbi.nlm.nih.gov/17432718" }, { "database": "PubMed", "id": "17543278", "url": "https://pubmed.ncbi.nlm.nih.gov/17543278" }, { "database": "PubMed", "id": "17575268", "url": "https://pubmed.ncbi.nlm.nih.gov/17575268" }, { "database": "PubMed", "id": "17586727", "url": "https://pubmed.ncbi.nlm.nih.gov/17586727" }, { "database": "PubMed", "id": "17616983", "url": "https://pubmed.ncbi.nlm.nih.gov/17616983" }, { "database": "PubMed", "id": "17670892", "url": "https://pubmed.ncbi.nlm.nih.gov/17670892" }, { "database": "PubMed", "id": "17761947", "url": "https://pubmed.ncbi.nlm.nih.gov/17761947" }, { "database": "PubMed", "id": "17931419", "url": "https://pubmed.ncbi.nlm.nih.gov/17931419" }, { "database": "PubMed", "id": "17967179", "url": "https://pubmed.ncbi.nlm.nih.gov/17967179" }, { "database": "PubMed", "id": "18196976", "url": "https://pubmed.ncbi.nlm.nih.gov/18196976" }, { "database": "PubMed", "id": "18198175", "url": "https://pubmed.ncbi.nlm.nih.gov/18198175" }, { "database": "PubMed", "id": "18203738", "url": "https://pubmed.ncbi.nlm.nih.gov/18203738" }, { "database": "PubMed", "id": "18204781", "url": "https://pubmed.ncbi.nlm.nih.gov/18204781" }, { "database": "PubMed", "id": "18353781", "url": "https://pubmed.ncbi.nlm.nih.gov/18353781" }, { "database": "PubMed", "id": "18365011", "url": "https://pubmed.ncbi.nlm.nih.gov/18365011" }, { "database": "PubMed", "id": "18463684", "url": "https://pubmed.ncbi.nlm.nih.gov/18463684" }, { "database": "PubMed", "id": "18498667", "url": "https://pubmed.ncbi.nlm.nih.gov/18498667" }, { "database": "PubMed", "id": "18519681", "url": "https://pubmed.ncbi.nlm.nih.gov/18519681" }, { "database": "PubMed", "id": "18525315", "url": "https://pubmed.ncbi.nlm.nih.gov/18525315" }, { "database": "PubMed", "id": "18544087", "url": "https://pubmed.ncbi.nlm.nih.gov/18544087" }, { "database": "PubMed", "id": "18550668", "url": "https://pubmed.ncbi.nlm.nih.gov/18550668" }, { "database": "PubMed", "id": "18593565", "url": "https://pubmed.ncbi.nlm.nih.gov/18593565" }, { "database": "PubMed", "id": "18612371", "url": "https://pubmed.ncbi.nlm.nih.gov/18612371" }, { "database": "PubMed", "id": "18755267", "url": "https://pubmed.ncbi.nlm.nih.gov/18755267" }, { "database": "PubMed", "id": "18755494", "url": "https://pubmed.ncbi.nlm.nih.gov/18755494" }, { "database": "PubMed", "id": "18779368", "url": "https://pubmed.ncbi.nlm.nih.gov/18779368" }, { "database": "PubMed", "id": "18790750", "url": "https://pubmed.ncbi.nlm.nih.gov/18790750" }, { "database": "PubMed", "id": "18939995", "url": "https://pubmed.ncbi.nlm.nih.gov/18939995" }, { "database": "PubMed", "id": "18941632", "url": "https://pubmed.ncbi.nlm.nih.gov/18941632" }, { "database": "PubMed", "id": "18995957", "url": "https://pubmed.ncbi.nlm.nih.gov/18995957" }, { "database": "PubMed", "id": "19001435", "url": "https://pubmed.ncbi.nlm.nih.gov/19001435" }, { "database": "PubMed", "id": "19025606", "url": "https://pubmed.ncbi.nlm.nih.gov/19025606" }, { "database": "PubMed", "id": "19118003", "url": "https://pubmed.ncbi.nlm.nih.gov/19118003" }, { "database": "PubMed", "id": "19182994", "url": "https://pubmed.ncbi.nlm.nih.gov/19182994" }, { "database": "PubMed", "id": "19201396", "url": "https://pubmed.ncbi.nlm.nih.gov/19201396" }, { "database": "PubMed", "id": "19232485", "url": "https://pubmed.ncbi.nlm.nih.gov/19232485" }, { "database": "PubMed", "id": "19351839", "url": "https://pubmed.ncbi.nlm.nih.gov/19351839" }, { "database": "PubMed", "id": "19421230", "url": "https://pubmed.ncbi.nlm.nih.gov/19421230" }, { "database": "PubMed", "id": "19440292", "url": "https://pubmed.ncbi.nlm.nih.gov/19440292" }, { "database": "PubMed", "id": "19506034", "url": "https://pubmed.ncbi.nlm.nih.gov/19506034" }, { "database": "PubMed", "id": "19595669", "url": "https://pubmed.ncbi.nlm.nih.gov/19595669" }, { "database": "PubMed", "id": "19623660", "url": "https://pubmed.ncbi.nlm.nih.gov/19623660" }, { "database": "PubMed", "id": "19712481", "url": "https://pubmed.ncbi.nlm.nih.gov/19712481" }, { "database": "PubMed", "id": "19723038", "url": "https://pubmed.ncbi.nlm.nih.gov/19723038" }, { "database": "PubMed", "id": "19741197", "url": "https://pubmed.ncbi.nlm.nih.gov/19741197" }, { "database": "PubMed", "id": "19744341", "url": "https://pubmed.ncbi.nlm.nih.gov/19744341" }, { "database": "PubMed", "id": "19754877", "url": "https://pubmed.ncbi.nlm.nih.gov/19754877" }, { "database": "PubMed", "id": "19764570", "url": "https://pubmed.ncbi.nlm.nih.gov/19764570" }, { "database": "PubMed", "id": "19808903", "url": "https://pubmed.ncbi.nlm.nih.gov/19808903" }, { "database": "PubMed", "id": "19821497", "url": "https://pubmed.ncbi.nlm.nih.gov/19821497" }, { "database": "PubMed", "id": "19901082", "url": "https://pubmed.ncbi.nlm.nih.gov/19901082" }, { "database": "PubMed", "id": "19903761", "url": "https://pubmed.ncbi.nlm.nih.gov/19903761" }, { "database": "PubMed", "id": "19903771", "url": "https://pubmed.ncbi.nlm.nih.gov/19903771" }, { "database": "PubMed", "id": "19995546", "url": "https://pubmed.ncbi.nlm.nih.gov/19995546" }, { "database": "PubMed", "id": "20072652", "url": "https://pubmed.ncbi.nlm.nih.gov/20072652" }, { "database": "PubMed", "id": "20156552", "url": "https://pubmed.ncbi.nlm.nih.gov/20156552" }, { "database": "PubMed", "id": "20169197", "url": "https://pubmed.ncbi.nlm.nih.gov/20169197" }, { "database": "PubMed", "id": "20228845", "url": "https://pubmed.ncbi.nlm.nih.gov/20228845" }, { "database": "PubMed", "id": "20233902", "url": "https://pubmed.ncbi.nlm.nih.gov/20233902" }, { "database": "PubMed", "id": "20351777", "url": "https://pubmed.ncbi.nlm.nih.gov/20351777" }, { "database": "PubMed", "id": "20371721", "url": "https://pubmed.ncbi.nlm.nih.gov/20371721" }, { "database": "PubMed", "id": "20455003", "url": "https://pubmed.ncbi.nlm.nih.gov/20455003" }, { "database": "PubMed", "id": "20507639", "url": "https://pubmed.ncbi.nlm.nih.gov/20507639" }, { "database": "PubMed", "id": "20534983", "url": "https://pubmed.ncbi.nlm.nih.gov/20534983" }, { "database": "PubMed", "id": "20576164", "url": "https://pubmed.ncbi.nlm.nih.gov/20576164" }, { "database": "PubMed", "id": "20589525", "url": "https://pubmed.ncbi.nlm.nih.gov/20589525" }, { "database": "PubMed", "id": "20712901", "url": "https://pubmed.ncbi.nlm.nih.gov/20712901" }, { "database": "PubMed", "id": "20724373", "url": "https://pubmed.ncbi.nlm.nih.gov/20724373" }, { "database": "PubMed", "id": "20808823", "url": "https://pubmed.ncbi.nlm.nih.gov/20808823" }, { "database": "PubMed", "id": "20840775", "url": "https://pubmed.ncbi.nlm.nih.gov/20840775" }, { "database": "PubMed", "id": "20851386", "url": "https://pubmed.ncbi.nlm.nih.gov/20851386" }, { "database": "PubMed", "id": "20877211", "url": "https://pubmed.ncbi.nlm.nih.gov/20877211" }, { "database": "PubMed", "id": "20959517", "url": "https://pubmed.ncbi.nlm.nih.gov/20959517" }, { "database": "PubMed", "id": "20977777", "url": "https://pubmed.ncbi.nlm.nih.gov/20977777" }, { "database": "PubMed", "id": "21098725", "url": "https://pubmed.ncbi.nlm.nih.gov/21098725" }, { "database": "PubMed", "id": "21122157", "url": "https://pubmed.ncbi.nlm.nih.gov/21122157" }, { "database": "PubMed", "id": "21163886", "url": "https://pubmed.ncbi.nlm.nih.gov/21163886" }, { "database": "PubMed", "id": "21253577", "url": "https://pubmed.ncbi.nlm.nih.gov/21253577" }, { "database": "PubMed", "id": "21254404", "url": "https://pubmed.ncbi.nlm.nih.gov/21254404" }, { "database": "PubMed", "id": "21311975", "url": "https://pubmed.ncbi.nlm.nih.gov/21311975" }, { "database": "PubMed", "id": "21360612", "url": "https://pubmed.ncbi.nlm.nih.gov/21360612" }, { "database": "PubMed", "id": "21369699", "url": "https://pubmed.ncbi.nlm.nih.gov/21369699" }, { "database": "PubMed", "id": "21388555", "url": "https://pubmed.ncbi.nlm.nih.gov/21388555" }, { "database": "PubMed", "id": "21435102", "url": "https://pubmed.ncbi.nlm.nih.gov/21435102" }, { "database": "PubMed", "id": "21443800", "url": "https://pubmed.ncbi.nlm.nih.gov/21443800" }, { "database": "PubMed", "id": "21486470", "url": "https://pubmed.ncbi.nlm.nih.gov/21486470" }, { "database": "PubMed", "id": "21490133", "url": "https://pubmed.ncbi.nlm.nih.gov/21490133" }, { "database": "PubMed", "id": "21524651", "url": "https://pubmed.ncbi.nlm.nih.gov/21524651" }, { "database": "PubMed", "id": "21526200", "url": "https://pubmed.ncbi.nlm.nih.gov/21526200" }, { "database": "PubMed", "id": "21538419", "url": "https://pubmed.ncbi.nlm.nih.gov/21538419" }, { "database": "PubMed", "id": "21625473", "url": "https://pubmed.ncbi.nlm.nih.gov/21625473" }, { "database": "PubMed", "id": "21625522", "url": "https://pubmed.ncbi.nlm.nih.gov/21625522" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21655185", "url": "https://pubmed.ncbi.nlm.nih.gov/21655185" }, { "database": "PubMed", "id": "21677772", "url": "https://pubmed.ncbi.nlm.nih.gov/21677772" }, { "database": "PubMed", "id": "21685938", "url": "https://pubmed.ncbi.nlm.nih.gov/21685938" }, { "database": "PubMed", "id": "21689417", "url": "https://pubmed.ncbi.nlm.nih.gov/21689417" }, { "database": "PubMed", "id": "21690253", "url": "https://pubmed.ncbi.nlm.nih.gov/21690253" }, { "database": "PubMed", "id": "21694723", "url": "https://pubmed.ncbi.nlm.nih.gov/21694723" }, { "database": "PubMed", "id": "21730976", "url": "https://pubmed.ncbi.nlm.nih.gov/21730976" }, { "database": "PubMed", "id": "21738667", "url": "https://pubmed.ncbi.nlm.nih.gov/21738667" }, { "database": "PubMed", "id": "21785467", "url": "https://pubmed.ncbi.nlm.nih.gov/21785467" }, { "database": "PubMed", "id": "21799891", "url": "https://pubmed.ncbi.nlm.nih.gov/21799891" }, { "database": "PubMed", "id": "21801384", "url": "https://pubmed.ncbi.nlm.nih.gov/21801384" }, { "database": "PubMed", "id": "21840932", "url": "https://pubmed.ncbi.nlm.nih.gov/21840932" }, { "database": "PubMed", "id": "21906308", "url": "https://pubmed.ncbi.nlm.nih.gov/21906308" }, { "database": "PubMed", "id": "21915376", "url": "https://pubmed.ncbi.nlm.nih.gov/21915376" }, { "database": "PubMed", "id": "21931595", "url": "https://pubmed.ncbi.nlm.nih.gov/21931595" }, { "database": "PubMed", "id": "21954831", "url": "https://pubmed.ncbi.nlm.nih.gov/21954831" }, { "database": "PubMed", "id": "22016776", "url": "https://pubmed.ncbi.nlm.nih.gov/22016776" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22142222", "url": "https://pubmed.ncbi.nlm.nih.gov/22142222" }, { "database": "PubMed", "id": "22174695", "url": "https://pubmed.ncbi.nlm.nih.gov/22174695" }, { "database": "PubMed", "id": "22174819", "url": "https://pubmed.ncbi.nlm.nih.gov/22174819" }, { "database": "PubMed", "id": "22179221", "url": "https://pubmed.ncbi.nlm.nih.gov/22179221" }, { "database": "PubMed", "id": "22210382", "url": "https://pubmed.ncbi.nlm.nih.gov/22210382" }, { "database": "PubMed", "id": "22259633", "url": "https://pubmed.ncbi.nlm.nih.gov/22259633" }, { "database": "PubMed", "id": "22279540", "url": "https://pubmed.ncbi.nlm.nih.gov/22279540" }, { "database": "PubMed", "id": "22280969", "url": "https://pubmed.ncbi.nlm.nih.gov/22280969" }, { "database": "PubMed", "id": "22313388", "url": "https://pubmed.ncbi.nlm.nih.gov/22313388" }, { "database": "PubMed", "id": "22315522", "url": "https://pubmed.ncbi.nlm.nih.gov/22315522" }, { "database": "PubMed", "id": "22349830", "url": "https://pubmed.ncbi.nlm.nih.gov/22349830" }, { "database": "PubMed", "id": "22351606", "url": "https://pubmed.ncbi.nlm.nih.gov/22351606" }, { "database": "PubMed", "id": "22359610", "url": "https://pubmed.ncbi.nlm.nih.gov/22359610" }, { "database": "PubMed", "id": "22366233", "url": "https://pubmed.ncbi.nlm.nih.gov/22366233" }, { "database": "PubMed", "id": "22370645", "url": "https://pubmed.ncbi.nlm.nih.gov/22370645" }, { "database": "PubMed", "id": "22374428", "url": "https://pubmed.ncbi.nlm.nih.gov/22374428" }, { "database": "PubMed", "id": "22406995", "url": "https://pubmed.ncbi.nlm.nih.gov/22406995" }, { "database": "PubMed", "id": "22418867", "url": "https://pubmed.ncbi.nlm.nih.gov/22418867" }, { "database": "PubMed", "id": "22450744", "url": "https://pubmed.ncbi.nlm.nih.gov/22450744" }, { "database": "PubMed", "id": "22461519", "url": "https://pubmed.ncbi.nlm.nih.gov/22461519" }, { "database": "PubMed", "id": "22465052", "url": "https://pubmed.ncbi.nlm.nih.gov/22465052" }, { "database": "PubMed", "id": "22484976", "url": "https://pubmed.ncbi.nlm.nih.gov/22484976" }, { "database": "PubMed", "id": "22504904", "url": "https://pubmed.ncbi.nlm.nih.gov/22504904" }, { "database": "PubMed", "id": "22522613", "url": "https://pubmed.ncbi.nlm.nih.gov/22522613" }, { "database": "PubMed", "id": "22581261", "url": "https://pubmed.ncbi.nlm.nih.gov/22581261" }, { "database": "PubMed", "id": "22642622", "url": "https://pubmed.ncbi.nlm.nih.gov/22642622" }, { "database": "PubMed", "id": "22677902", "url": "https://pubmed.ncbi.nlm.nih.gov/22677902" }, { "database": "PubMed", "id": "22754353", "url": "https://pubmed.ncbi.nlm.nih.gov/22754353" }, { "database": "PubMed", "id": "22799634", "url": "https://pubmed.ncbi.nlm.nih.gov/22799634" }, { "database": "PubMed", "id": "22801507", "url": "https://pubmed.ncbi.nlm.nih.gov/22801507" }, { "database": "PubMed", "id": "22824293", "url": "https://pubmed.ncbi.nlm.nih.gov/22824293" }, { "database": "PubMed", "id": "22829072", "url": "https://pubmed.ncbi.nlm.nih.gov/22829072" }, { "database": "PubMed", "id": "22870139", "url": "https://pubmed.ncbi.nlm.nih.gov/22870139" }, { "database": "PubMed", "id": "22899991", "url": "https://pubmed.ncbi.nlm.nih.gov/22899991" }, { "database": "PubMed", "id": "22905257", "url": "https://pubmed.ncbi.nlm.nih.gov/22905257" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22922995", "url": "https://pubmed.ncbi.nlm.nih.gov/22922995" }, { "database": "PubMed", "id": "22937084", "url": "https://pubmed.ncbi.nlm.nih.gov/22937084" }, { "database": "PubMed", "id": "22978563", "url": "https://pubmed.ncbi.nlm.nih.gov/22978563" }, { "database": "PubMed", "id": "22984561", "url": "https://pubmed.ncbi.nlm.nih.gov/22984561" }, { "database": "PubMed", "id": "22987802", "url": "https://pubmed.ncbi.nlm.nih.gov/22987802" }, { "database": "PubMed", "id": "23007731", "url": "https://pubmed.ncbi.nlm.nih.gov/23007731" }, { "database": "PubMed", "id": "23056374", "url": "https://pubmed.ncbi.nlm.nih.gov/23056374" }, { "database": "PubMed", "id": "23056515", "url": "https://pubmed.ncbi.nlm.nih.gov/23056515" }, { "database": "PubMed", "id": "23074171", "url": "https://pubmed.ncbi.nlm.nih.gov/23074171" }, { "database": "PubMed", "id": "23094050", "url": "https://pubmed.ncbi.nlm.nih.gov/23094050" }, { "database": "PubMed", "id": "23108098", "url": "https://pubmed.ncbi.nlm.nih.gov/23108098" }, { "database": "PubMed", "id": "23125416", "url": "https://pubmed.ncbi.nlm.nih.gov/23125416" }, { "database": "PubMed", "id": "23166634", "url": "https://pubmed.ncbi.nlm.nih.gov/23166634" }, { "database": "PubMed", "id": "23189171", "url": "https://pubmed.ncbi.nlm.nih.gov/23189171" }, { "database": "PubMed", "id": "23226414", "url": "https://pubmed.ncbi.nlm.nih.gov/23226414" }, { "database": "PubMed", "id": "23251493", "url": "https://pubmed.ncbi.nlm.nih.gov/23251493" }, { "database": "PubMed", "id": "23279849", "url": "https://pubmed.ncbi.nlm.nih.gov/23279849" }, { "database": "PubMed", "id": "23303450", "url": "https://pubmed.ncbi.nlm.nih.gov/23303450" }, { "database": "PubMed", "id": "23318430", "url": "https://pubmed.ncbi.nlm.nih.gov/23318430" }, { "database": "PubMed", "id": "23322008", "url": "https://pubmed.ncbi.nlm.nih.gov/23322008" }, { "database": "PubMed", "id": "23326583", "url": "https://pubmed.ncbi.nlm.nih.gov/23326583" }, { "database": "PubMed", "id": "23350355", "url": "https://pubmed.ncbi.nlm.nih.gov/23350355" }, { "database": "PubMed", "id": "23372833", "url": "https://pubmed.ncbi.nlm.nih.gov/23372833" }, { "database": "PubMed", "id": "23382914", "url": "https://pubmed.ncbi.nlm.nih.gov/23382914" }, { "database": "PubMed", "id": "23416975", "url": "https://pubmed.ncbi.nlm.nih.gov/23416975" }, { "database": "PubMed", "id": "23434226", "url": "https://pubmed.ncbi.nlm.nih.gov/23434226" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23446809", "url": "https://pubmed.ncbi.nlm.nih.gov/23446809" }, { "database": "PubMed", "id": "23455323", "url": "https://pubmed.ncbi.nlm.nih.gov/23455323" }, { "database": "PubMed", "id": "23496892", "url": "https://pubmed.ncbi.nlm.nih.gov/23496892" }, { "database": "PubMed", "id": "23525442", "url": "https://pubmed.ncbi.nlm.nih.gov/23525442" }, { "database": "PubMed", "id": "23528817", "url": "https://pubmed.ncbi.nlm.nih.gov/23528817" }, { "database": "PubMed", "id": "23614738", "url": "https://pubmed.ncbi.nlm.nih.gov/23614738" }, { "database": "PubMed", "id": "23637829", "url": "https://pubmed.ncbi.nlm.nih.gov/23637829" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23686482", "url": "https://pubmed.ncbi.nlm.nih.gov/23686482" }, { "database": "PubMed", "id": "23690956", "url": "https://pubmed.ncbi.nlm.nih.gov/23690956" }, { "database": "PubMed", "id": "23704931", "url": "https://pubmed.ncbi.nlm.nih.gov/23704931" }, { "database": "PubMed", "id": "23740516", "url": "https://pubmed.ncbi.nlm.nih.gov/23740516" }, { "database": "PubMed", "id": "23755918", "url": "https://pubmed.ncbi.nlm.nih.gov/23755918" }, { "database": "PubMed", "id": "23756865", "url": "https://pubmed.ncbi.nlm.nih.gov/23756865" }, { "database": "PubMed", "id": "23774064", "url": "https://pubmed.ncbi.nlm.nih.gov/23774064" }, { "database": "PubMed", "id": "23776396", "url": "https://pubmed.ncbi.nlm.nih.gov/23776396" }, { "database": "PubMed", "id": "23782265", "url": "https://pubmed.ncbi.nlm.nih.gov/23782265" }, { "database": "PubMed", "id": "23831387", "url": "https://pubmed.ncbi.nlm.nih.gov/23831387" }, { "database": "PubMed", "id": "23861822", "url": "https://pubmed.ncbi.nlm.nih.gov/23861822" }, { "database": "PubMed", "id": "23872421", "url": "https://pubmed.ncbi.nlm.nih.gov/23872421" }, { "database": "PubMed", "id": "23874455", "url": "https://pubmed.ncbi.nlm.nih.gov/23874455" }, { "database": "PubMed", "id": "23889739", "url": "https://pubmed.ncbi.nlm.nih.gov/23889739" }, { "database": "PubMed", "id": "23894143", "url": "https://pubmed.ncbi.nlm.nih.gov/23894143" }, { "database": "PubMed", "id": "23903834", "url": "https://pubmed.ncbi.nlm.nih.gov/23903834" }, { "database": "PubMed", "id": "23923048", "url": "https://pubmed.ncbi.nlm.nih.gov/23923048" }, { "database": "PubMed", "id": "23928694", "url": "https://pubmed.ncbi.nlm.nih.gov/23928694" }, { "database": "PubMed", "id": "23936533", "url": "https://pubmed.ncbi.nlm.nih.gov/23936533" }, { "database": "PubMed", "id": "23947369", "url": "https://pubmed.ncbi.nlm.nih.gov/23947369" }, { "database": "PubMed", "id": "23967200", "url": "https://pubmed.ncbi.nlm.nih.gov/23967200" }, { "database": "PubMed", "id": "23991099", "url": "https://pubmed.ncbi.nlm.nih.gov/23991099" }, { "database": "PubMed", "id": "24015205", "url": "https://pubmed.ncbi.nlm.nih.gov/24015205" }, { "database": "PubMed", "id": "24019973", "url": "https://pubmed.ncbi.nlm.nih.gov/24019973" }, { "database": "PubMed", "id": "24043762", "url": "https://pubmed.ncbi.nlm.nih.gov/24043762" }, { "database": "PubMed", "id": "24048798", "url": "https://pubmed.ncbi.nlm.nih.gov/24048798" }, { "database": "PubMed", "id": "24058749", "url": "https://pubmed.ncbi.nlm.nih.gov/24058749" }, { "database": "PubMed", "id": "24058783", "url": "https://pubmed.ncbi.nlm.nih.gov/24058783" }, { "database": "PubMed", "id": "24063605", "url": "https://pubmed.ncbi.nlm.nih.gov/24063605" }, { "database": "PubMed", "id": "24069562", "url": "https://pubmed.ncbi.nlm.nih.gov/24069562" }, { "database": "PubMed", "id": "24086526", "url": "https://pubmed.ncbi.nlm.nih.gov/24086526" }, { "database": "PubMed", "id": "24090995", "url": "https://pubmed.ncbi.nlm.nih.gov/24090995" }, { "database": "PubMed", "id": "24098663", "url": "https://pubmed.ncbi.nlm.nih.gov/24098663" }, { "database": "PubMed", "id": "24129709", "url": "https://pubmed.ncbi.nlm.nih.gov/24129709" }, { "database": "PubMed", "id": "24154873", "url": "https://pubmed.ncbi.nlm.nih.gov/24154873" }, { "database": "PubMed", "id": "24164699", "url": "https://pubmed.ncbi.nlm.nih.gov/24164699" }, { "database": "PubMed", "id": "24165129", "url": "https://pubmed.ncbi.nlm.nih.gov/24165129" }, { "database": "PubMed", "id": "24192293", "url": "https://pubmed.ncbi.nlm.nih.gov/24192293" }, { "database": "PubMed", "id": "24280348", "url": "https://pubmed.ncbi.nlm.nih.gov/24280348" }, { "database": "PubMed", "id": "24288470", "url": "https://pubmed.ncbi.nlm.nih.gov/24288470" }, { "database": "PubMed", "id": "24312439", "url": "https://pubmed.ncbi.nlm.nih.gov/24312439" }, { "database": "PubMed", "id": "24314214", "url": "https://pubmed.ncbi.nlm.nih.gov/24314214" }, { "database": "PubMed", "id": "24317090", "url": "https://pubmed.ncbi.nlm.nih.gov/24317090" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24324713", "url": "https://pubmed.ncbi.nlm.nih.gov/24324713" }, { "database": "PubMed", "id": "24348829", "url": "https://pubmed.ncbi.nlm.nih.gov/24348829" }, { "database": "PubMed", "id": "24418169", "url": "https://pubmed.ncbi.nlm.nih.gov/24418169" }, { "database": "PubMed", "id": "24423131", "url": "https://pubmed.ncbi.nlm.nih.gov/24423131" }, { "database": "PubMed", "id": "24499623", "url": "https://pubmed.ncbi.nlm.nih.gov/24499623" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24520293", "url": "https://pubmed.ncbi.nlm.nih.gov/24520293" }, { "database": "PubMed", "id": "24533098", "url": "https://pubmed.ncbi.nlm.nih.gov/24533098" }, { "database": "PubMed", "id": "24586249", "url": "https://pubmed.ncbi.nlm.nih.gov/24586249" }, { "database": "PubMed", "id": "24602263", "url": "https://pubmed.ncbi.nlm.nih.gov/24602263" }, { "database": "PubMed", "id": "24615012", "url": "https://pubmed.ncbi.nlm.nih.gov/24615012" }, { "database": "PubMed", "id": "24622734", "url": "https://pubmed.ncbi.nlm.nih.gov/24622734" }, { "database": "PubMed", "id": "24652192", "url": "https://pubmed.ncbi.nlm.nih.gov/24652192" }, { "database": "PubMed", "id": "24661007", "url": "https://pubmed.ncbi.nlm.nih.gov/24661007" }, { "database": "PubMed", "id": "24671465", "url": "https://pubmed.ncbi.nlm.nih.gov/24671465" }, { "database": "PubMed", "id": "24671708", "url": "https://pubmed.ncbi.nlm.nih.gov/24671708" }, { "database": "PubMed", "id": "24687132", "url": "https://pubmed.ncbi.nlm.nih.gov/24687132" }, { "database": "PubMed", "id": "24707243", "url": "https://pubmed.ncbi.nlm.nih.gov/24707243" }, { "database": "PubMed", "id": "24726840", "url": "https://pubmed.ncbi.nlm.nih.gov/24726840" }, { "database": "PubMed", "id": "24736071", "url": "https://pubmed.ncbi.nlm.nih.gov/24736071" }, { "database": "PubMed", "id": "24756126", "url": "https://pubmed.ncbi.nlm.nih.gov/24756126" }, { "database": "PubMed", "id": "24799285", "url": "https://pubmed.ncbi.nlm.nih.gov/24799285" }, { "database": "PubMed", "id": "24846175", "url": "https://pubmed.ncbi.nlm.nih.gov/24846175" }, { "database": "PubMed", "id": "24855827", "url": "https://pubmed.ncbi.nlm.nih.gov/24855827" }, { "database": "PubMed", "id": "24909826", "url": "https://pubmed.ncbi.nlm.nih.gov/24909826" }, { "database": "PubMed", "id": "24930769", "url": "https://pubmed.ncbi.nlm.nih.gov/24930769" }, { "database": "PubMed", "id": "24931163", "url": "https://pubmed.ncbi.nlm.nih.gov/24931163" }, { "database": "PubMed", "id": "24932134", "url": "https://pubmed.ncbi.nlm.nih.gov/24932134" }, { "database": "PubMed", "id": "24945434", "url": "https://pubmed.ncbi.nlm.nih.gov/24945434" }, { "database": "PubMed", "id": "24953430", "url": "https://pubmed.ncbi.nlm.nih.gov/24953430" }, { "database": "PubMed", "id": "24954857", "url": "https://pubmed.ncbi.nlm.nih.gov/24954857" }, { "database": "PubMed", "id": "24970801", "url": "https://pubmed.ncbi.nlm.nih.gov/24970801" }, { "database": "PubMed", "id": "24978112", "url": "https://pubmed.ncbi.nlm.nih.gov/24978112" }, { "database": "PubMed", "id": "25013907", "url": "https://pubmed.ncbi.nlm.nih.gov/25013907" }, { "database": "PubMed", "id": "25016575", "url": "https://pubmed.ncbi.nlm.nih.gov/25016575" }, { "database": "PubMed", "id": "25031733", "url": "https://pubmed.ncbi.nlm.nih.gov/25031733" }, { "database": "PubMed", "id": "25036749", "url": "https://pubmed.ncbi.nlm.nih.gov/25036749" }, { "database": "PubMed", "id": "25040935", "url": "https://pubmed.ncbi.nlm.nih.gov/25040935" }, { "database": "PubMed", "id": "25047660", "url": "https://pubmed.ncbi.nlm.nih.gov/25047660" }, { "database": "PubMed", "id": "25071018", "url": "https://pubmed.ncbi.nlm.nih.gov/25071018" }, { "database": "PubMed", "id": "25072782", "url": "https://pubmed.ncbi.nlm.nih.gov/25072782" }, { "database": "PubMed", "id": "25101566", "url": "https://pubmed.ncbi.nlm.nih.gov/25101566" }, { "database": "PubMed", "id": "25116684", "url": "https://pubmed.ncbi.nlm.nih.gov/25116684" }, { "database": "PubMed", "id": "25200966", "url": "https://pubmed.ncbi.nlm.nih.gov/25200966" }, { "database": "PubMed", "id": "25216529", "url": "https://pubmed.ncbi.nlm.nih.gov/25216529" }, { "database": "PubMed", "id": "25217633", "url": "https://pubmed.ncbi.nlm.nih.gov/25217633" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25231320", "url": "https://pubmed.ncbi.nlm.nih.gov/25231320" }, { "database": "PubMed", "id": "25246098", "url": "https://pubmed.ncbi.nlm.nih.gov/25246098" }, { "database": "PubMed", "id": "25252914", "url": "https://pubmed.ncbi.nlm.nih.gov/25252914" }, { "database": "PubMed", "id": "25266665", "url": "https://pubmed.ncbi.nlm.nih.gov/25266665" }, { "database": "PubMed", "id": "25296502", "url": "https://pubmed.ncbi.nlm.nih.gov/25296502" }, { "database": "PubMed", "id": "25299776", "url": "https://pubmed.ncbi.nlm.nih.gov/25299776" }, { "database": "PubMed", "id": "25327561", "url": "https://pubmed.ncbi.nlm.nih.gov/25327561" }, { "database": "PubMed", "id": "25360179", "url": "https://pubmed.ncbi.nlm.nih.gov/25360179" }, { "database": "PubMed", "id": "25373509", "url": "https://pubmed.ncbi.nlm.nih.gov/25373509" }, { "database": "PubMed", "id": "25383546", "url": "https://pubmed.ncbi.nlm.nih.gov/25383546" }, { "database": "PubMed", "id": "25393367", "url": "https://pubmed.ncbi.nlm.nih.gov/25393367" }, { "database": "PubMed", "id": "25401333", "url": "https://pubmed.ncbi.nlm.nih.gov/25401333" }, { "database": "PubMed", "id": "25417721", "url": "https://pubmed.ncbi.nlm.nih.gov/25417721" }, { "database": "PubMed", "id": "25452693", "url": "https://pubmed.ncbi.nlm.nih.gov/25452693" }, { "database": "PubMed", "id": "25476455", "url": "https://pubmed.ncbi.nlm.nih.gov/25476455" }, { "database": "PubMed", "id": "25486864", "url": "https://pubmed.ncbi.nlm.nih.gov/25486864" }, { "database": "PubMed", "id": "25512602", "url": "https://pubmed.ncbi.nlm.nih.gov/25512602" }, { "database": "PubMed", "id": "25539644", "url": "https://pubmed.ncbi.nlm.nih.gov/25539644" }, { "database": "PubMed", "id": "25544757", "url": "https://pubmed.ncbi.nlm.nih.gov/25544757" }, { "database": "PubMed", "id": "25548514", "url": "https://pubmed.ncbi.nlm.nih.gov/25548514" }, { "database": "PubMed", "id": "25561562", "url": "https://pubmed.ncbi.nlm.nih.gov/25561562" }, { "database": "PubMed", "id": "25584415", "url": "https://pubmed.ncbi.nlm.nih.gov/25584415" }, { "database": "PubMed", "id": "25594014", "url": "https://pubmed.ncbi.nlm.nih.gov/25594014" }, { "database": "PubMed", "id": "25597412", "url": "https://pubmed.ncbi.nlm.nih.gov/25597412" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25612622", "url": "https://pubmed.ncbi.nlm.nih.gov/25612622" }, { "database": "PubMed", "id": "25622587", "url": "https://pubmed.ncbi.nlm.nih.gov/25622587" }, { "database": "PubMed", "id": "25661370", "url": "https://pubmed.ncbi.nlm.nih.gov/25661370" }, { "database": "PubMed", "id": "25684140", "url": "https://pubmed.ncbi.nlm.nih.gov/25684140" }, { "database": "PubMed", "id": "25687700", "url": "https://pubmed.ncbi.nlm.nih.gov/25687700" }, { "database": "PubMed", "id": "25699542", "url": "https://pubmed.ncbi.nlm.nih.gov/25699542" }, { "database": "PubMed", "id": "25734337", "url": "https://pubmed.ncbi.nlm.nih.gov/25734337" }, { "database": "PubMed", "id": "25736961", "url": "https://pubmed.ncbi.nlm.nih.gov/25736961" }, { "database": "PubMed", "id": "25744297", "url": "https://pubmed.ncbi.nlm.nih.gov/25744297" }, { "database": "PubMed", "id": "25750173", "url": "https://pubmed.ncbi.nlm.nih.gov/25750173" }, { "database": "PubMed", "id": "25789077", "url": "https://pubmed.ncbi.nlm.nih.gov/25789077" }, { "database": "PubMed", "id": "25793261", "url": "https://pubmed.ncbi.nlm.nih.gov/25793261" }, { "database": "PubMed", "id": "25811798", "url": "https://pubmed.ncbi.nlm.nih.gov/25811798" }, { "database": "PubMed", "id": "25843671", "url": "https://pubmed.ncbi.nlm.nih.gov/25843671" }, { "database": "PubMed", "id": "25849286", "url": "https://pubmed.ncbi.nlm.nih.gov/25849286" }, { "database": "PubMed", "id": "25869100", "url": "https://pubmed.ncbi.nlm.nih.gov/25869100" }, { "database": "PubMed", "id": "25879763", "url": "https://pubmed.ncbi.nlm.nih.gov/25879763" }, { "database": "PubMed", "id": "25881314", "url": "https://pubmed.ncbi.nlm.nih.gov/25881314" }, { "database": "PubMed", "id": "25883212", "url": "https://pubmed.ncbi.nlm.nih.gov/25883212" }, { "database": "PubMed", "id": "25915430", "url": "https://pubmed.ncbi.nlm.nih.gov/25915430" }, { "database": "PubMed", "id": "25928665", "url": "https://pubmed.ncbi.nlm.nih.gov/25928665" }, { "database": "PubMed", "id": "25947346", "url": "https://pubmed.ncbi.nlm.nih.gov/25947346" }, { "database": "PubMed", "id": "25961376", "url": "https://pubmed.ncbi.nlm.nih.gov/25961376" }, { "database": "PubMed", "id": "25968054", "url": "https://pubmed.ncbi.nlm.nih.gov/25968054" }, { "database": "PubMed", "id": "25984943", "url": "https://pubmed.ncbi.nlm.nih.gov/25984943" }, { "database": "PubMed", "id": "26008966", "url": "https://pubmed.ncbi.nlm.nih.gov/26008966" }, { "database": "PubMed", "id": "26028030", "url": "https://pubmed.ncbi.nlm.nih.gov/26028030" }, { "database": "PubMed", "id": "26041409", "url": "https://pubmed.ncbi.nlm.nih.gov/26041409" }, { "database": "PubMed", "id": "26045618", "url": "https://pubmed.ncbi.nlm.nih.gov/26045618" }, { "database": "PubMed", "id": "26051842", "url": "https://pubmed.ncbi.nlm.nih.gov/26051842" }, { "database": "PubMed", "id": "26055806", "url": "https://pubmed.ncbi.nlm.nih.gov/26055806" }, { "database": "PubMed", "id": "26068861", "url": "https://pubmed.ncbi.nlm.nih.gov/26068861" }, { "database": "PubMed", "id": "26084289", "url": "https://pubmed.ncbi.nlm.nih.gov/26084289" }, { "database": "PubMed", "id": "26090459", "url": "https://pubmed.ncbi.nlm.nih.gov/26090459" }, { "database": "PubMed", "id": "26136691", "url": "https://pubmed.ncbi.nlm.nih.gov/26136691" }, { "database": "PubMed", "id": "26138072", "url": "https://pubmed.ncbi.nlm.nih.gov/26138072" }, { "database": "PubMed", "id": "26166037", "url": "https://pubmed.ncbi.nlm.nih.gov/26166037" }, { "database": "PubMed", "id": "26175331", "url": "https://pubmed.ncbi.nlm.nih.gov/26175331" }, { "database": "PubMed", "id": "26212545", "url": "https://pubmed.ncbi.nlm.nih.gov/26212545" }, { "database": "PubMed", "id": "26215634", "url": "https://pubmed.ncbi.nlm.nih.gov/26215634" }, { "database": "PubMed", "id": "26215971", "url": "https://pubmed.ncbi.nlm.nih.gov/26215971" }, { "database": "PubMed", "id": "26279438", "url": "https://pubmed.ncbi.nlm.nih.gov/26279438" }, { "database": "PubMed", "id": "26283544", "url": "https://pubmed.ncbi.nlm.nih.gov/26283544" }, { "database": "PubMed", "id": "26307676", "url": "https://pubmed.ncbi.nlm.nih.gov/26307676" }, { "database": "PubMed", "id": "26329521", "url": "https://pubmed.ncbi.nlm.nih.gov/26329521" }, { "database": "PubMed", "id": "26343524", "url": "https://pubmed.ncbi.nlm.nih.gov/26343524" }, { "database": "PubMed", "id": "26359029", "url": "https://pubmed.ncbi.nlm.nih.gov/26359029" }, { "database": "PubMed", "id": "26376676", "url": "https://pubmed.ncbi.nlm.nih.gov/26376676" }, { "database": "PubMed", "id": "26396689", "url": "https://pubmed.ncbi.nlm.nih.gov/26396689" }, { "database": "PubMed", "id": "26410177", "url": "https://pubmed.ncbi.nlm.nih.gov/26410177" }, { "database": "PubMed", "id": "26418031", "url": "https://pubmed.ncbi.nlm.nih.gov/26418031" }, { "database": "PubMed", "id": "26430964", "url": "https://pubmed.ncbi.nlm.nih.gov/26430964" }, { "database": "PubMed", "id": "26452542", "url": "https://pubmed.ncbi.nlm.nih.gov/26452542" }, { "database": "PubMed", "id": "26459366", "url": "https://pubmed.ncbi.nlm.nih.gov/26459366" }, { "database": "PubMed", "id": "26485029", "url": "https://pubmed.ncbi.nlm.nih.gov/26485029" }, { "database": "PubMed", "id": "26486080", "url": "https://pubmed.ncbi.nlm.nih.gov/26486080" }, { "database": "PubMed", "id": "26528725", "url": "https://pubmed.ncbi.nlm.nih.gov/26528725" }, { "database": "PubMed", "id": "26542452", "url": "https://pubmed.ncbi.nlm.nih.gov/26542452" }, { "database": "PubMed", "id": "26549437", "url": "https://pubmed.ncbi.nlm.nih.gov/26549437" }, { "database": "PubMed", "id": "26549519", "url": "https://pubmed.ncbi.nlm.nih.gov/26549519" }, { "database": "PubMed", "id": "26575169", "url": "https://pubmed.ncbi.nlm.nih.gov/26575169" }, { "database": "PubMed", "id": "26580615", "url": "https://pubmed.ncbi.nlm.nih.gov/26580615" }, { "database": "PubMed", "id": "26610526", "url": "https://pubmed.ncbi.nlm.nih.gov/26610526" }, { "database": "PubMed", "id": "26646010", "url": "https://pubmed.ncbi.nlm.nih.gov/26646010" }, { "database": "PubMed", "id": "26657118", "url": "https://pubmed.ncbi.nlm.nih.gov/26657118" }, { "database": "PubMed", "id": "26664907", "url": "https://pubmed.ncbi.nlm.nih.gov/26664907" }, { "database": "PubMed", "id": "26667266", "url": "https://pubmed.ncbi.nlm.nih.gov/26667266" }, { "database": "PubMed", "id": "26700461", "url": "https://pubmed.ncbi.nlm.nih.gov/26700461" }, { "database": "PubMed", "id": "26755645", "url": "https://pubmed.ncbi.nlm.nih.gov/26755645" }, { "database": "PubMed", "id": "26799670", "url": "https://pubmed.ncbi.nlm.nih.gov/26799670" }, { "database": "PubMed", "id": "26807955", "url": "https://pubmed.ncbi.nlm.nih.gov/26807955" }, { "database": "PubMed", "id": "26843613", "url": "https://pubmed.ncbi.nlm.nih.gov/26843613" }, { "database": "PubMed", "id": "26848618", "url": "https://pubmed.ncbi.nlm.nih.gov/26848618" }, { "database": "PubMed", "id": "26883202", "url": "https://pubmed.ncbi.nlm.nih.gov/26883202" }, { "database": "PubMed", "id": "26883847", "url": "https://pubmed.ncbi.nlm.nih.gov/26883847" }, { "database": "PubMed", "id": "26893174", "url": "https://pubmed.ncbi.nlm.nih.gov/26893174" }, { "database": "PubMed", "id": "26893580", "url": "https://pubmed.ncbi.nlm.nih.gov/26893580" }, { "database": "PubMed", "id": "26898989", "url": "https://pubmed.ncbi.nlm.nih.gov/26898989" }, { "database": "PubMed", "id": "26904942", "url": "https://pubmed.ncbi.nlm.nih.gov/26904942" }, { "database": "PubMed", "id": "26904961", "url": "https://pubmed.ncbi.nlm.nih.gov/26904961" }, { "database": "PubMed", "id": "26909608", "url": "https://pubmed.ncbi.nlm.nih.gov/26909608" }, { "database": "PubMed", "id": "26911335", "url": "https://pubmed.ncbi.nlm.nih.gov/26911335" }, { "database": "PubMed", "id": "26921179", "url": "https://pubmed.ncbi.nlm.nih.gov/26921179" }, { "database": "PubMed", "id": "26926996", "url": "https://pubmed.ncbi.nlm.nih.gov/26926996" }, { "database": "PubMed", "id": "26927669", "url": "https://pubmed.ncbi.nlm.nih.gov/26927669" }, { "database": "PubMed", "id": "26949510", "url": "https://pubmed.ncbi.nlm.nih.gov/26949510" }, { "database": "PubMed", "id": "26956050", "url": "https://pubmed.ncbi.nlm.nih.gov/26956050" }, { "database": "PubMed", "id": "26959890", "url": "https://pubmed.ncbi.nlm.nih.gov/26959890" }, { "database": "PubMed", "id": "26967055", "url": "https://pubmed.ncbi.nlm.nih.gov/26967055" }, { "database": "PubMed", "id": "26974964", "url": "https://pubmed.ncbi.nlm.nih.gov/26974964" }, { "database": "PubMed", "id": "27009358", "url": "https://pubmed.ncbi.nlm.nih.gov/27009358" }, { "database": "PubMed", "id": "27036022", "url": "https://pubmed.ncbi.nlm.nih.gov/27036022" }, { "database": "PubMed", "id": "27050371", "url": "https://pubmed.ncbi.nlm.nih.gov/27050371" }, { "database": "PubMed", "id": "27064016", "url": "https://pubmed.ncbi.nlm.nih.gov/27064016" }, { "database": "PubMed", "id": "27080861", "url": "https://pubmed.ncbi.nlm.nih.gov/27080861" }, { "database": "PubMed", "id": "27107422", "url": "https://pubmed.ncbi.nlm.nih.gov/27107422" }, { "database": "PubMed", "id": "27121055", "url": "https://pubmed.ncbi.nlm.nih.gov/27121055" }, { "database": "PubMed", "id": "27145367", "url": "https://pubmed.ncbi.nlm.nih.gov/27145367" }, { "database": "PubMed", "id": "27151455", "url": "https://pubmed.ncbi.nlm.nih.gov/27151455" }, { "database": "PubMed", "id": "27181202", "url": "https://pubmed.ncbi.nlm.nih.gov/27181202" }, { "database": "PubMed", "id": "27200496", "url": "https://pubmed.ncbi.nlm.nih.gov/27200496" }, { "database": "PubMed", "id": "27216197", "url": "https://pubmed.ncbi.nlm.nih.gov/27216197" }, { "database": "PubMed", "id": "27264264", "url": "https://pubmed.ncbi.nlm.nih.gov/27264264" }, { "database": "PubMed", "id": "27274723", "url": "https://pubmed.ncbi.nlm.nih.gov/27274723" }, { "database": "PubMed", "id": "27279256", "url": "https://pubmed.ncbi.nlm.nih.gov/27279256" }, { "database": "PubMed", "id": "27292026", "url": "https://pubmed.ncbi.nlm.nih.gov/27292026" }, { "database": "PubMed", "id": "27317770", "url": "https://pubmed.ncbi.nlm.nih.gov/27317770" }, { "database": "PubMed", "id": "27323414", "url": "https://pubmed.ncbi.nlm.nih.gov/27323414" }, { "database": "PubMed", "id": "27326257", "url": "https://pubmed.ncbi.nlm.nih.gov/27326257" }, { "database": "PubMed", "id": "27344175", "url": "https://pubmed.ncbi.nlm.nih.gov/27344175" }, { "database": "PubMed", "id": "27362806", "url": "https://pubmed.ncbi.nlm.nih.gov/27362806" }, { "database": "PubMed", "id": "27373978", "url": "https://pubmed.ncbi.nlm.nih.gov/27373978" }, { "database": "PubMed", "id": "27384401", "url": "https://pubmed.ncbi.nlm.nih.gov/27384401" }, { "database": "PubMed", "id": "27418138", "url": "https://pubmed.ncbi.nlm.nih.gov/27418138" }, { "database": "PubMed", "id": "27419630", "url": "https://pubmed.ncbi.nlm.nih.gov/27419630" }, { "database": "PubMed", "id": "27428425", "url": "https://pubmed.ncbi.nlm.nih.gov/27428425" }, { "database": "PubMed", "id": "27456333", "url": "https://pubmed.ncbi.nlm.nih.gov/27456333" }, { "database": "PubMed", "id": "27457246", "url": "https://pubmed.ncbi.nlm.nih.gov/27457246" }, { "database": "PubMed", "id": "27458171", "url": "https://pubmed.ncbi.nlm.nih.gov/27458171" }, { "database": "PubMed", "id": "27462789", "url": "https://pubmed.ncbi.nlm.nih.gov/27462789" }, { "database": "PubMed", "id": "27486258", "url": "https://pubmed.ncbi.nlm.nih.gov/27486258" }, { "database": "PubMed", "id": "27502076", "url": "https://pubmed.ncbi.nlm.nih.gov/27502076" }, { "database": "PubMed", "id": "27537522", "url": "https://pubmed.ncbi.nlm.nih.gov/27537522" }, { "database": "PubMed", "id": "27555284", "url": "https://pubmed.ncbi.nlm.nih.gov/27555284" }, { "database": "PubMed", "id": "27602766", "url": "https://pubmed.ncbi.nlm.nih.gov/27602766" }, { "database": "PubMed", "id": "27616044", "url": "https://pubmed.ncbi.nlm.nih.gov/27616044" }, { "database": "PubMed", "id": "27624867", "url": "https://pubmed.ncbi.nlm.nih.gov/27624867" }, { "database": "PubMed", "id": "27626315", "url": "https://pubmed.ncbi.nlm.nih.gov/27626315" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27660268", "url": "https://pubmed.ncbi.nlm.nih.gov/27660268" }, { "database": "PubMed", "id": "27687804", "url": "https://pubmed.ncbi.nlm.nih.gov/27687804" }, { "database": "PubMed", "id": "27694691", "url": "https://pubmed.ncbi.nlm.nih.gov/27694691" }, { "database": "PubMed", "id": "27705908", "url": "https://pubmed.ncbi.nlm.nih.gov/27705908" }, { "database": "PubMed", "id": "27708408", "url": "https://pubmed.ncbi.nlm.nih.gov/27708408" }, { "database": "PubMed", "id": "27732936", "url": "https://pubmed.ncbi.nlm.nih.gov/27732936" }, { "database": "PubMed", "id": "27748760", "url": "https://pubmed.ncbi.nlm.nih.gov/27748760" }, { "database": "PubMed", "id": "27748818", "url": "https://pubmed.ncbi.nlm.nih.gov/27748818" }, { "database": "PubMed", "id": "27806334", "url": "https://pubmed.ncbi.nlm.nih.gov/27806334" }, { "database": "PubMed", "id": "27824155", "url": "https://pubmed.ncbi.nlm.nih.gov/27824155" }, { "database": "PubMed", "id": "27834930", "url": "https://pubmed.ncbi.nlm.nih.gov/27834930" }, { "database": "PubMed", "id": "27845909", "url": "https://pubmed.ncbi.nlm.nih.gov/27845909" }, { "database": "PubMed", "id": "27855189", "url": "https://pubmed.ncbi.nlm.nih.gov/27855189" }, { "database": "PubMed", "id": "27855669", "url": "https://pubmed.ncbi.nlm.nih.gov/27855669" }, { "database": "PubMed", "id": "27861147", "url": "https://pubmed.ncbi.nlm.nih.gov/27861147" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "27864909", "url": "https://pubmed.ncbi.nlm.nih.gov/27864909" }, { "database": "PubMed", "id": "27871173", "url": "https://pubmed.ncbi.nlm.nih.gov/27871173" }, { "database": "PubMed", "id": "27888804", "url": "https://pubmed.ncbi.nlm.nih.gov/27888804" }, { "database": "PubMed", "id": "27903968", "url": "https://pubmed.ncbi.nlm.nih.gov/27903968" }, { "database": "PubMed", "id": "27977009", "url": "https://pubmed.ncbi.nlm.nih.gov/27977009" }, { "database": "PubMed", "id": "28000790", "url": "https://pubmed.ncbi.nlm.nih.gov/28000790" }, { "database": "PubMed", "id": "28004755", "url": "https://pubmed.ncbi.nlm.nih.gov/28004755" }, { "database": "PubMed", "id": "28017654", "url": "https://pubmed.ncbi.nlm.nih.gov/28017654" }, { "database": "PubMed", "id": "28030813", "url": "https://pubmed.ncbi.nlm.nih.gov/28030813" }, { "database": "PubMed", "id": "28035720", "url": "https://pubmed.ncbi.nlm.nih.gov/28035720" }, { "database": "PubMed", "id": "28053540", "url": "https://pubmed.ncbi.nlm.nih.gov/28053540" }, { "database": "PubMed", "id": "28054649", "url": "https://pubmed.ncbi.nlm.nih.gov/28054649" }, { "database": "PubMed", "id": "28055016", "url": "https://pubmed.ncbi.nlm.nih.gov/28055016" }, { "database": "PubMed", "id": "28100038", "url": "https://pubmed.ncbi.nlm.nih.gov/28100038" }, { "database": "PubMed", "id": "28123608", "url": "https://pubmed.ncbi.nlm.nih.gov/28123608" }, { "database": "PubMed", "id": "28125678", "url": "https://pubmed.ncbi.nlm.nih.gov/28125678" }, { "database": "PubMed", "id": "28134252", "url": "https://pubmed.ncbi.nlm.nih.gov/28134252" }, { "database": "PubMed", "id": "28138036", "url": "https://pubmed.ncbi.nlm.nih.gov/28138036" }, { "database": "PubMed", "id": "28150703", "url": "https://pubmed.ncbi.nlm.nih.gov/28150703" }, { "database": "PubMed", "id": "28150717", "url": "https://pubmed.ncbi.nlm.nih.gov/28150717" }, { "database": "PubMed", "id": "28157205", "url": "https://pubmed.ncbi.nlm.nih.gov/28157205" }, { "database": "PubMed", "id": "28157698", "url": "https://pubmed.ncbi.nlm.nih.gov/28157698" }, { "database": "PubMed", "id": "28157712", "url": "https://pubmed.ncbi.nlm.nih.gov/28157712" }, { "database": "PubMed", "id": "28159925", "url": "https://pubmed.ncbi.nlm.nih.gov/28159925" }, { "database": "PubMed", "id": "28160777", "url": "https://pubmed.ncbi.nlm.nih.gov/28160777" }, { "database": "PubMed", "id": "28207963", "url": "https://pubmed.ncbi.nlm.nih.gov/28207963" }, { "database": "PubMed", "id": "28222632", "url": "https://pubmed.ncbi.nlm.nih.gov/28222632" }, { "database": "PubMed", "id": "28223425", "url": "https://pubmed.ncbi.nlm.nih.gov/28223425" }, { "database": "PubMed", "id": "28228214", "url": "https://pubmed.ncbi.nlm.nih.gov/28228214" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28264935", "url": "https://pubmed.ncbi.nlm.nih.gov/28264935" }, { "database": "PubMed", "id": "28276425", "url": "https://pubmed.ncbi.nlm.nih.gov/28276425" }, { "database": "PubMed", "id": "28280036", "url": "https://pubmed.ncbi.nlm.nih.gov/28280036" }, { "database": "PubMed", "id": "28345832", "url": "https://pubmed.ncbi.nlm.nih.gov/28345832" }, { "database": "PubMed", "id": "28350008", "url": "https://pubmed.ncbi.nlm.nih.gov/28350008" }, { "database": "PubMed", "id": "28367059", "url": "https://pubmed.ncbi.nlm.nih.gov/28367059" }, { "database": "PubMed", "id": "28376152", "url": "https://pubmed.ncbi.nlm.nih.gov/28376152" }, { "database": "PubMed", "id": "28384648", "url": "https://pubmed.ncbi.nlm.nih.gov/28384648" }, { "database": "PubMed", "id": "28388577", "url": "https://pubmed.ncbi.nlm.nih.gov/28388577" }, { "database": "PubMed", "id": "28397855", "url": "https://pubmed.ncbi.nlm.nih.gov/28397855" }, { "database": "PubMed", "id": "28415760", "url": "https://pubmed.ncbi.nlm.nih.gov/28415760" }, { "database": "PubMed", "id": "28427199", "url": "https://pubmed.ncbi.nlm.nih.gov/28427199" }, { "database": "PubMed", "id": "28427224", "url": "https://pubmed.ncbi.nlm.nih.gov/28427224" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28469272", "url": "https://pubmed.ncbi.nlm.nih.gov/28469272" }, { "database": "PubMed", "id": "28483518", "url": "https://pubmed.ncbi.nlm.nih.gov/28483518" }, { "database": "PubMed", "id": "28492557", "url": "https://pubmed.ncbi.nlm.nih.gov/28492557" }, { "database": "PubMed", "id": "28500786", "url": "https://pubmed.ncbi.nlm.nih.gov/28500786" }, { "database": "PubMed", "id": "28503147", "url": "https://pubmed.ncbi.nlm.nih.gov/28503147" }, { "database": "PubMed", "id": "28520923", "url": "https://pubmed.ncbi.nlm.nih.gov/28520923" }, { "database": "PubMed", "id": "28526807", "url": "https://pubmed.ncbi.nlm.nih.gov/28526807" }, { "database": "PubMed", "id": "28526849", "url": "https://pubmed.ncbi.nlm.nih.gov/28526849" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28549350", "url": "https://pubmed.ncbi.nlm.nih.gov/28549350" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28560454", "url": "https://pubmed.ncbi.nlm.nih.gov/28560454" }, { "database": "PubMed", "id": "28572601", "url": "https://pubmed.ncbi.nlm.nih.gov/28572601" }, { "database": "PubMed", "id": "28574510", "url": "https://pubmed.ncbi.nlm.nih.gov/28574510" }, { "database": "PubMed", "id": "28588262", "url": "https://pubmed.ncbi.nlm.nih.gov/28588262" }, { "database": "PubMed", "id": "28629363", "url": "https://pubmed.ncbi.nlm.nih.gov/28629363" }, { "database": "PubMed", "id": "28634059", "url": "https://pubmed.ncbi.nlm.nih.gov/28634059" }, { "database": "PubMed", "id": "28636670", "url": "https://pubmed.ncbi.nlm.nih.gov/28636670" }, { "database": "PubMed", "id": "28654902", "url": "https://pubmed.ncbi.nlm.nih.gov/28654902" }, { "database": "PubMed", "id": "28661045", "url": "https://pubmed.ncbi.nlm.nih.gov/28661045" }, { "database": "PubMed", "id": "28664080", "url": "https://pubmed.ncbi.nlm.nih.gov/28664080" }, { "database": "PubMed", "id": "28666623", "url": "https://pubmed.ncbi.nlm.nih.gov/28666623" }, { "database": "PubMed", "id": "28670112", "url": "https://pubmed.ncbi.nlm.nih.gov/28670112" }, { "database": "PubMed", "id": "28672024", "url": "https://pubmed.ncbi.nlm.nih.gov/28672024" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28705432", "url": "https://pubmed.ncbi.nlm.nih.gov/28705432" }, { "database": "PubMed", "id": "28720093", "url": "https://pubmed.ncbi.nlm.nih.gov/28720093" }, { "database": "PubMed", "id": "28745314", "url": "https://pubmed.ncbi.nlm.nih.gov/28745314" }, { "database": "PubMed", "id": "28750624", "url": "https://pubmed.ncbi.nlm.nih.gov/28750624" }, { "database": "PubMed", "id": "28757590", "url": "https://pubmed.ncbi.nlm.nih.gov/28757590" }, { "database": "PubMed", "id": "28781685", "url": "https://pubmed.ncbi.nlm.nih.gov/28781685" }, { "database": "PubMed", "id": "28783167", "url": "https://pubmed.ncbi.nlm.nih.gov/28783167" }, { "database": "PubMed", "id": "28785079", "url": "https://pubmed.ncbi.nlm.nih.gov/28785079" }, { "database": "PubMed", "id": "28785380", "url": "https://pubmed.ncbi.nlm.nih.gov/28785380" }, { "database": "PubMed", "id": "28859117", "url": "https://pubmed.ncbi.nlm.nih.gov/28859117" }, { "database": "PubMed", "id": "28881473", "url": "https://pubmed.ncbi.nlm.nih.gov/28881473" }, { "database": "PubMed", "id": "28883791", "url": "https://pubmed.ncbi.nlm.nih.gov/28883791" }, { "database": "PubMed", "id": "28884137", "url": "https://pubmed.ncbi.nlm.nih.gov/28884137" }, { "database": "PubMed", "id": "28903349", "url": "https://pubmed.ncbi.nlm.nih.gov/28903349" }, { "database": "PubMed", "id": "28918059", "url": "https://pubmed.ncbi.nlm.nih.gov/28918059" }, { "database": "PubMed", "id": "29024195", "url": "https://pubmed.ncbi.nlm.nih.gov/29024195" }, { "database": "PubMed", "id": "29050232", "url": "https://pubmed.ncbi.nlm.nih.gov/29050232" }, { "database": "PubMed", "id": "29062282", "url": "https://pubmed.ncbi.nlm.nih.gov/29062282" }, { "database": "PubMed", "id": "29082496", "url": "https://pubmed.ncbi.nlm.nih.gov/29082496" }, { "database": "PubMed", "id": "29088733", "url": "https://pubmed.ncbi.nlm.nih.gov/29088733" }, { "database": "PubMed", "id": "29126425", "url": "https://pubmed.ncbi.nlm.nih.gov/29126425" }, { "database": "PubMed", "id": "29133922", "url": "https://pubmed.ncbi.nlm.nih.gov/29133922" }, { "database": "PubMed", "id": "29142074", "url": "https://pubmed.ncbi.nlm.nih.gov/29142074" }, { "database": "PubMed", "id": "29158850", "url": "https://pubmed.ncbi.nlm.nih.gov/29158850" }, { "database": "PubMed", "id": "29162862", "url": "https://pubmed.ncbi.nlm.nih.gov/29162862" }, { "database": "PubMed", "id": "29174507", "url": "https://pubmed.ncbi.nlm.nih.gov/29174507" }, { "database": "PubMed", "id": "29179471", "url": "https://pubmed.ncbi.nlm.nih.gov/29179471" }, { "database": "PubMed", "id": "29180818", "url": "https://pubmed.ncbi.nlm.nih.gov/29180818" }, { "database": "PubMed", "id": "29182685", "url": "https://pubmed.ncbi.nlm.nih.gov/29182685" }, { "database": "PubMed", "id": "29185442", "url": "https://pubmed.ncbi.nlm.nih.gov/29185442" }, { "database": "PubMed", "id": "29190960", "url": "https://pubmed.ncbi.nlm.nih.gov/29190960" }, { "database": "PubMed", "id": "29207075", "url": "https://pubmed.ncbi.nlm.nih.gov/29207075" }, { "database": "PubMed", "id": "29207614", "url": "https://pubmed.ncbi.nlm.nih.gov/29207614" }, { "database": "PubMed", "id": "29212252", "url": "https://pubmed.ncbi.nlm.nih.gov/29212252" }, { "database": "PubMed", "id": "29228628", "url": "https://pubmed.ncbi.nlm.nih.gov/29228628" }, { "database": "PubMed", "id": "29229958", "url": "https://pubmed.ncbi.nlm.nih.gov/29229958" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29242509", "url": "https://pubmed.ncbi.nlm.nih.gov/29242509" }, { "database": "PubMed", "id": "29253028", "url": "https://pubmed.ncbi.nlm.nih.gov/29253028" }, { "database": "PubMed", "id": "29254221", "url": "https://pubmed.ncbi.nlm.nih.gov/29254221" }, { "database": "PubMed", "id": "29263930", "url": "https://pubmed.ncbi.nlm.nih.gov/29263930" }, { "database": "PubMed", "id": "29270528", "url": "https://pubmed.ncbi.nlm.nih.gov/29270528" }, { "database": "PubMed", "id": "29286132", "url": "https://pubmed.ncbi.nlm.nih.gov/29286132" }, { "database": "PubMed", "id": "29290793", "url": "https://pubmed.ncbi.nlm.nih.gov/29290793" }, { "database": "PubMed", "id": "29309895", "url": "https://pubmed.ncbi.nlm.nih.gov/29309895" }, { "database": "PubMed", "id": "29330478", "url": "https://pubmed.ncbi.nlm.nih.gov/29330478" }, { "database": "PubMed", "id": "29351406", "url": "https://pubmed.ncbi.nlm.nih.gov/29351406" }, { "database": "PubMed", "id": "29402895", "url": "https://pubmed.ncbi.nlm.nih.gov/29402895" }, { "database": "PubMed", "id": "29423098", "url": "https://pubmed.ncbi.nlm.nih.gov/29423098" }, { "database": "PubMed", "id": "29449694", "url": "https://pubmed.ncbi.nlm.nih.gov/29449694" }, { "database": "PubMed", "id": "29456111", "url": "https://pubmed.ncbi.nlm.nih.gov/29456111" }, { "database": "PubMed", "id": "29456240", "url": "https://pubmed.ncbi.nlm.nih.gov/29456240" }, { "database": "PubMed", "id": "29464030", "url": "https://pubmed.ncbi.nlm.nih.gov/29464030" }, { "database": "PubMed", "id": "29488000", "url": "https://pubmed.ncbi.nlm.nih.gov/29488000" }, { "database": "PubMed", "id": "29499951", "url": "https://pubmed.ncbi.nlm.nih.gov/29499951" }, { "database": "PubMed", "id": "29511087", "url": "https://pubmed.ncbi.nlm.nih.gov/29511087" }, { "database": "PubMed", "id": "29511600", "url": "https://pubmed.ncbi.nlm.nih.gov/29511600" }, { "database": "PubMed", "id": "29518696", "url": "https://pubmed.ncbi.nlm.nih.gov/29518696" }, { "database": "PubMed", "id": "29540666", "url": "https://pubmed.ncbi.nlm.nih.gov/29540666" }, { "database": "PubMed", "id": "29565987", "url": "https://pubmed.ncbi.nlm.nih.gov/29565987" }, { "database": "PubMed", "id": "29566069", "url": "https://pubmed.ncbi.nlm.nih.gov/29566069" }, { "database": "PubMed", "id": "29571296", "url": "https://pubmed.ncbi.nlm.nih.gov/29571296" }, { "database": "PubMed", "id": "29595328", "url": "https://pubmed.ncbi.nlm.nih.gov/29595328" }, { "database": "PubMed", "id": "29599917", "url": "https://pubmed.ncbi.nlm.nih.gov/29599917" }, { "database": "PubMed", "id": "29606890", "url": "https://pubmed.ncbi.nlm.nih.gov/29606890" }, { "database": "PubMed", "id": "29630659", "url": "https://pubmed.ncbi.nlm.nih.gov/29630659" }, { "database": "PubMed", "id": "29636527", "url": "https://pubmed.ncbi.nlm.nih.gov/29636527" }, { "database": "PubMed", "id": "29637003", "url": "https://pubmed.ncbi.nlm.nih.gov/29637003" }, { "database": "PubMed", "id": "29652915", "url": "https://pubmed.ncbi.nlm.nih.gov/29652915" }, { "database": "PubMed", "id": "29660364", "url": "https://pubmed.ncbi.nlm.nih.gov/29660364" }, { "database": "PubMed", "id": "29666362", "url": "https://pubmed.ncbi.nlm.nih.gov/29666362" }, { "database": "PubMed", "id": "29682112", "url": "https://pubmed.ncbi.nlm.nih.gov/29682112" }, { "database": "PubMed", "id": "29686295", "url": "https://pubmed.ncbi.nlm.nih.gov/29686295" }, { "database": "PubMed", "id": "29717134", "url": "https://pubmed.ncbi.nlm.nih.gov/29717134" }, { "database": "PubMed", "id": "29721383", "url": "https://pubmed.ncbi.nlm.nih.gov/29721383" }, { "database": "PubMed", "id": "29749438", "url": "https://pubmed.ncbi.nlm.nih.gov/29749438" }, { "database": "PubMed", "id": "29765448", "url": "https://pubmed.ncbi.nlm.nih.gov/29765448" }, { "database": "PubMed", "id": "29774125", "url": "https://pubmed.ncbi.nlm.nih.gov/29774125" }, { "database": "PubMed", "id": "29795016", "url": "https://pubmed.ncbi.nlm.nih.gov/29795016" }, { "database": "PubMed", "id": "29805309", "url": "https://pubmed.ncbi.nlm.nih.gov/29805309" }, { "database": "PubMed", "id": "29807795", "url": "https://pubmed.ncbi.nlm.nih.gov/29807795" }, { "database": "PubMed", "id": "29855616", "url": "https://pubmed.ncbi.nlm.nih.gov/29855616" }, { "database": "PubMed", "id": "29891854", "url": "https://pubmed.ncbi.nlm.nih.gov/29891854" }, { "database": "PubMed", "id": "29892198", "url": "https://pubmed.ncbi.nlm.nih.gov/29892198" }, { "database": "PubMed", "id": "29901083", "url": "https://pubmed.ncbi.nlm.nih.gov/29901083" }, { "database": "PubMed", "id": "29904948", "url": "https://pubmed.ncbi.nlm.nih.gov/29904948" }, { "database": "PubMed", "id": "29915371", "url": "https://pubmed.ncbi.nlm.nih.gov/29915371" }, { "database": "PubMed", "id": "29920512", "url": "https://pubmed.ncbi.nlm.nih.gov/29920512" }, { "database": "PubMed", "id": "29921768", "url": "https://pubmed.ncbi.nlm.nih.gov/29921768" }, { "database": "PubMed", "id": "29949238", "url": "https://pubmed.ncbi.nlm.nih.gov/29949238" }, { "database": "PubMed", "id": "29950561", "url": "https://pubmed.ncbi.nlm.nih.gov/29950561" }, { "database": "PubMed", "id": "29991802", "url": "https://pubmed.ncbi.nlm.nih.gov/29991802" }, { "database": "PubMed", "id": "29995595", "url": "https://pubmed.ncbi.nlm.nih.gov/29995595" }, { "database": "PubMed", "id": "30008594", "url": "https://pubmed.ncbi.nlm.nih.gov/30008594" }, { "database": "PubMed", "id": "30009856", "url": "https://pubmed.ncbi.nlm.nih.gov/30009856" }, { "database": "PubMed", "id": "30015159", "url": "https://pubmed.ncbi.nlm.nih.gov/30015159" }, { "database": "PubMed", "id": "30016456", "url": "https://pubmed.ncbi.nlm.nih.gov/30016456" }, { "database": "PubMed", "id": "30036966", "url": "https://pubmed.ncbi.nlm.nih.gov/30036966" }, { "database": "PubMed", "id": "30072687", "url": "https://pubmed.ncbi.nlm.nih.gov/30072687" }, { "database": "PubMed", "id": "30080291", "url": "https://pubmed.ncbi.nlm.nih.gov/30080291" }, { "database": "PubMed", "id": "30106087", "url": "https://pubmed.ncbi.nlm.nih.gov/30106087" }, { "database": "PubMed", "id": "30123428", "url": "https://pubmed.ncbi.nlm.nih.gov/30123428" }, { "database": "PubMed", "id": "30127373", "url": "https://pubmed.ncbi.nlm.nih.gov/30127373" }, { "database": "PubMed", "id": "30127519", "url": "https://pubmed.ncbi.nlm.nih.gov/30127519" }, { "database": "PubMed", "id": "30135074", "url": "https://pubmed.ncbi.nlm.nih.gov/30135074" }, { "database": "PubMed", "id": "30135654", "url": "https://pubmed.ncbi.nlm.nih.gov/30135654" }, { "database": "PubMed", "id": "30209389", "url": "https://pubmed.ncbi.nlm.nih.gov/30209389" }, { "database": "PubMed", "id": "30214513", "url": "https://pubmed.ncbi.nlm.nih.gov/30214513" }, { "database": "PubMed", "id": "30234199", "url": "https://pubmed.ncbi.nlm.nih.gov/30234199" }, { "database": "PubMed", "id": "30250641", "url": "https://pubmed.ncbi.nlm.nih.gov/30250641" }, { "database": "PubMed", "id": "30251272", "url": "https://pubmed.ncbi.nlm.nih.gov/30251272" }, { "database": "PubMed", "id": "30261753", "url": "https://pubmed.ncbi.nlm.nih.gov/30261753" }, { "database": "PubMed", "id": "30286779", "url": "https://pubmed.ncbi.nlm.nih.gov/30286779" }, { "database": "PubMed", "id": "30302278", "url": "https://pubmed.ncbi.nlm.nih.gov/30302278" }, { "database": "PubMed", "id": "30323565", "url": "https://pubmed.ncbi.nlm.nih.gov/30323565" }, { "database": "PubMed", "id": "30368518", "url": "https://pubmed.ncbi.nlm.nih.gov/30368518" }, { "database": "PubMed", "id": "30375708", "url": "https://pubmed.ncbi.nlm.nih.gov/30375708" }, { "database": "PubMed", "id": "30410767", "url": "https://pubmed.ncbi.nlm.nih.gov/30410767" }, { "database": "PubMed", "id": "30442941", "url": "https://pubmed.ncbi.nlm.nih.gov/30442941" }, { "database": "PubMed", "id": "30455690", "url": "https://pubmed.ncbi.nlm.nih.gov/30455690" }, { "database": "PubMed", "id": "30481203", "url": "https://pubmed.ncbi.nlm.nih.gov/30481203" }, { "database": "PubMed", "id": "30519314", "url": "https://pubmed.ncbi.nlm.nih.gov/30519314" }, { "database": "PubMed", "id": "30523261", "url": "https://pubmed.ncbi.nlm.nih.gov/30523261" }, { "database": "PubMed", "id": "30577812", "url": "https://pubmed.ncbi.nlm.nih.gov/30577812" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30622697", "url": "https://pubmed.ncbi.nlm.nih.gov/30622697" }, { "database": "PubMed", "id": "30631031", "url": "https://pubmed.ncbi.nlm.nih.gov/30631031" }, { "database": "PubMed", "id": "30668440", "url": "https://pubmed.ncbi.nlm.nih.gov/30668440" }, { "database": "PubMed", "id": "30674340", "url": "https://pubmed.ncbi.nlm.nih.gov/30674340" }, { "database": "PubMed", "id": "30675525", "url": "https://pubmed.ncbi.nlm.nih.gov/30675525" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30720080", "url": "https://pubmed.ncbi.nlm.nih.gov/30720080" }, { "database": "PubMed", "id": "30720090", "url": "https://pubmed.ncbi.nlm.nih.gov/30720090" }, { "database": "PubMed", "id": "30735121", "url": "https://pubmed.ncbi.nlm.nih.gov/30735121" }, { "database": "PubMed", "id": "30745853", "url": "https://pubmed.ncbi.nlm.nih.gov/30745853" }, { "database": "PubMed", "id": "30756445", "url": "https://pubmed.ncbi.nlm.nih.gov/30756445" }, { "database": "PubMed", "id": "30760703", "url": "https://pubmed.ncbi.nlm.nih.gov/30760703" }, { "database": "PubMed", "id": "30770798", "url": "https://pubmed.ncbi.nlm.nih.gov/30770798" }, { "database": "PubMed", "id": "30783489", "url": "https://pubmed.ncbi.nlm.nih.gov/30783489" }, { "database": "PubMed", "id": "30787270", "url": "https://pubmed.ncbi.nlm.nih.gov/30787270" }, { "database": "PubMed", "id": "30810286", "url": "https://pubmed.ncbi.nlm.nih.gov/30810286" }, { "database": "PubMed", "id": "30833574", "url": "https://pubmed.ncbi.nlm.nih.gov/30833574" }, { "database": "PubMed", "id": "30854231", "url": "https://pubmed.ncbi.nlm.nih.gov/30854231" }, { "database": "PubMed", "id": "30857539", "url": "https://pubmed.ncbi.nlm.nih.gov/30857539" }, { "database": "PubMed", "id": "30899371", "url": "https://pubmed.ncbi.nlm.nih.gov/30899371" }, { "database": "PubMed", "id": "30947697", "url": "https://pubmed.ncbi.nlm.nih.gov/30947697" }, { "database": "PubMed", "id": "30948493", "url": "https://pubmed.ncbi.nlm.nih.gov/30948493" }, { "database": "PubMed", "id": "30949204", "url": "https://pubmed.ncbi.nlm.nih.gov/30949204" }, { "database": "PubMed", "id": "30950039", "url": "https://pubmed.ncbi.nlm.nih.gov/30950039" }, { "database": "PubMed", "id": "30958597", "url": "https://pubmed.ncbi.nlm.nih.gov/30958597" }, { "database": "PubMed", "id": "30980700", "url": "https://pubmed.ncbi.nlm.nih.gov/30980700" }, { "database": "PubMed", "id": "30981183", "url": "https://pubmed.ncbi.nlm.nih.gov/30981183" }, { "database": "PubMed", "id": "30986607", "url": "https://pubmed.ncbi.nlm.nih.gov/30986607" }, { "database": "PubMed", "id": "31002364", "url": "https://pubmed.ncbi.nlm.nih.gov/31002364" }, { "database": "PubMed", "id": "31013746", "url": "https://pubmed.ncbi.nlm.nih.gov/31013746" }, { "database": "PubMed", "id": "31018021", "url": "https://pubmed.ncbi.nlm.nih.gov/31018021" }, { "database": "PubMed", "id": "31048139", "url": "https://pubmed.ncbi.nlm.nih.gov/31048139" }, { "database": "PubMed", "id": "31058868", "url": "https://pubmed.ncbi.nlm.nih.gov/31058868" }, { "database": "PubMed", "id": "31068940", "url": "https://pubmed.ncbi.nlm.nih.gov/31068940" }, { "database": "PubMed", "id": "31105997", "url": "https://pubmed.ncbi.nlm.nih.gov/31105997" }, { "database": "PubMed", "id": "31118769", "url": "https://pubmed.ncbi.nlm.nih.gov/31118769" }, { "database": "PubMed", "id": "31129031", "url": "https://pubmed.ncbi.nlm.nih.gov/31129031" }, { "database": "PubMed", "id": "31182137", "url": "https://pubmed.ncbi.nlm.nih.gov/31182137" }, { "database": "PubMed", "id": "31198634", "url": "https://pubmed.ncbi.nlm.nih.gov/31198634" }, { "database": "PubMed", "id": "31201357", "url": "https://pubmed.ncbi.nlm.nih.gov/31201357" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31213027", "url": "https://pubmed.ncbi.nlm.nih.gov/31213027" }, { "database": "PubMed", "id": "31226168", "url": "https://pubmed.ncbi.nlm.nih.gov/31226168" }, { "database": "PubMed", "id": "31227842", "url": "https://pubmed.ncbi.nlm.nih.gov/31227842" }, { "database": "PubMed", "id": "31277507", "url": "https://pubmed.ncbi.nlm.nih.gov/31277507" }, { "database": "PubMed", "id": "31277685", "url": "https://pubmed.ncbi.nlm.nih.gov/31277685" }, { "database": "PubMed", "id": "31284599", "url": "https://pubmed.ncbi.nlm.nih.gov/31284599" }, { "database": "PubMed", "id": "31285546", "url": "https://pubmed.ncbi.nlm.nih.gov/31285546" }, { "database": "PubMed", "id": "31306849", "url": "https://pubmed.ncbi.nlm.nih.gov/31306849" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "31323961", "url": "https://pubmed.ncbi.nlm.nih.gov/31323961" }, { "database": "PubMed", "id": "31337063", "url": "https://pubmed.ncbi.nlm.nih.gov/31337063" }, { "database": "PubMed", "id": "31337349", "url": "https://pubmed.ncbi.nlm.nih.gov/31337349" }, { "database": "PubMed", "id": "31337843", "url": "https://pubmed.ncbi.nlm.nih.gov/31337843" }, { "database": "PubMed", "id": "31361391", "url": "https://pubmed.ncbi.nlm.nih.gov/31361391" }, { "database": "PubMed", "id": "31361777", "url": "https://pubmed.ncbi.nlm.nih.gov/31361777" }, { "database": "PubMed", "id": "31372043", "url": "https://pubmed.ncbi.nlm.nih.gov/31372043" }, { "database": "PubMed", "id": "31375423", "url": "https://pubmed.ncbi.nlm.nih.gov/31375423" }, { "database": "PubMed", "id": "31383893", "url": "https://pubmed.ncbi.nlm.nih.gov/31383893" }, { "database": "PubMed", "id": "31390744", "url": "https://pubmed.ncbi.nlm.nih.gov/31390744" }, { "database": "PubMed", "id": "31409371", "url": "https://pubmed.ncbi.nlm.nih.gov/31409371" }, { "database": "PubMed", "id": "31412593", "url": "https://pubmed.ncbi.nlm.nih.gov/31412593" }, { "database": "PubMed", "id": "31422383", "url": "https://pubmed.ncbi.nlm.nih.gov/31422383" }, { "database": "PubMed", "id": "31438472", "url": "https://pubmed.ncbi.nlm.nih.gov/31438472" }, { "database": "PubMed", "id": "31438567", "url": "https://pubmed.ncbi.nlm.nih.gov/31438567" }, { "database": "PubMed", "id": "31448054", "url": "https://pubmed.ncbi.nlm.nih.gov/31448054" }, { "database": "PubMed", "id": "31455240", "url": "https://pubmed.ncbi.nlm.nih.gov/31455240" }, { "database": "PubMed", "id": "31465777", "url": "https://pubmed.ncbi.nlm.nih.gov/31465777" }, { "database": "PubMed", "id": "31500219", "url": "https://pubmed.ncbi.nlm.nih.gov/31500219" }, { "database": "PubMed", "id": "31511071", "url": "https://pubmed.ncbi.nlm.nih.gov/31511071" }, { "database": "PubMed", "id": "31530281", "url": "https://pubmed.ncbi.nlm.nih.gov/31530281" }, { "database": "PubMed", "id": "31537377", "url": "https://pubmed.ncbi.nlm.nih.gov/31537377" }, { "database": "PubMed", "id": "31568643", "url": "https://pubmed.ncbi.nlm.nih.gov/31568643" }, { "database": "PubMed", "id": "31573734", "url": "https://pubmed.ncbi.nlm.nih.gov/31573734" }, { "database": "PubMed", "id": "31575007", "url": "https://pubmed.ncbi.nlm.nih.gov/31575007" }, { "database": "PubMed", "id": "31597912", "url": "https://pubmed.ncbi.nlm.nih.gov/31597912" }, { "database": "PubMed", "id": "31616177", "url": "https://pubmed.ncbi.nlm.nih.gov/31616177" }, { "database": "PubMed", "id": "31655629", "url": "https://pubmed.ncbi.nlm.nih.gov/31655629" }, { "database": "PubMed", "id": "31695791", "url": "https://pubmed.ncbi.nlm.nih.gov/31695791" }, { "database": "PubMed", "id": "31709178", "url": "https://pubmed.ncbi.nlm.nih.gov/31709178" }, { "database": "PubMed", "id": "31744223", "url": "https://pubmed.ncbi.nlm.nih.gov/31744223" }, { "database": "PubMed", "id": "31750256", "url": "https://pubmed.ncbi.nlm.nih.gov/31750256" }, { "database": "PubMed", "id": "31760402", "url": "https://pubmed.ncbi.nlm.nih.gov/31760402" }, { "database": "PubMed", "id": "31765941", "url": "https://pubmed.ncbi.nlm.nih.gov/31765941" }, { "database": "PubMed", "id": "31781039", "url": "https://pubmed.ncbi.nlm.nih.gov/31781039" }, { "database": "PubMed", "id": "31816634", "url": "https://pubmed.ncbi.nlm.nih.gov/31816634" }, { "database": "PubMed", "id": "31817171", "url": "https://pubmed.ncbi.nlm.nih.gov/31817171" }, { "database": "PubMed", "id": "31847229", "url": "https://pubmed.ncbi.nlm.nih.gov/31847229" }, { "database": "PubMed", "id": "31878046", "url": "https://pubmed.ncbi.nlm.nih.gov/31878046" }, { "database": "PubMed", "id": "31888532", "url": "https://pubmed.ncbi.nlm.nih.gov/31888532" }, { "database": "PubMed", "id": "31894334", "url": "https://pubmed.ncbi.nlm.nih.gov/31894334" }, { "database": "PubMed", "id": "31900385", "url": "https://pubmed.ncbi.nlm.nih.gov/31900385" }, { "database": "PubMed", "id": "31908417", "url": "https://pubmed.ncbi.nlm.nih.gov/31908417" }, { "database": "PubMed", "id": "31920333", "url": "https://pubmed.ncbi.nlm.nih.gov/31920333" }, { "database": "PubMed", "id": "31936807", "url": "https://pubmed.ncbi.nlm.nih.gov/31936807" }, { "database": "PubMed", "id": "31938049", "url": "https://pubmed.ncbi.nlm.nih.gov/31938049" }, { "database": "PubMed", "id": "31956373", "url": "https://pubmed.ncbi.nlm.nih.gov/31956373" }, { "database": "PubMed", "id": "31980595", "url": "https://pubmed.ncbi.nlm.nih.gov/31980595" }, { "database": "PubMed", "id": "31990532", "url": "https://pubmed.ncbi.nlm.nih.gov/31990532" }, { "database": "PubMed", "id": "32005797", "url": "https://pubmed.ncbi.nlm.nih.gov/32005797" }, { "database": "PubMed", "id": "32005799", "url": "https://pubmed.ncbi.nlm.nih.gov/32005799" }, { "database": "PubMed", "id": "32021288", "url": "https://pubmed.ncbi.nlm.nih.gov/32021288" }, { "database": "PubMed", "id": "32029900", "url": "https://pubmed.ncbi.nlm.nih.gov/32029900" }, { "database": "PubMed", "id": "32051479", "url": "https://pubmed.ncbi.nlm.nih.gov/32051479" }, { "database": "PubMed", "id": "32054489", "url": "https://pubmed.ncbi.nlm.nih.gov/32054489" }, { "database": "PubMed", "id": "32071920", "url": "https://pubmed.ncbi.nlm.nih.gov/32071920" }, { "database": "PubMed", "id": "32080166", "url": "https://pubmed.ncbi.nlm.nih.gov/32080166" }, { "database": "PubMed", "id": "32150979", "url": "https://pubmed.ncbi.nlm.nih.gov/32150979" }, { "database": "PubMed", "id": "32164483", "url": "https://pubmed.ncbi.nlm.nih.gov/32164483" }, { "database": "PubMed", "id": "32171124", "url": "https://pubmed.ncbi.nlm.nih.gov/32171124" }, { "database": "PubMed", "id": "32182833", "url": "https://pubmed.ncbi.nlm.nih.gov/32182833" }, { "database": "PubMed", "id": "32188095", "url": "https://pubmed.ncbi.nlm.nih.gov/32188095" }, { "database": "PubMed", "id": "32242230", "url": "https://pubmed.ncbi.nlm.nih.gov/32242230" }, { "database": "PubMed", "id": "32252311", "url": "https://pubmed.ncbi.nlm.nih.gov/32252311" }, { "database": "PubMed", "id": "32257917", "url": "https://pubmed.ncbi.nlm.nih.gov/32257917" }, { "database": "PubMed", "id": "32273843", "url": "https://pubmed.ncbi.nlm.nih.gov/32273843" }, { "database": "PubMed", "id": "32365859", "url": "https://pubmed.ncbi.nlm.nih.gov/32365859" }, { "database": "PubMed", "id": "32391256", "url": "https://pubmed.ncbi.nlm.nih.gov/32391256" }, { "database": "PubMed", "id": "32422984", "url": "https://pubmed.ncbi.nlm.nih.gov/32422984" }, { "database": "PubMed", "id": "32450513", "url": "https://pubmed.ncbi.nlm.nih.gov/32450513" }, { "database": "PubMed", "id": "32456348", "url": "https://pubmed.ncbi.nlm.nih.gov/32456348" }, { "database": "PubMed", "id": "32475380", "url": "https://pubmed.ncbi.nlm.nih.gov/32475380" }, { "database": "PubMed", "id": "32483468", "url": "https://pubmed.ncbi.nlm.nih.gov/32483468" }, { "database": "PubMed", "id": "32491253", "url": "https://pubmed.ncbi.nlm.nih.gov/32491253" }, { "database": "PubMed", "id": "32495998", "url": "https://pubmed.ncbi.nlm.nih.gov/32495998" }, { "database": "PubMed", "id": "32517717", "url": "https://pubmed.ncbi.nlm.nih.gov/32517717" }, { "database": "PubMed", "id": "32526010", "url": "https://pubmed.ncbi.nlm.nih.gov/32526010" }, { "database": "PubMed", "id": "32528731", "url": "https://pubmed.ncbi.nlm.nih.gov/32528731" }, { "database": "PubMed", "id": "32580970", "url": "https://pubmed.ncbi.nlm.nih.gov/32580970" }, { "database": "PubMed", "id": "32587662", "url": "https://pubmed.ncbi.nlm.nih.gov/32587662" }, { "database": "PubMed", "id": "32589311", "url": "https://pubmed.ncbi.nlm.nih.gov/32589311" }, { "database": "PubMed", "id": "32641029", "url": "https://pubmed.ncbi.nlm.nih.gov/32641029" }, { "database": "PubMed", "id": "32657763", "url": "https://pubmed.ncbi.nlm.nih.gov/32657763" }, { "database": "PubMed", "id": "32667731", "url": "https://pubmed.ncbi.nlm.nih.gov/32667731" }, { "database": "PubMed", "id": "32716315", "url": "https://pubmed.ncbi.nlm.nih.gov/32716315" }, { "database": "PubMed", "id": "32721246", "url": "https://pubmed.ncbi.nlm.nih.gov/32721246" }, { "database": "PubMed", "id": "32735617", "url": "https://pubmed.ncbi.nlm.nih.gov/32735617" }, { "database": "PubMed", "id": "32751884", "url": "https://pubmed.ncbi.nlm.nih.gov/32751884" }, { "database": "PubMed", "id": "32754441", "url": "https://pubmed.ncbi.nlm.nih.gov/32754441" }, { "database": "PubMed", "id": "32766155", "url": "https://pubmed.ncbi.nlm.nih.gov/32766155" }, { "database": "PubMed", "id": "32767999", "url": "https://pubmed.ncbi.nlm.nih.gov/32767999" }, { "database": "PubMed", "id": "32807795", "url": "https://pubmed.ncbi.nlm.nih.gov/32807795" }, { "database": "PubMed", "id": "32811873", "url": "https://pubmed.ncbi.nlm.nih.gov/32811873" }, { "database": "PubMed", "id": "32850477", "url": "https://pubmed.ncbi.nlm.nih.gov/32850477" }, { "database": "PubMed", "id": "32852592", "url": "https://pubmed.ncbi.nlm.nih.gov/32852592" }, { "database": "PubMed", "id": "32863764", "url": "https://pubmed.ncbi.nlm.nih.gov/32863764" }, { "database": "PubMed", "id": "32868906", "url": "https://pubmed.ncbi.nlm.nih.gov/32868906" }, { "database": "PubMed", "id": "32877289", "url": "https://pubmed.ncbi.nlm.nih.gov/32877289" }, { "database": "PubMed", "id": "32885530", "url": "https://pubmed.ncbi.nlm.nih.gov/32885530" }, { "database": "PubMed", "id": "32908147", "url": "https://pubmed.ncbi.nlm.nih.gov/32908147" }, { "database": "PubMed", "id": "32922036", "url": "https://pubmed.ncbi.nlm.nih.gov/32922036" }, { "database": "PubMed", "id": "32929201", "url": "https://pubmed.ncbi.nlm.nih.gov/32929201" }, { "database": "PubMed", "id": "32961646", "url": "https://pubmed.ncbi.nlm.nih.gov/32961646" }, { "database": "PubMed", "id": "32971907", "url": "https://pubmed.ncbi.nlm.nih.gov/32971907" }, { "database": "PubMed", "id": "32972460", "url": "https://pubmed.ncbi.nlm.nih.gov/32972460" }, { "database": "PubMed", "id": "32973302", "url": "https://pubmed.ncbi.nlm.nih.gov/32973302" }, { "database": "PubMed", "id": "33015502", "url": "https://pubmed.ncbi.nlm.nih.gov/33015502" }, { "database": "PubMed", "id": "33038372", "url": "https://pubmed.ncbi.nlm.nih.gov/33038372" }, { "database": "PubMed", "id": "33040485", "url": "https://pubmed.ncbi.nlm.nih.gov/33040485" }, { "database": "PubMed", "id": "33042115", "url": "https://pubmed.ncbi.nlm.nih.gov/33042115" }, { "database": "PubMed", "id": "33053804", "url": "https://pubmed.ncbi.nlm.nih.gov/33053804" }, { "database": "PubMed", "id": "33061855", "url": "https://pubmed.ncbi.nlm.nih.gov/33061855" }, { "database": "PubMed", "id": "33066004", "url": "https://pubmed.ncbi.nlm.nih.gov/33066004" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33140053", "url": "https://pubmed.ncbi.nlm.nih.gov/33140053" }, { "database": "PubMed", "id": "33144502", "url": "https://pubmed.ncbi.nlm.nih.gov/33144502" }, { "database": "PubMed", "id": "33164240", "url": "https://pubmed.ncbi.nlm.nih.gov/33164240" }, { "database": "PubMed", "id": "33174044", "url": "https://pubmed.ncbi.nlm.nih.gov/33174044" }, { "database": "PubMed", "id": "33178223", "url": "https://pubmed.ncbi.nlm.nih.gov/33178223" }, { "database": "PubMed", "id": "33193827", "url": "https://pubmed.ncbi.nlm.nih.gov/33193827" }, { "database": "PubMed", "id": "33217668", "url": "https://pubmed.ncbi.nlm.nih.gov/33217668" }, { "database": "PubMed", "id": "33249747", "url": "https://pubmed.ncbi.nlm.nih.gov/33249747" }, { "database": "PubMed", "id": "33257655", "url": "https://pubmed.ncbi.nlm.nih.gov/33257655" }, { "database": "PubMed", "id": "33259114", "url": "https://pubmed.ncbi.nlm.nih.gov/33259114" }, { "database": "PubMed", "id": "33262462", "url": "https://pubmed.ncbi.nlm.nih.gov/33262462" }, { "database": "PubMed", "id": "33274592", "url": "https://pubmed.ncbi.nlm.nih.gov/33274592" }, { "database": "PubMed", "id": "33277798", "url": "https://pubmed.ncbi.nlm.nih.gov/33277798" }, { "database": "PubMed", "id": "33279931", "url": "https://pubmed.ncbi.nlm.nih.gov/33279931" }, { "database": "PubMed", "id": "33281966", "url": "https://pubmed.ncbi.nlm.nih.gov/33281966" }, { "database": "PubMed", "id": "33291686", "url": "https://pubmed.ncbi.nlm.nih.gov/33291686" }, { "database": "PubMed", "id": "33293765", "url": "https://pubmed.ncbi.nlm.nih.gov/33293765" }, { "database": "PubMed", "id": "33380422", "url": "https://pubmed.ncbi.nlm.nih.gov/33380422" }, { "database": "PubMed", "id": "33391507", "url": "https://pubmed.ncbi.nlm.nih.gov/33391507" }, { "database": "PubMed", "id": "33392396", "url": "https://pubmed.ncbi.nlm.nih.gov/33392396" }, { "database": "PubMed", "id": "33420372", "url": "https://pubmed.ncbi.nlm.nih.gov/33420372" }, { "database": "PubMed", "id": "33440995", "url": "https://pubmed.ncbi.nlm.nih.gov/33440995" }, { "database": "PubMed", "id": "33448097", "url": "https://pubmed.ncbi.nlm.nih.gov/33448097" }, { "database": "PubMed", "id": "33450849", "url": "https://pubmed.ncbi.nlm.nih.gov/33450849" }, { "database": "PubMed", "id": "33469308", "url": "https://pubmed.ncbi.nlm.nih.gov/33469308" }, { "database": "PubMed", "id": "33513694", "url": "https://pubmed.ncbi.nlm.nih.gov/33513694" }, { "database": "PubMed", "id": "33517393", "url": "https://pubmed.ncbi.nlm.nih.gov/33517393" }, { "database": "PubMed", "id": "33529218", "url": "https://pubmed.ncbi.nlm.nih.gov/33529218" }, { "database": "PubMed", "id": "33541421", "url": "https://pubmed.ncbi.nlm.nih.gov/33541421" }, { "database": "PubMed", "id": "33640759", "url": "https://pubmed.ncbi.nlm.nih.gov/33640759" }, { "database": "PubMed", "id": "33658640", "url": "https://pubmed.ncbi.nlm.nih.gov/33658640" }, { "database": "PubMed", "id": "33660414", "url": "https://pubmed.ncbi.nlm.nih.gov/33660414" }, { "database": "PubMed", "id": "33669259", "url": "https://pubmed.ncbi.nlm.nih.gov/33669259" }, { "database": "PubMed", "id": "33669634", "url": "https://pubmed.ncbi.nlm.nih.gov/33669634" }, { "database": "PubMed", "id": "33772065", "url": "https://pubmed.ncbi.nlm.nih.gov/33772065" }, { "database": "PubMed", "id": "33818016", "url": "https://pubmed.ncbi.nlm.nih.gov/33818016" }, { "database": "PubMed", "id": "33824475", "url": "https://pubmed.ncbi.nlm.nih.gov/33824475" }, { "database": "PubMed", "id": "33839684", "url": "https://pubmed.ncbi.nlm.nih.gov/33839684" }, { "database": "PubMed", "id": "33909625", "url": "https://pubmed.ncbi.nlm.nih.gov/33909625" }, { "database": "PubMed", "id": "33920736", "url": "https://pubmed.ncbi.nlm.nih.gov/33920736" }, { "database": "PubMed", "id": "33924087", "url": "https://pubmed.ncbi.nlm.nih.gov/33924087" }, { "database": "PubMed", "id": "33968084", "url": "https://pubmed.ncbi.nlm.nih.gov/33968084" }, { "database": "PubMed", "id": "33986510", "url": "https://pubmed.ncbi.nlm.nih.gov/33986510" }, { "database": "PubMed", "id": "34067421", "url": "https://pubmed.ncbi.nlm.nih.gov/34067421" }, { "database": "PubMed", "id": "34440160", "url": "https://pubmed.ncbi.nlm.nih.gov/34440160" }, { "database": "PubMed", "id": "34908808", "url": "https://pubmed.ncbi.nlm.nih.gov/34908808" }, { "database": "PubMed", "id": "35131454", "url": "https://pubmed.ncbi.nlm.nih.gov/35131454" }, { "database": "PubMed", "id": "35184394", "url": "https://pubmed.ncbi.nlm.nih.gov/35184394" }, { "database": "PubMed", "id": "35200033", "url": "https://pubmed.ncbi.nlm.nih.gov/35200033" }, { "database": "PubMed", "id": "35476936", "url": "https://pubmed.ncbi.nlm.nih.gov/35476936" }, { "database": "PubMed", "id": "35566660", "url": "https://pubmed.ncbi.nlm.nih.gov/35566660" }, { "database": "PubMed", "id": "35670018", "url": "https://pubmed.ncbi.nlm.nih.gov/35670018" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "35722967", "url": "https://pubmed.ncbi.nlm.nih.gov/35722967" }, { "database": "PubMed", "id": "35756080", "url": "https://pubmed.ncbi.nlm.nih.gov/35756080" }, { "database": "PubMed", "id": "35809767", "url": "https://pubmed.ncbi.nlm.nih.gov/35809767" }, { "database": "PubMed", "id": "35932642", "url": "https://pubmed.ncbi.nlm.nih.gov/35932642" }, { "database": "PubMed", "id": "36017196", "url": "https://pubmed.ncbi.nlm.nih.gov/36017196" }, { "database": "PubMed", "id": "36068200", "url": "https://pubmed.ncbi.nlm.nih.gov/36068200" }, { "database": "PubMed", "id": "36103247", "url": "https://pubmed.ncbi.nlm.nih.gov/36103247" }, { "database": "PubMed", "id": "36179418", "url": "https://pubmed.ncbi.nlm.nih.gov/36179418" }, { "database": "PubMed", "id": "36207761", "url": "https://pubmed.ncbi.nlm.nih.gov/36207761" }, { "database": "PubMed", "id": "36282975", "url": "https://pubmed.ncbi.nlm.nih.gov/36282975" }, { "database": "PubMed", "id": "36362294", "url": "https://pubmed.ncbi.nlm.nih.gov/36362294" }, { "database": "PubMed", "id": "9531474", "url": "https://pubmed.ncbi.nlm.nih.gov/9531474" }, { "database": "PubMed", "id": "12637586", "url": "https://pubmed.ncbi.nlm.nih.gov/12637586" }, { "database": "PubMed", "id": "15592455", "url": "https://pubmed.ncbi.nlm.nih.gov/15592455" }, { "database": "PubMed", "id": "16568091", "url": "https://pubmed.ncbi.nlm.nih.gov/16568091" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22306293", "url": "https://pubmed.ncbi.nlm.nih.gov/22306293" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26293184", "url": "https://pubmed.ncbi.nlm.nih.gov/26293184" }, { "database": "PubMed", "id": "31899195", "url": "https://pubmed.ncbi.nlm.nih.gov/31899195" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "O60674-1", "kinase_gene_name": "JAK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11152457", "url": "https://pubmed.ncbi.nlm.nih.gov/11152457" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "P06239-1", "kinase_gene_name": "LCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "P22455-1", "kinase_gene_name": "FGFR4", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "P22607-1", "kinase_gene_name": "FGFR3", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "P23458-1", "kinase_gene_name": "JAK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "10982844", "url": "https://pubmed.ncbi.nlm.nih.gov/10982844" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "PubMed", "id": "7504784", "url": "https://pubmed.ncbi.nlm.nih.gov/7504784" }, { "database": "PubMed", "id": "11823427", "url": "https://pubmed.ncbi.nlm.nih.gov/11823427" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "P29597-1", "kinase_gene_name": "TYK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" } ], "mutagenesis": [ { "start_pos": 577, "end_pos": 577, "sequence_org": "Y", "sequence_mut": "F", "comment": "Minor effect on kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" } ], "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 724, "end_pos": 724, "sequence_org": "Y", "sequence_mut": "F", "comment": "Strongly reduced kinase activity. Strongly reduced mitogen activity.", "evidence": [ { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" } ], "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 760, "end_pos": 760, "sequence_org": "Y", "sequence_mut": "F", "comment": "Minor effect on kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" } ], "uniprot_canonical_ac": "P22607-1" }, { "start_pos": 770, "end_pos": 770, "sequence_org": "Y", "sequence_mut": "F", "comment": "Minor effect on kinase activity. Increased mitogen activity.", "evidence": [ { "database": "UniProtKB", "id": "P22607", "url": "https://www.uniprot.org/uniprotkb/P22607" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" } ], "uniprot_canonical_ac": "P22607-1" } ], "record_id": "pubmed.11294897", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prognostic significance of UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-3 (GalNAc-T3) expression in patients with gastric carcinoma.", "journal": "Cancer Sci.", "date": "2003", "authors": "Onitsuka Koji, Shibao Kazunori, Nakayama Yoshifumi, Minagawa Noritaka, Hirata Keiji, Izumi Hiroto, Matsuo Ken-ichi, Nagata Naoki, Kitazato Kenji, Kohno Kimitoshi, Itoh Hideaki", "reference": { "type": "PubMed", "id": "12708471", "url": "https://pubmed.ncbi.nlm.nih.gov/12708471" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12708471", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Point mutation in FGF receptor eliminates phosphatidylinositol hydrolysis without affecting mitogenesis.", "journal": "Nature", "date": "1992", "authors": "Mohammadi M, Dionne CA, Li W, Li N, Spivak T, Honegger AM, Jaye M, Schlessinger J", "reference": { "type": "PubMed", "id": "1379698", "url": "https://pubmed.ncbi.nlm.nih.gov/1379698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23352-1", "protein_name": "Anosmin-1", "gene_name": "ANOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11362-1", "protein_name": "Fibroblast growth factor receptor 1", "gene_name": "FGFR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAT2-1", "protein_name": "Fibroblast growth factor-binding protein 3", "gene_name": "FGFBP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYJ0-1", "protein_name": "Fibroblast growth factor-binding protein 2", "gene_name": "FGFBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14908-1", "protein_name": "PDZ domain-containing protein GIPC1", "gene_name": "GIPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Z14-1", "protein_name": "Beta-klotho", "gene_name": "KLB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14512-1", "protein_name": "Fibroblast growth factor-binding protein 1", "gene_name": "FGFBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 766, "end_pos": 766, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes interaction with PLCG1 and SHB. Decreases phosphorylation of FRS2, activation of RAS and MAP kinase signaling and stimulation of cell proliferation.", "evidence": [ { "database": "UniProtKB", "id": "P11362", "url": "https://www.uniprot.org/uniprotkb/P11362" }, { "database": "PubMed", "id": "12181353", "url": "https://pubmed.ncbi.nlm.nih.gov/12181353" }, { "database": "PubMed", "id": "1379698", "url": "https://pubmed.ncbi.nlm.nih.gov/1379698" }, { "database": "PubMed", "id": "7516330", "url": "https://pubmed.ncbi.nlm.nih.gov/7516330" }, { "database": "PubMed", "id": "1379697", "url": "https://pubmed.ncbi.nlm.nih.gov/1379697" } ], "uniprot_canonical_ac": "P11362-1" } ], "record_id": "pubmed.1379698", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in GALNT3, encoding a protein involved in O-linked glycosylation, cause familial tumoral calcinosis.", "journal": "Nature genetics", "date": "2004", "authors": "Topaz O, Shurman DL, Bergman R, Indelman M, Ratajczak P, Mizrachi M, Khamaysi Z, Behar D, Petronius D, Friedman V, Zelikovic I, Raimer S, Metzker A, Richard G, Sprecher E", "reference": { "type": "PubMed", "id": "15133511", "url": "https://pubmed.ncbi.nlm.nih.gov/15133511" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "Q14435", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14435" }, { "id": "rs137853086", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853086" }, { "id": "rs137853086", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs137853086" }, { "id": "rs137853086", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853086" }, { "id": "rs137853086", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137853086#frequency_tab" }, { "id": "rs137853086", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137853086" }, { "id": "15133511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15133511" }, { "id": "15687324", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15687324" }, { "id": "8338191", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8338191" } ], "glycoeffect": [], "start_pos": 162, "end_pos": 162, "subjects_tested": "4799", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "2", "chr_pos": "165770217", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R162", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "unlinked_id_list": [ "DOID:4765" ], "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] }, { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.15133511", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Generation and annotation of the DNA sequences of human chromosomes 2 and 4.", "journal": "Nature", "date": "2005", "authors": "Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK", "reference": { "type": "PubMed", "id": "15815621", "url": "https://pubmed.ncbi.nlm.nih.gov/15815621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1N0-1", "protein_name": "C-type lectin domain family 4 member F", "gene_name": "CLEC4F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UW15-1", "protein_name": "Regenerating islet-derived protein 3-gamma", "gene_name": "REG3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0V9-1", "protein_name": "VIP36-like protein", "gene_name": "LMAN2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BWP8-1", "protein_name": "Collectin-11", "gene_name": "COLEC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ1-1", "protein_name": "Endoplasmic reticulum lectin 1", "gene_name": "ERLEC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC8-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 13", "gene_name": "GALNT13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FL9-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 14", "gene_name": "GALNT14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJ71-1", "protein_name": "C-type lectin domain family 4 member K", "gene_name": "CD207", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q49A17-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase-like 6", "gene_name": "GALNTL6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15815621", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for fibroblast growth factor receptor activation.", "journal": "Cytokine & growth factor reviews", "date": "2005", "authors": "Mohammadi M, Olsen SK, Ibrahimi OA", "reference": { "type": "PubMed", "id": "15863029", "url": "https://pubmed.ncbi.nlm.nih.gov/15863029" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23352-1", "protein_name": "Anosmin-1", "gene_name": "ANOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAT2-1", "protein_name": "Fibroblast growth factor-binding protein 3", "gene_name": "FGFBP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYJ0-1", "protein_name": "Fibroblast growth factor-binding protein 2", "gene_name": "FGFBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14908-1", "protein_name": "PDZ domain-containing protein GIPC1", "gene_name": "GIPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14512-1", "protein_name": "Fibroblast growth factor-binding protein 1", "gene_name": "FGFBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15863029", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hyperphosphatemic familial tumoral calcinosis caused by a mutation in GALNT3 in a European kindred.", "journal": "Journal of human genetics", "date": "2006", "authors": "Specktor Polina, Cooper John G, Indelman Margarita, Sprecher Eli", "reference": { "type": "PubMed", "id": "16528452", "url": "https://pubmed.ncbi.nlm.nih.gov/16528452" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137853087", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853087" }, { "id": "rs137853087", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137853087#frequency_tab" }, { "id": "rs137853087", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137853087" }, { "id": "16528452", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16528452" } ], "glycoeffect": [], "start_pos": 592, "end_pos": 592, "sequence_org": "Q", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165749747", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Q592", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000100000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.16528452", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A tyrosine-phosphorylated carboxy-terminal peptide of the fibroblast growth factor receptor (Flg) is a binding site for the SH2 domain of phospholipase C-gamma 1.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Mohammadi M, Honegger AM, Rotin D, Fischer R, Bellot F, Li W, Dionne CA, Jaye M, Rubinstein M, Schlessinger J", "reference": { "type": "PubMed", "id": "1656221", "url": "https://pubmed.ncbi.nlm.nih.gov/1656221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11362-1", "protein_name": "Fibroblast growth factor receptor 1", "gene_name": "FGFR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAT2-1", "protein_name": "Fibroblast growth factor-binding protein 3", "gene_name": "FGFBP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYJ0-1", "protein_name": "Fibroblast growth factor-binding protein 2", "gene_name": "FGFBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14908-1", "protein_name": "PDZ domain-containing protein GIPC1", "gene_name": "GIPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Z14-1", "protein_name": "Beta-klotho", "gene_name": "KLB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14512-1", "protein_name": "Fibroblast growth factor-binding protein 1", "gene_name": "FGFBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 766, "end_pos": 766, "kinase_uniprot_canonical_ac": "P11362-1", "kinase_gene_name": "FGFR1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11362", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11362" }, { "database": "PubMed", "id": "16507368", "url": "https://pubmed.ncbi.nlm.nih.gov/16507368" }, { "database": "PubMed", "id": "1656221", "url": "https://pubmed.ncbi.nlm.nih.gov/1656221" }, { "database": "PubMed", "id": "8622701", "url": "https://pubmed.ncbi.nlm.nih.gov/8622701" }, { "database": "UniProtKB", "id": "P11362", "url": "https://www.uniprot.org/uniprotkb/P11362" }, { "database": "PubMed", "id": "19665973", "url": "https://pubmed.ncbi.nlm.nih.gov/19665973" } ], "site_lbl": "Tyr766", "uniprot_canonical_ac": "P11362-1" }, { "start_pos": 766, "end_pos": 766, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P11362", "url": "https://www.uniprot.org/uniprotkb/P11362" }, { "database": "IntAct", "id": "P11362", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11362*" }, { "database": "iPTMnet", "id": "P11362", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11362" }, { "database": "PubMed", "id": "18412956", "url": "https://pubmed.ncbi.nlm.nih.gov/18412956" }, { "database": "PubMed", "id": "1656221", "url": "https://pubmed.ncbi.nlm.nih.gov/1656221" }, { "database": "PubMed", "id": "12181353", "url": "https://pubmed.ncbi.nlm.nih.gov/12181353" }, { "database": "PubMed", "id": "8321198", "url": "https://pubmed.ncbi.nlm.nih.gov/8321198" }, { "database": "PubMed", "id": "22247553", "url": "https://pubmed.ncbi.nlm.nih.gov/22247553" } ], "site_lbl": "Tyr766", "uniprot_canonical_ac": "P11362-1" } ], "record_id": "pubmed.1656221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zhang X, Ibrahimi OA, Olsen SK, Umemori H, Mohammadi M, Ornitz DM", "reference": { "type": "PubMed", "id": "16597617", "url": "https://pubmed.ncbi.nlm.nih.gov/16597617" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23352-1", "protein_name": "Anosmin-1", "gene_name": "ANOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11362-1", "protein_name": "Fibroblast growth factor receptor 1", "gene_name": "FGFR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60258-1", "protein_name": "Fibroblast growth factor 17", "gene_name": "FGF17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55075-1", "protein_name": "Fibroblast growth factor 8", "gene_name": "FGF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22607-1", "protein_name": "Fibroblast growth factor receptor 3", "gene_name": "FGFR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAT2-1", "protein_name": "Fibroblast growth factor-binding protein 3", "gene_name": "FGFBP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYJ0-1", "protein_name": "Fibroblast growth factor-binding protein 2", "gene_name": "FGFBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14908-1", "protein_name": "PDZ domain-containing protein GIPC1", "gene_name": "GIPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21802-1", "protein_name": "Fibroblast growth factor receptor 2", "gene_name": "FGFR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14512-1", "protein_name": "Fibroblast growth factor-binding protein 1", "gene_name": "FGFBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16597617", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polypeptide GalNAc-transferase T3 and familial tumoral calcinosis. Secretion of fibroblast growth factor 23 requires O-glycosylation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kato K, Jeanneau C, Tarp MA, Benet-Pages A, Lorenz-Depiereux B, Bennett EP, Mandel U, Strom TM, Clausen H", "reference": { "type": "PubMed", "id": "16638743", "url": "https://pubmed.ncbi.nlm.nih.gov/16638743" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "Q9GZV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9GZV9#ptm_processing" }, { "id": "31932717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" }, { "id": "16638743", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16638743" } ], "filter_code": "000000000000000010000.00000010000000.00.01101", "uniprot_canonical_ac": "Q9GZV9-1" } ], "record_id": "pubmed.16638743", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumoral calcinosis presenting with eyelid calcifications due to novel missense mutations in the glycosyl transferase domain of the GALNT3 gene.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2006-11", "authors": "Ichikawa Shoji, Imel Erik A, Sorenson Andrea H, Severe Rebecca, Knudson Paul, Harris Gerald J, Shaker Joseph L, Econs Michael J", "reference": { "type": "PubMed", "id": "16940445", "url": "https://pubmed.ncbi.nlm.nih.gov/16940445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137853091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853091" }, { "id": "rs137853091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137853091" }, { "id": "16940445", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16940445" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 359, "end_pos": 359, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 2 filters: o-glyco-site-loss (T->K); glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165758862", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T359", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000010000.00000000001000.000000000001000000.01001.10.010.001", "uniprot_canonical_ac": "Q14435-1" }, { "evidence": [ { "id": "rs137853090", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853090" }, { "id": "rs137853090", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs137853090" }, { "id": "rs137853090", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853090" }, { "id": "rs137853090", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137853090#frequency_tab" }, { "id": "rs137853090", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137853090" }, { "id": "16940445", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16940445" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 272, "end_pos": 272, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165761928", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T272", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000010000.00000000000000.000000000001000000.00001.10.000.001", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.16940445", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel GALNT3 mutations causing hyperostosis-hyperphosphatemia syndrome result in low intact fibroblast growth factor 23 concentrations.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2007-05", "authors": "Ichikawa Shoji, Guigonis Vincent, Imel Erik A, Courouble M\u00e9lanie, Heissat Sophie, Henley John D, Sorenson Andrea H, Petit Barbara, Lienhardt Anne, Econs Michael J", "reference": { "type": "PubMed", "id": "17311862", "url": "https://pubmed.ncbi.nlm.nih.gov/17311862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs766750282", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766750282" }, { "id": "17311862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17311862" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 269, "end_pos": 269, "sequence_org": "T", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165761940", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T269", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000010000.00000000000000.000000000001000000.00001.11.000.001", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.17311862", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two novel nonsense mutations in GALNT3 gene are responsible for familial tumoral calcinosis.", "journal": "Journal of human genetics", "date": "2007", "authors": "Barbieri Anna Maria, Filopanti Marcello, Bua Guido, Beck-Peccoz Paolo", "reference": { "type": "PubMed", "id": "17351710", "url": "https://pubmed.ncbi.nlm.nih.gov/17351710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137853088", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853088" }, { "id": "rs137853088", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs137853088" }, { "id": "17351710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17351710" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 322, "end_pos": 322, "sequence_org": "Y", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165759443", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y322", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000000100.00000000000000.000000000001000000.00001.10.000.001", "uniprot_canonical_ac": "Q14435-1" }, { "evidence": [ { "id": "Q14435", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14435" }, { "id": "rs137853089", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137853089" }, { "id": "rs137853089", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs137853089" }, { "id": "17351710", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17351710" }, { "id": "rs137853089", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs137853089" } ], "glycoeffect": [], "start_pos": 481, "end_pos": 481, "subjects_tested": "4484", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "Q", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "2", "chr_pos": "165755015", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "Q481", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:3017", "DOID:0050938" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] }, { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "000000100000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.17351710", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical variability of familial tumoral calcinosis caused by novel GALNT3 mutations.", "journal": "American journal of medical genetics. Part A", "date": "2010-04", "authors": "Ichikawa Shoji, Baujat Genevi\u00e8ve, Seyahi Aksel, Garoufali Anastasia G, Imel Erik A, Padgett Leah R, Austin Anthony M, Sorenson Andrea H, Pejin Zagorka, Topouchian Vicken, Quartier Pierre, Cormier-Daire Valerie, Dechaux Michele, Malandrinou Fotini Ch, Singhellakis Panagiotis N, Le Merrer Martine, Econs Michael J", "reference": { "type": "PubMed", "id": "20358599", "url": "https://pubmed.ncbi.nlm.nih.gov/20358599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs786205250", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs786205250" }, { "id": "20358599", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20358599" } ], "glycoeffect": [], "start_pos": 226, "end_pos": 226, "sequence_org": "A", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165764895", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A226", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14435-1" }, { "evidence": [ { "id": "rs267606841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267606841" }, { "id": "rs267606841", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs267606841" }, { "id": "20358599", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20358599" } ], "glycoeffect": [], "start_pos": 574, "end_pos": 574, "sequence_org": "C", "sequence_mut": "G", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "2", "chr_pos": "165749801", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C574", "disease": [ { "disease_id": "DOID:0111063", "recommended_name": { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemic familial tumoral calcinosis", "description": "A calcinosis characterized by autosomal recessive inheritance of elevated blood calcium levels and calcium phosphate crystals in cutaneous and subcutaneous tissues that has_material_basis_in mutation in the GALNT3 gene, the FGF23 gene, or the KL gene." }, "synonyms": [ { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "HFTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "PHPTC", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "cortical hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "familial Teutschlaender disease", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hypercalcemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperostosis with hyperphosphatemia", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia hyperostosis syndrome", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "hyperphosphatemia tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "lipocalcinogranulomatosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "morbus Teutschlaender", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "primary hyperphosphatemic tumoral calcinosis", "description": "" }, { "id": "DOID:0111063", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0111063", "name": "tumoral calcinosis with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "HFTC1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Morbus Teutschlaender", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "Teutschlaender disease, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "calcinosis, tumoral, with hyperphosphatemia", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "hyperostosis-hyperphosphatemia syndrome", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, HYPERPHOSPHATEMIC, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, Hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "" }, { "id": "MONDO:0100252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100252", "name": "tumoral calcinosis, primary Hyperphosphatemic", "description": "" }, { "id": "MIM:211900", "resource": "MIM", "url": "https://www.omim.org/entry/211900", "name": "Tumoral calcinosis, hyperphosphatemic, familial, 1", "description": "Tumoral calcinosis, hyperphosphatemic, familial, 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" }, { "id": "0111063", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0111063" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000010000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.20358599", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinically significant missense variants in human GALNT3, GALNT8, GALNT12, and GALNT13 genes: intriguing in silico findings.", "journal": "Journal of cellular biochemistry", "date": "2014", "authors": "Hussain MRM, Nasir J, Al-Aama JY", "reference": { "type": "PubMed", "id": "24038392", "url": "https://pubmed.ncbi.nlm.nih.gov/24038392" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXK2-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 12", "gene_name": "GALNT12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY28-1", "protein_name": "Probable polypeptide N-acetylgalactosaminyltransferase 8", "gene_name": "GALNT8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 359, "start_aa": "Thr", "end_pos": 359, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr359", "evidence": [ { "id": "24038392", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24038392" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000000001000.00.01001", "uniprot_canonical_ac": "Q14435-1" } ], "record_id": "pubmed.24038392", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "GALNT3 Maintains the Epithelial State in Trophoblast Stem Cells.", "journal": "Cell reports", "date": "2019", "authors": "Raghu D, Mobley RJ, Shendy NAM, Perry CH, Abell AN", "reference": { "type": "PubMed", "id": "30917321", "url": "https://pubmed.ncbi.nlm.nih.gov/30917321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30917321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The polypeptide GALNT6 Displays Redundant Functions upon Suppression of its Closest Homolog GALNT3 in Mediating Aberrant O-Glycosylation, Associated with Ovarian Cancer Progression.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Sheta R, Bachvarova M, Macdonald E, Gobeil S, Vanderhyden B, Bachvarov D", "reference": { "type": "PubMed", "id": "31071912", "url": "https://pubmed.ncbi.nlm.nih.gov/31071912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCL4-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 6", "gene_name": "GALNT6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31071912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for fibroblast growth factor 23 O-glycosylation by GalNAc-T3.", "journal": "Nature chemical biology", "date": "2020", "authors": "de Las Rivas M, Paul Daniel EJ, Narimatsu Y, Companon I, Kato K, Hermosilla P, Thureau A, Ceballos-Laita L, Coelho H, Bernado P, Marcelo F, Hansen L, Maeda R, Lostao A, Corzana F, Clausen H, Gerken TA, Hurtado-Guerrero R", "reference": { "type": "PubMed", "id": "31932717", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NCL4-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 6", "gene_name": "GALNT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 277, "end_pos": 277, "sequence_org": "D", "sequence_mut": "H", "comment": "Loss of ability to glycosylate FGF23.", "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" }, { "database": "PubMed", "id": "31932717", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" } ], "uniprot_canonical_ac": "Q14435-1" }, { "start_pos": 510, "end_pos": 633, "sequence_org": "KSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQND", "sequence_mut": "", "comment": "Loss of ability to glycosylate FGF23.", "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" }, { "database": "PubMed", "id": "31932717", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" } ], "uniprot_canonical_ac": "Q14435-1" }, { "start_pos": 519, "end_pos": 519, "sequence_org": "D", "sequence_mut": "H", "comment": "Loss of ability to glycosylate FGF23.", "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" }, { "database": "PubMed", "id": "31932717", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" } ], "uniprot_canonical_ac": "Q14435-1" }, { "start_pos": 178, "end_pos": 178, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9GZV9", "url": "https://www.uniprot.org/uniprotkb/Q9GZV9" }, { "database": "PubMed", "id": "31932717", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" } ], "uniprot_canonical_ac": "Q9GZV9-1" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6S22&bu=0&command=select+.F:171;+center+selection;+zoom+selection" }, "start_pos": 171, "start_aa": "Thr", "end_pos": 171, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr171", "evidence": [ { "id": "Q9GZV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9GZV9#ptm_processing" }, { "id": "31932717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" }, { "id": "6S22", "database": "PDB", "url": "https://www.rcsb.org/structure/6S22" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q9GZV9-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "Q9GZV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9GZV9#ptm_processing" }, { "id": "31932717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" }, { "id": "16638743", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16638743" } ], "filter_code": "000000000000000010000.00000010000000.00.01101", "uniprot_canonical_ac": "Q9GZV9-1" } ], "phosphorylation": [ { "start_pos": 180, "end_pos": 180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "Q9GZV9", "url": "https://www.uniprot.org/uniprotkb/Q9GZV9" }, { "database": "iPTMnet", "id": "Q9GZV9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9GZV9" }, { "database": "PubMed", "id": "24706917", "url": "https://pubmed.ncbi.nlm.nih.gov/24706917" }, { "database": "PubMed", "id": "31932717", "url": "https://pubmed.ncbi.nlm.nih.gov/31932717" } ], "site_lbl": "Ser180", "uniprot_canonical_ac": "Q9GZV9-1" } ], "record_id": "pubmed.31932717", "abstract": "", "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hyperphosphatemic familial tumoral calcinosis caused by a novel variant in the GALNT3 gene.", "journal": "Journal of endocrinological investigation", "date": "2020", "authors": "Mahjoubi F, Ghadir M, Samanian S, Heydari I, Honardoost M", "reference": { "type": "PubMed", "id": "32125652", "url": "https://pubmed.ncbi.nlm.nih.gov/32125652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14435-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 3", "gene_name": "GALNT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14435", "url": "https://www.uniprot.org/uniprotkb/Q14435" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32125652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GalNAc-T3 and MUC1, a combined predictor of prognosis and recurrence in solitary pulmonary adenocarcinoma initially diagnosed as malignant solitary pulmonary nodule (