[ { "title": "Cloning and sequence analysis of cDNA for the precursor of human growth hormone-releasing factor, somatocrinin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Gubler U, Monahan JJ, Lomedico PT, Bhatt RS, Collier KJ, Hoffman BJ, Bohlen P, Esch F, Ling N, Zeytin F, Brazeau P, Poonian MS, Gage LP", "reference": { "type": "PubMed", "id": "6192430", "url": "https://pubmed.ncbi.nlm.nih.gov/6192430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6192430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The isolation and sequencing of human gastric inhibitory peptide (GIP).", "journal": "FEBS letters", "date": "1984", "authors": "Moody AJ, Thim L, Valverde I", "reference": { "type": "PubMed", "id": "6745415", "url": "https://pubmed.ncbi.nlm.nih.gov/6745415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6745415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of a cDNA for the human prostanoid IP receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Boie Y, Rushmore TH, Darmon-Goodwin A, Grygorczyk R, Slipetz DM, Metters KM, Abramovitz M", "reference": { "type": "PubMed", "id": "7512962", "url": "https://pubmed.ncbi.nlm.nih.gov/7512962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43119-1", "protein_name": "Prostacyclin receptor", "gene_name": "PTGIR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7512962", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of a cDNA for the human prostacyclin receptor.", "journal": "FEBS letters", "date": "1994", "authors": "Katsuyama M, Sugimoto Y, Namba T, Irie A, Negishi M, Narumiya S, Ichikawa A", "reference": { "type": "PubMed", "id": "7514139", "url": "https://pubmed.ncbi.nlm.nih.gov/7514139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43119-1", "protein_name": "Prostacyclin receptor", "gene_name": "PTGIR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7514139", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel Gs alpha mutant in a patient with Albright hereditary osteodystrophy uncouples cell surface receptors from adenylyl cyclase.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Schwindinger WF, Miric A, Zimmerman D, Levine MA", "reference": { "type": "PubMed", "id": "7523385", "url": "https://pubmed.ncbi.nlm.nih.gov/7523385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7523385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential activation of Gi and Gs proteins by E- and I-type prostaglandins in membranes from the human erythroleukaemia cell line, HEL.", "journal": "Biochimica et biophysica acta", "date": "1995", "authors": "Schwaner I, Offermanns S, Spicher K, Seifert R, Schultz G", "reference": { "type": "PubMed", "id": "7532011", "url": "https://pubmed.ncbi.nlm.nih.gov/7532011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13258-1", "protein_name": "Prostaglandin D2 receptor", "gene_name": "PTGDR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43116-1", "protein_name": "Prostaglandin E2 receptor EP2 subtype", "gene_name": "PTGER2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34995-1", "protein_name": "Prostaglandin E2 receptor EP1 subtype", "gene_name": "PTGER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43119-1", "protein_name": "Prostacyclin receptor", "gene_name": "PTGIR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43088-1", "protein_name": "Prostaglandin F2-alpha receptor", "gene_name": "PTGFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Y4-1", "protein_name": "Prostaglandin D2 receptor 2", "gene_name": "PTGDR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21731-3", "protein_name": "Thromboxane A2 receptor", "gene_name": "TBXA2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43115-1", "protein_name": "Prostaglandin E2 receptor EP3 subtype", "gene_name": "PTGER3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35408-1", "protein_name": "Prostaglandin E2 receptor EP4 subtype", "gene_name": "PTGER4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7532011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma.", "journal": "FEBS letters", "date": "1995", "authors": "Volz A, Goke R, Lankat-Buttgereit B, Fehmann HC, Bode HP, Goke B", "reference": { "type": "PubMed", "id": "7589426", "url": "https://pubmed.ncbi.nlm.nih.gov/7589426" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7589426", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and expression of a human anterior pituitary receptor for growth hormone-releasing hormone.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "Gaylinn BD, Harrison JK, Zysk JR, Lyons CE, Lynch KR, Thorner MO", "reference": { "type": "PubMed", "id": "7680413", "url": "https://pubmed.ncbi.nlm.nih.gov/7680413" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7680413", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and expression of a human secretin receptor.", "journal": "Molecular pharmacology", "date": "1995", "authors": "Patel DR, Kong Y, Sreedharan SP", "reference": { "type": "PubMed", "id": "7700244", "url": "https://pubmed.ncbi.nlm.nih.gov/7700244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7700244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G-protein mutations in human pituitary adrenocorticotrophic hormone-secreting adenomas.", "journal": "European journal of clinical investigation", "date": "1995", "authors": "Williamson EA, Ince PG, Harrison D, Kendall-Taylor P, Harris PE", "reference": { "type": "PubMed", "id": "7737262", "url": "https://pubmed.ncbi.nlm.nih.gov/7737262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7737262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of Gs alpha subunit in thyroid tumors bearing a mutated Gs alpha gene.", "journal": "Journal of cancer research and clinical oncology", "date": "1995", "authors": "Gorelov VN, Dumon K, Barteneva NS, Palm D, Roher HD, Goretzki PE", "reference": { "type": "PubMed", "id": "7751320", "url": "https://pubmed.ncbi.nlm.nih.gov/7751320" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7751320", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and functional characterization of a human VIP receptor from SUP-T1 lymphoblasts.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Svoboda M, Tastenoy M, Van Rampelbergh J, Goossens JF, De Neef P, Waelbroeck M, Robberecht P", "reference": { "type": "PubMed", "id": "7811244", "url": "https://pubmed.ncbi.nlm.nih.gov/7811244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7811244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and functional expression of a cDNA encoding a human pituitary adenylate cyclase activating polypeptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Ogi K, Miyamoto Y, Masuda Y, Habata Y, Hosoya M, Ohtaki T, Masuo Y, Onda H, Fujino M", "reference": { "type": "PubMed", "id": "7902709", "url": "https://pubmed.ncbi.nlm.nih.gov/7902709" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7902709", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rapid GDP release from Gs alpha in patients with gain and loss of endocrine function.", "journal": "Nature", "date": "1994", "authors": "Iiri T, Herzmark P, Nakamoto JM, van Dop C, Bourne HR", "reference": { "type": "PubMed", "id": "8072545", "url": "https://pubmed.ncbi.nlm.nih.gov/8072545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8072545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human glucagon receptor encoding gene: structure, cDNA sequence and chromosomal localization.", "journal": "Gene", "date": "1994", "authors": "Lok S, Kuijper JL, Jelinek LJ, Kramer JM, Whitmore TE, Sprecher CA, Mathewes S, Grant FJ, Biggs SH, Rosenberg GB, et al.", "reference": { "type": "PubMed", "id": "8144028", "url": "https://pubmed.ncbi.nlm.nih.gov/8144028" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8144028", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterogeneous mutations in the gene encoding the alpha-subunit of the stimulatory G protein of adenylyl cyclase in Albright hereditary osteodystrophy.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Miric A, Vechio JD, Levine MA", "reference": { "type": "PubMed", "id": "8388883", "url": "https://pubmed.ncbi.nlm.nih.gov/8388883" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8388883", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Sreedharan SP, Patel DR, Huang JX, Goetzl EJ", "reference": { "type": "PubMed", "id": "8390245", "url": "https://pubmed.ncbi.nlm.nih.gov/8390245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8390245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pseudohypoparathyroidism, a novel mutation in the betagamma-contact region of Gsalpha impairs receptor stimulation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Farfel Z, Iiri T, Shapira H, Roitman A, Mouallem M, Bourne HR", "reference": { "type": "PubMed", "id": "8702665", "url": "https://pubmed.ncbi.nlm.nih.gov/8702665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8702665", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characteristics of gsp-positive growth hormone-secreting pituitary tumors in Korean acromegalic patients.", "journal": "European journal of endocrinology", "date": "1996", "authors": "Yang I, Park S, Ryu M, Woo J, Kim S, Kim J, Kim Y, Choi Y", "reference": { "type": "PubMed", "id": "8766942", "url": "https://pubmed.ncbi.nlm.nih.gov/8766942" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8766942", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conditional activation defect of a human Gsalpha mutant.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Iiri T, Farfel Z, Bourne HR", "reference": { "type": "PubMed", "id": "9159128", "url": "https://pubmed.ncbi.nlm.nih.gov/9159128" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9159128", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polymerase chain reaction-based technique for the selective enrichment and analysis of mosaic arg201 mutations in G alpha s from patients with fibrous dysplasia of bone.", "journal": "Bone", "date": "1997", "authors": "Candeliere GA, Roughley PJ, Glorieux FH", "reference": { "type": "PubMed", "id": "9267696", "url": "https://pubmed.ncbi.nlm.nih.gov/9267696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9267696", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel mutation adjacent to the switch III domain of G(S alpha) in a patient with pseudohypoparathyroidism.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Warner DR, Gejman PV, Collins RM, Weinstein LS", "reference": { "type": "PubMed", "id": "9328353", "url": "https://pubmed.ncbi.nlm.nih.gov/9328353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9328353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human GNAS1 gene is imprinted and encodes distinct paternally and biallelically expressed G proteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Hayward B E, Kamiya M, Strain L, Moran V, Campbell R, Hayashizaki Y, Bonthron D T", "reference": { "type": "PubMed", "id": "9707596", "url": "https://pubmed.ncbi.nlm.nih.gov/9707596" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9707596", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel mutation in the switch 3 region of Gsalpha in a patient with Albright hereditary osteodystrophy impairs GDP binding and receptor activation.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Warner DR, Weng G, Yu S, Matalon R, Weinstein LS", "reference": { "type": "PubMed", "id": "9727013", "url": "https://pubmed.ncbi.nlm.nih.gov/9727013" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 258, "end_pos": 258, "sequence_org": "V", "sequence_mut": "A", "comment": "Increases GDP release and impairs receptor-mediated activation; markedly elevated intrinsic GTPase rate which will lead to more rapid inactivation.", "evidence": [ { "database": "UniProtKB", "id": "P63092", "url": "https://www.uniprot.org/uniprotkb/P63092" }, { "database": "PubMed", "id": "9727013", "url": "https://pubmed.ncbi.nlm.nih.gov/9727013" }, { "database": "PubMed", "id": "10200251", "url": "https://pubmed.ncbi.nlm.nih.gov/10200251" } ], "uniprot_canonical_ac": "Q5JWF2-1" } ], "record_id": "pubmed.9727013", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bidirectional imprinting of a single gene: human GNAS1 encodes distinct maternally, paternally and biallelically derived proteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Hayward B E, Moran V, Strain L, Bonthron D T", "reference": { "type": "PubMed", "id": "9860993", "url": "https://pubmed.ncbi.nlm.nih.gov/9860993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6R0H7-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "Gnas", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9860993", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Munroe DG, Gupta AK, Kooshesh F, Vyas TB, Rizkalla G, Wang H, Demchyshyn L, Yang ZJ, Kamboj RK, Chen H, McCallum K, Sumner-Smith M, Drucker DJ, Crivici A", "reference": { "type": "PubMed", "id": "9990065", "url": "https://pubmed.ncbi.nlm.nih.gov/9990065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JWF2-1", "protein_name": "Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas", "gene_name": "GNAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18509-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide", "gene_name": "ADCYAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95838-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "GLP2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z0W0-1", "protein_name": "Glucagon-like peptide 2 receptor", "gene_name": "Glp2r", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P09683-1", "protein_name": "Secretin", "gene_name": "SCT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01286-1", "protein_name": "Somatoliberin", "gene_name": "GHRH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47872-1", "protein_name": "Secretin receptor", "gene_name": "SCTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02643-1", "protein_name": "Growth hormone-releasing hormone receptor", "gene_name": "GHRHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43220-1", "protein_name": "Glucagon-like peptide 1 receptor", "gene_name": "GLP1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48546-1", "protein_name": "Gastric inhibitory polypeptide receptor", "gene_name": "GIPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09681-1", "protein_name": "Gastric inhibitory polypeptide", "gene_name": "GIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41586-1", "protein_name": "Pituitary adenylate cyclase-activating polypeptide type I receptor", "gene_name": "ADCYAP1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01275-1", "protein_name": "Pro-glucagon", "gene_name": "GCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01282-1", "protein_name": "VIP peptides", "gene_name": "VIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47871-1", "protein_name": "Glucagon receptor", "gene_name": "GCGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41587-1", "protein_name": "Vasoactive intestinal polypeptide receptor 2", "gene_name": "VIPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JWF2", "url": "https://www.uniprot.org/uniprotkb/Q5JWF2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9990065", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Galpha 13 requires palmitoylation for plasma membrane localization, Rho-dependent signaling, and promotion of p115-RhoGEF membrane binding.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Bhattacharyya R, Wedegaertner PB", "reference": { "type": "PubMed", "id": "10747909", "url": "https://pubmed.ncbi.nlm.nih.gov/10747909" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 14, "end_pos": 14, "sequence_org": "C", "sequence_mut": "S", "comment": "Fails to localize to plasma membranes and failed to activate Rho-dependent serum response factor-mediated transcription and actin stress fiber formation.", "evidence": [ { "database": "UniProtKB", "id": "Q14344", "url": "https://www.uniprot.org/uniprotkb/Q14344" }, { "database": "PubMed", "id": "10747909", "url": "https://pubmed.ncbi.nlm.nih.gov/10747909" } ], "uniprot_canonical_ac": "Q14344-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "C", "sequence_mut": "S", "comment": "Fails to localize to plasma membranes and failed to activate Rho-dependent serum response factor-mediated transcription and actin stress fiber formation.", "evidence": [ { "database": "UniProtKB", "id": "Q14344", "url": "https://www.uniprot.org/uniprotkb/Q14344" }, { "database": "PubMed", "id": "10747909", "url": "https://pubmed.ncbi.nlm.nih.gov/10747909" } ], "uniprot_canonical_ac": "Q14344-1" } ], "record_id": "pubmed.10747909", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the rgRGS domain of p115RhoGEF.", "journal": "Nat. Struct. Biol.", "date": "2001", "authors": "Chen Z, Wells C D, Sternweis P C, Sprang S R", "reference": { "type": "PubMed", "id": "11524686", "url": "https://pubmed.ncbi.nlm.nih.gov/11524686" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11524686", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of Lbc Rho guanine nucleotide exchange factor with alpha-catenin-related protein, alpha-catulin/CTNNAL1, supports serum response factor activation.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Park B, Nguyen NT, Dutt P, Merdek KD, Bashar M, Sterpetti P, Tosolini A, Testa JR, Toksoz D", "reference": { "type": "PubMed", "id": "12270917", "url": "https://pubmed.ncbi.nlm.nih.gov/12270917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBT7-1", "protein_name": "Alpha-catulin", "gene_name": "CTNNAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12270917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase Calpha-induced p115RhoGEF phosphorylation signals endothelial cytoskeletal rearrangement.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Holinstat M, Mehta D, Kozasa T, Minshall RD, Malik AB", "reference": { "type": "PubMed", "id": "12754211", "url": "https://pubmed.ncbi.nlm.nih.gov/12754211" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12754211", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Rho exchange factor Arhgef1 mediates the effects of angiotensin II on vascular tone and blood pressure.", "journal": "Nature medicine", "date": "2010", "authors": "Guilluy C, Bregeon J, Toumaniantz G, Rolli-Derkinderen M, Retailleau K, Loufrani L, Henrion D, Scalbert E, Bril A, Torres RM, Offermanns S, Pacaud P, Loirand G", "reference": { "type": "PubMed", "id": "20098430", "url": "https://pubmed.ncbi.nlm.nih.gov/20098430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1I6-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "Arhgef1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62120-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "Jak2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q61210-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "Arhgef1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 487, "end_pos": 487, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" }, { "database": "PubMed", "id": "20098430", "url": "https://pubmed.ncbi.nlm.nih.gov/20098430" } ], "uniprot_canonical_ac": "Q92888-1" }, { "start_pos": 738, "end_pos": 738, "sequence_org": "Y", "sequence_mut": "F", "comment": "Lowers the exchange activity.", "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" }, { "database": "PubMed", "id": "20098430", "url": "https://pubmed.ncbi.nlm.nih.gov/20098430" } ], "uniprot_canonical_ac": "Q92888-1" } ], "phosphorylation": [ { "start_pos": 738, "end_pos": 738, "kinase_uniprot_canonical_ac": "O60674-1", "kinase_gene_name": "JAK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92888", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92888" }, { "database": "PubMed", "id": "20098430", "url": "https://pubmed.ncbi.nlm.nih.gov/20098430" } ], "site_lbl": "Tyr738", "uniprot_canonical_ac": "Q92888-1" }, { "start_pos": 738, "end_pos": 738, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK2", "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" }, { "database": "iPTMnet", "id": "Q92888", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92888" }, { "database": "PubMed", "id": "20098430", "url": "https://pubmed.ncbi.nlm.nih.gov/20098430" } ], "site_lbl": "Tyr738", "uniprot_canonical_ac": "Q92888-1" }, { "start_pos": 737, "end_pos": 737, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK2", "evidence": [ { "database": "UniProtKB", "id": "Q61210", "url": "https://www.uniprot.org/uniprotkb/Q61210" }, { "database": "iPTMnet", "id": "Q61210", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q61210" }, { "database": "PubMed", "id": "20098430", "url": "https://pubmed.ncbi.nlm.nih.gov/20098430" } ], "site_lbl": "Tyr737", "uniprot_canonical_ac": "Q61210-1" } ], "record_id": "pubmed.20098430", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of PDZ-mediated chemokine receptor CXCR2 scaffolding by guanine nucleotide exchange factor PDZ-RhoGEF.", "journal": "Biochemical and biophysical research communications", "date": "2017", "authors": "Spellmon N, Holcomb J, Niu A, Choudhary V, Sun X, Zhang Y, Wan J, Doughan M, Hayden S, Hachem F, Brunzelle J, Li C, Yang Z", "reference": { "type": "PubMed", "id": "28179147", "url": "https://pubmed.ncbi.nlm.nih.gov/28179147" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28179147", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p115 RhoGEF activates the Rac1 GTPase signaling cascade in MCP1 chemokine-induced vascular smooth muscle cell migration and proliferation.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Singh NK, Janjanam J, Rao GN", "reference": { "type": "PubMed", "id": "28655771", "url": "https://pubmed.ncbi.nlm.nih.gov/28655771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28655771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transforming growth factor-beta enhances Rho-kinase activity and contraction in airway smooth muscle via the nucleotide exchange factor ARHGEF1.", "journal": "The Journal of physiology", "date": "2018", "authors": "Shaifta Y, MacKay CE, Irechukwu N, O'Brien KA, Wright DB, Ward JPT, Knock GA", "reference": { "type": "PubMed", "id": "29071730", "url": "https://pubmed.ncbi.nlm.nih.gov/29071730" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23528-1", "protein_name": "Cofilin-1", "gene_name": "CFL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NRK", "evidence": [ { "database": "UniProtKB", "id": "P23528", "url": "https://www.uniprot.org/uniprotkb/P23528" }, { "database": "PRO", "id": "P23528", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P23528" }, { "database": "iPTMnet", "id": "P23528", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23528" }, { "database": "PubMed", "id": "19562668", "url": "https://pubmed.ncbi.nlm.nih.gov/19562668" }, { "database": "PubMed", "id": "10613909", "url": "https://pubmed.ncbi.nlm.nih.gov/10613909" }, { "database": "PubMed", "id": "10644754", "url": "https://pubmed.ncbi.nlm.nih.gov/10644754" }, { "database": "PubMed", "id": "11093160", "url": "https://pubmed.ncbi.nlm.nih.gov/11093160" }, { "database": "PubMed", "id": "11294912", "url": "https://pubmed.ncbi.nlm.nih.gov/11294912" }, { "database": "PubMed", "id": "11418599", "url": "https://pubmed.ncbi.nlm.nih.gov/11418599" }, { "database": "PubMed", "id": "11784854", "url": "https://pubmed.ncbi.nlm.nih.gov/11784854" }, { "database": "PubMed", "id": "12451591", "url": "https://pubmed.ncbi.nlm.nih.gov/12451591" }, { "database": "PubMed", "id": "12655149", "url": "https://pubmed.ncbi.nlm.nih.gov/12655149" }, { "database": "PubMed", "id": "12837278", "url": "https://pubmed.ncbi.nlm.nih.gov/12837278" }, { "database": "PubMed", "id": "14636893", "url": "https://pubmed.ncbi.nlm.nih.gov/14636893" }, { "database": "PubMed", "id": "14645219", "url": "https://pubmed.ncbi.nlm.nih.gov/14645219" }, { "database": "PubMed", "id": "15159416", "url": "https://pubmed.ncbi.nlm.nih.gov/15159416" }, { "database": "PubMed", "id": "15660133", "url": "https://pubmed.ncbi.nlm.nih.gov/15660133" }, { "database": "PubMed", "id": "15671020", "url": "https://pubmed.ncbi.nlm.nih.gov/15671020" }, { "database": "PubMed", "id": "15866889", "url": "https://pubmed.ncbi.nlm.nih.gov/15866889" }, { "database": "PubMed", "id": "15901596", "url": "https://pubmed.ncbi.nlm.nih.gov/15901596" }, { "database": "PubMed", "id": "16230460", "url": "https://pubmed.ncbi.nlm.nih.gov/16230460" }, { "database": "PubMed", "id": "16803871", "url": "https://pubmed.ncbi.nlm.nih.gov/16803871" }, { "database": "PubMed", "id": "17130184", "url": "https://pubmed.ncbi.nlm.nih.gov/17130184" }, { "database": "PubMed", "id": "17470633", "url": "https://pubmed.ncbi.nlm.nih.gov/17470633" }, { "database": "PubMed", "id": "17954607", "url": "https://pubmed.ncbi.nlm.nih.gov/17954607" }, { "database": "PubMed", "id": "18096821", "url": "https://pubmed.ncbi.nlm.nih.gov/18096821" }, { "database": "PubMed", "id": "18309290", "url": "https://pubmed.ncbi.nlm.nih.gov/18309290" }, { "database": "PubMed", "id": "18459146", "url": "https://pubmed.ncbi.nlm.nih.gov/18459146" }, { "database": "PubMed", "id": "18771940", "url": "https://pubmed.ncbi.nlm.nih.gov/18771940" }, { "database": "PubMed", "id": "19029335", "url": "https://pubmed.ncbi.nlm.nih.gov/19029335" }, { "database": "PubMed", "id": "19329994", "url": "https://pubmed.ncbi.nlm.nih.gov/19329994" }, { "database": "PubMed", "id": "19339277", "url": "https://pubmed.ncbi.nlm.nih.gov/19339277" }, { "database": "PubMed", "id": "20558337", "url": "https://pubmed.ncbi.nlm.nih.gov/20558337" }, { "database": "PubMed", "id": "20610540", "url": "https://pubmed.ncbi.nlm.nih.gov/20610540" }, { "database": "PubMed", "id": "20825680", "url": "https://pubmed.ncbi.nlm.nih.gov/20825680" }, { "database": "PubMed", "id": "20935470", "url": "https://pubmed.ncbi.nlm.nih.gov/20935470" }, { "database": "PubMed", "id": "21221513", "url": "https://pubmed.ncbi.nlm.nih.gov/21221513" }, { "database": "PubMed", "id": "22019611", "url": "https://pubmed.ncbi.nlm.nih.gov/22019611" }, { "database": "PubMed", "id": "22216116", "url": "https://pubmed.ncbi.nlm.nih.gov/22216116" }, { "database": "PubMed", "id": "22550395", "url": "https://pubmed.ncbi.nlm.nih.gov/22550395" }, { "database": "PubMed", "id": "22593798", "url": "https://pubmed.ncbi.nlm.nih.gov/22593798" }, { "database": "PubMed", "id": "22869619", "url": "https://pubmed.ncbi.nlm.nih.gov/22869619" }, { "database": "PubMed", "id": "22970259", "url": "https://pubmed.ncbi.nlm.nih.gov/22970259" }, { "database": "PubMed", "id": "23060131", "url": "https://pubmed.ncbi.nlm.nih.gov/23060131" }, { "database": "PubMed", "id": "23112838", "url": "https://pubmed.ncbi.nlm.nih.gov/23112838" }, { "database": "PubMed", "id": "23170111", "url": "https://pubmed.ncbi.nlm.nih.gov/23170111" }, { "database": "PubMed", "id": "23897816", "url": "https://pubmed.ncbi.nlm.nih.gov/23897816" }, { "database": "PubMed", "id": "23934191", "url": "https://pubmed.ncbi.nlm.nih.gov/23934191" }, { "database": "PubMed", "id": "23951242", "url": "https://pubmed.ncbi.nlm.nih.gov/23951242" }, { "database": "PubMed", "id": "24284899", "url": "https://pubmed.ncbi.nlm.nih.gov/24284899" }, { "database": "PubMed", "id": "24425731", "url": "https://pubmed.ncbi.nlm.nih.gov/24425731" }, { "database": "PubMed", "id": "24478456", "url": "https://pubmed.ncbi.nlm.nih.gov/24478456" }, { "database": "PubMed", "id": "24486488", "url": "https://pubmed.ncbi.nlm.nih.gov/24486488" }, { "database": "PubMed", "id": "24664099", "url": "https://pubmed.ncbi.nlm.nih.gov/24664099" }, { "database": "PubMed", "id": "24795566", "url": "https://pubmed.ncbi.nlm.nih.gov/24795566" }, { "database": "PubMed", "id": "24840177", "url": "https://pubmed.ncbi.nlm.nih.gov/24840177" }, { "database": "PubMed", "id": "25179631", "url": "https://pubmed.ncbi.nlm.nih.gov/25179631" }, { "database": "PubMed", "id": "25486435", "url": "https://pubmed.ncbi.nlm.nih.gov/25486435" }, { "database": "PubMed", "id": "25527205", "url": "https://pubmed.ncbi.nlm.nih.gov/25527205" }, { "database": "PubMed", "id": "25549357", "url": "https://pubmed.ncbi.nlm.nih.gov/25549357" }, { "database": "PubMed", "id": "25684665", "url": "https://pubmed.ncbi.nlm.nih.gov/25684665" }, { "database": "PubMed", "id": "25714964", "url": "https://pubmed.ncbi.nlm.nih.gov/25714964" }, { "database": "PubMed", "id": "25781955", "url": "https://pubmed.ncbi.nlm.nih.gov/25781955" }, { "database": "PubMed", "id": "25864508", "url": "https://pubmed.ncbi.nlm.nih.gov/25864508" }, { "database": "PubMed", "id": "26056138", "url": "https://pubmed.ncbi.nlm.nih.gov/26056138" }, { "database": "PubMed", "id": "26169356", "url": "https://pubmed.ncbi.nlm.nih.gov/26169356" }, { "database": "PubMed", "id": "26269174", "url": "https://pubmed.ncbi.nlm.nih.gov/26269174" }, { "database": "PubMed", "id": "26880202", "url": "https://pubmed.ncbi.nlm.nih.gov/26880202" }, { "database": "PubMed", "id": "26967395", "url": "https://pubmed.ncbi.nlm.nih.gov/26967395" }, { "database": "PubMed", "id": "27573465", "url": "https://pubmed.ncbi.nlm.nih.gov/27573465" }, { "database": "PubMed", "id": "27595610", "url": "https://pubmed.ncbi.nlm.nih.gov/27595610" }, { "database": "PubMed", "id": "28381571", "url": "https://pubmed.ncbi.nlm.nih.gov/28381571" }, { "database": "PubMed", "id": "28489960", "url": "https://pubmed.ncbi.nlm.nih.gov/28489960" }, { "database": "PubMed", "id": "28679472", "url": "https://pubmed.ncbi.nlm.nih.gov/28679472" }, { "database": "PubMed", "id": "28704726", "url": "https://pubmed.ncbi.nlm.nih.gov/28704726" }, { "database": "PubMed", "id": "28939776", "url": "https://pubmed.ncbi.nlm.nih.gov/28939776" }, { "database": "PubMed", "id": "29029503", "url": "https://pubmed.ncbi.nlm.nih.gov/29029503" }, { "database": "PubMed", "id": "29071730", "url": "https://pubmed.ncbi.nlm.nih.gov/29071730" }, { "database": "PubMed", "id": "29111771", "url": "https://pubmed.ncbi.nlm.nih.gov/29111771" }, { "database": "PubMed", "id": "29184140", "url": "https://pubmed.ncbi.nlm.nih.gov/29184140" }, { "database": "PubMed", "id": "29380537", "url": "https://pubmed.ncbi.nlm.nih.gov/29380537" }, { "database": "PubMed", "id": "29396473", "url": "https://pubmed.ncbi.nlm.nih.gov/29396473" }, { "database": "PubMed", "id": "29724193", "url": "https://pubmed.ncbi.nlm.nih.gov/29724193" }, { "database": "PubMed", "id": "29844397", "url": "https://pubmed.ncbi.nlm.nih.gov/29844397" }, { "database": "PubMed", "id": "30131725", "url": "https://pubmed.ncbi.nlm.nih.gov/30131725" }, { "database": "PubMed", "id": "30512203", "url": "https://pubmed.ncbi.nlm.nih.gov/30512203" }, { "database": "PubMed", "id": "30662943", "url": "https://pubmed.ncbi.nlm.nih.gov/30662943" }, { "database": "PubMed", "id": "30711747", "url": "https://pubmed.ncbi.nlm.nih.gov/30711747" }, { "database": "PubMed", "id": "30792702", "url": "https://pubmed.ncbi.nlm.nih.gov/30792702" }, { "database": "PubMed", "id": "30824802", "url": "https://pubmed.ncbi.nlm.nih.gov/30824802" }, { "database": "PubMed", "id": "31213900", "url": "https://pubmed.ncbi.nlm.nih.gov/31213900" }, { "database": "PubMed", "id": "31442208", "url": "https://pubmed.ncbi.nlm.nih.gov/31442208" }, { "database": "PubMed", "id": "31988091", "url": "https://pubmed.ncbi.nlm.nih.gov/31988091" }, { "database": "PubMed", "id": "32075676", "url": "https://pubmed.ncbi.nlm.nih.gov/32075676" }, { "database": "PubMed", "id": "32331276", "url": "https://pubmed.ncbi.nlm.nih.gov/32331276" }, { "database": "PubMed", "id": "32792588", "url": "https://pubmed.ncbi.nlm.nih.gov/32792588" }, { "database": "PubMed", "id": "32903827", "url": "https://pubmed.ncbi.nlm.nih.gov/32903827" }, { "database": "PubMed", "id": "32983407", "url": "https://pubmed.ncbi.nlm.nih.gov/32983407" }, { "database": "PubMed", "id": "33056987", "url": "https://pubmed.ncbi.nlm.nih.gov/33056987" }, { "database": "PubMed", "id": "33344441", "url": "https://pubmed.ncbi.nlm.nih.gov/33344441" }, { "database": "PubMed", "id": "33649781", "url": "https://pubmed.ncbi.nlm.nih.gov/33649781" }, { "database": "PubMed", "id": "33928084", "url": "https://pubmed.ncbi.nlm.nih.gov/33928084" }, { "database": "PubMed", "id": "9655398", "url": "https://pubmed.ncbi.nlm.nih.gov/9655398" }, { "database": "PubMed", "id": "9864364", "url": "https://pubmed.ncbi.nlm.nih.gov/9864364" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "30550596", "url": "https://pubmed.ncbi.nlm.nih.gov/30550596" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P23528-1" } ], "record_id": "pubmed.29071730", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of ARHGEF1 causes a human primary antibody deficiency.", "journal": "The Journal of clinical investigation", "date": "2019", "authors": "Bouafia A, Lofek S, Bruneau J, Chentout L, Lamrini H, Trinquand A, Deau MC, Heurtier L, Meignin V, Picard C, Macintyre E, Alibeu O, Bras M, Molina TJ, Cavazzana M, Andre-Schmutz I, Durandy A, Fischer A, Oksenhendler E, Kracker S", "reference": { "type": "PubMed", "id": "30521495", "url": "https://pubmed.ncbi.nlm.nih.gov/30521495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30521495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Rho GEF and RhoA Activation by Pull-Down Assays.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2021", "authors": "Sajib MS, Zahra FT, Akwii RG, Mikelis CM", "reference": { "type": "PubMed", "id": "32808262", "url": "https://pubmed.ncbi.nlm.nih.gov/32808262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32808262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Histamine-induced biphasic activation of RhoA allows for persistent RhoA signaling.", "journal": "PLoS biology", "date": "2020-09", "authors": "Zhang Jason Z, Nguyen Andy H, Miyamoto Shigeki, Heller Brown Joan, McCulloch Andrew D, Zhang Jin", "reference": { "type": "PubMed", "id": "32881857", "url": "https://pubmed.ncbi.nlm.nih.gov/32881857" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 240, "end_pos": 240, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92888", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92888" }, { "database": "PubMed", "id": "32881857", "url": "https://pubmed.ncbi.nlm.nih.gov/32881857" } ], "site_lbl": "Ser240", "uniprot_canonical_ac": "Q92888-1" } ], "record_id": "pubmed.32881857", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Integrative multiomics and in silico analysis revealed the role of ARHGEF1 and its screened antagonist in mild and severe COVID-19 patients.", "journal": "Journal of cellular biochemistry", "date": "2022", "authors": "Jha P, Singh P, Arora S, Sultan A, Nayek A, Ponnusamy K, Syed MA, Dohare R, Chopra M", "reference": { "type": "PubMed", "id": "35037717", "url": "https://pubmed.ncbi.nlm.nih.gov/35037717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35037717", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization, expression and chromosomal localization of a human gene homologous to the mouse Lsc oncogene, with strongest expression in hematopoetic tissues.", "journal": "Oncogene", "date": "1997", "authors": "Aasheim HC, Pedeutour F, Smeland EB", "reference": { "type": "PubMed", "id": "9135076", "url": "https://pubmed.ncbi.nlm.nih.gov/9135076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9135076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p115 RhoGEF, a GTPase activating protein for Galpha12 and Galpha13.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Kozasa T, Jiang X, Hart MJ, Sternweis PM, Singer WD, Gilman AG, Bollag G, Sternweis PC", "reference": { "type": "PubMed", "id": "9641915", "url": "https://pubmed.ncbi.nlm.nih.gov/9641915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9641915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct stimulation of the guanine nucleotide exchange activity of p115 RhoGEF by Galpha13.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Hart MJ, Jiang X, Kozasa T, Roscoe W, Singer WD, Gilman AG, Sternweis PC, Bollag G", "reference": { "type": "PubMed", "id": "9641916", "url": "https://pubmed.ncbi.nlm.nih.gov/9641916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92888-1", "protein_name": "Rho guanine nucleotide exchange factor 1", "gene_name": "ARHGEF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92888", "url": "https://www.uniprot.org/uniprotkb/Q92888" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9641916", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning and mapping of a novel subtype of glutamine:fructose-6-phosphate amidotransferase (GFAT2) in human and mouse.", "journal": "Genomics", "date": "1999", "authors": "Oki T, Yamazaki K, Kuromitsu J, Okada M, Tanaka I", "reference": { "type": "PubMed", "id": "10198162", "url": "https://pubmed.ncbi.nlm.nih.gov/10198162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z2Z9-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "Gfpt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10198162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of murine and human N-acetylglucosamine kinase.", "journal": "Eur. J. Biochem.", "date": "2000", "authors": "Hinderlich S, Berger M, Schwarzkopf M, Effertz K, Reutter W", "reference": { "type": "PubMed", "id": "10824116", "url": "https://pubmed.ncbi.nlm.nih.gov/10824116" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QZ08-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "Nagk", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10824116", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.", "journal": "The EMBO journal", "date": "2001", "authors": "Peneff C, Ferrari P, Charrier V, Taburet Y, Monnier C, Zamboni V, Winter J, Harnois M, Fassy F, Bourne Y", "reference": { "type": "PubMed", "id": "11707391", "url": "https://pubmed.ncbi.nlm.nih.gov/11707391" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11707391", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of nucleotides on N-acetyl-d-glucosamine 2-epimerases (renin-binding proteins): comparative biochemical studies.", "journal": "Journal of biochemistry", "date": "2001", "authors": "Takahashi S, Hori K, Takahashi K, Ogasawara H, Tomatsu M, Saito K", "reference": { "type": "PubMed", "id": "11726282", "url": "https://pubmed.ncbi.nlm.nih.gov/11726282" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11726282", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the phosphotyrosine proteome from thrombin activated platelets.", "journal": "Proteomics", "date": "2002", "authors": "Maguire PB, Wynne KJ, Harney DF, O'Donoghue NM, Stephens G, Fitzgerald DJ", "reference": { "type": "PubMed", "id": "12112843", "url": "https://pubmed.ncbi.nlm.nih.gov/12112843" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15547-1", "protein_name": "P2X purinoceptor 6", "gene_name": "P2RX6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55263-1", "protein_name": "Adenosine kinase", "gene_name": "ADK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36896-1", "protein_name": "Activin receptor type-1B", "gene_name": "ACVR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28370-2", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 1", "gene_name": "SMARCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 205, "end_pos": 205, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" }, { "database": "PubMed", "id": "12112843", "url": "https://pubmed.ncbi.nlm.nih.gov/12112843" }, { "database": "iPTMnet", "id": "Q9UJ70", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UJ70" } ], "site_lbl": "Tyr205", "uniprot_canonical_ac": "Q9UJ70-1" }, { "start_pos": 64, "end_pos": 64, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O15547", "url": "https://www.uniprot.org/uniprotkb/O15547" }, { "database": "PubMed", "id": "12112843", "url": "https://pubmed.ncbi.nlm.nih.gov/12112843" }, { "database": "iPTMnet", "id": "O15547", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15547" } ], "site_lbl": "Tyr64", "uniprot_canonical_ac": "O15547-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P55263", "url": "https://www.uniprot.org/uniprotkb/P55263" }, { "database": "PubMed", "id": "12112843", "url": "https://pubmed.ncbi.nlm.nih.gov/12112843" }, { "database": "iPTMnet", "id": "P55263", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55263" } ], "site_lbl": "Tyr77", "uniprot_canonical_ac": "P55263-1" }, { "start_pos": 380, "end_pos": 380, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P36896", "url": "https://www.uniprot.org/uniprotkb/P36896" }, { "database": "PubMed", "id": "12112843", "url": "https://pubmed.ncbi.nlm.nih.gov/12112843" }, { "database": "iPTMnet", "id": "P36896", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36896" }, { "database": "PRO", "id": "P36896", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P36896" } ], "site_lbl": "Tyr380", "uniprot_canonical_ac": "P36896-1" }, { "start_pos": 942, "end_pos": 942, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P28370", "url": "https://www.uniprot.org/uniprotkb/P28370" }, { "database": "PubMed", "id": "12112843", "url": "https://pubmed.ncbi.nlm.nih.gov/12112843" }, { "database": "iPTMnet", "id": "P28370", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P28370" } ], "site_lbl": "Tyr942", "uniprot_canonical_ac": "P28370-2" } ], "record_id": "pubmed.12112843", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of human phosphoglucomutase 3 (PGM3) as N-acetylglucosamine-phosphate mutase (AGM1).", "journal": "Annals of human genetics", "date": "2002", "authors": "Pang H, Koda Y, Soejima M, Kimura H", "reference": { "type": "PubMed", "id": "12174217", "url": "https://pubmed.ncbi.nlm.nih.gov/12174217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12174217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, cDNA sequence, and bacterial expression of human glutamine:fructose-6-phosphate amidotransferase.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "McKnight GL, Mudri SL, Mathewes SL, Traxinger RR, Marshall S, Sheppard PO, O'Hara PJ", "reference": { "type": "PubMed", "id": "1460020", "url": "https://pubmed.ncbi.nlm.nih.gov/1460020" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1460020", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structures of human N-acetylglucosamine kinase in two complexes with N-acetylglucosamine and with ADP/glucose: insights into substrate specificity and regulation.", "journal": "J. Mol. Biol.", "date": "2006", "authors": "Weihofen WA, Berger M, Chen H, Saenger W, Hinderlich S", "reference": { "type": "PubMed", "id": "17010375", "url": "https://pubmed.ncbi.nlm.nih.gov/17010375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17010375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1.", "journal": "FEBS letters", "date": "2008", "authors": "Wang J, Liu X, Liang YH, Li LF, Su XD", "reference": { "type": "PubMed", "id": "18675810", "url": "https://pubmed.ncbi.nlm.nih.gov/18675810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 156, "end_pos": 156, "sequence_org": "E", "sequence_mut": "A", "comment": "Reduces affinity for glucosamine-6-phosphate 6-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q96EK6", "url": "https://www.uniprot.org/uniprotkb/Q96EK6" }, { "database": "PubMed", "id": "18675810", "url": "https://pubmed.ncbi.nlm.nih.gov/18675810" } ], "uniprot_canonical_ac": "Q96EK6-1" }, { "start_pos": 156, "end_pos": 156, "sequence_org": "E", "sequence_mut": "D", "comment": "Slightly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96EK6", "url": "https://www.uniprot.org/uniprotkb/Q96EK6" }, { "database": "PubMed", "id": "18675810", "url": "https://pubmed.ncbi.nlm.nih.gov/18675810" } ], "uniprot_canonical_ac": "Q96EK6-1" } ], "record_id": "pubmed.18675810", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biomedical differences between human and nonhuman hominids: potential roles for uniquely human aspects of sialic acid biology.", "journal": "Annual review of pathology", "date": "2011", "authors": "Varki NM, Strobert E, Dick EJ Jr, Benirschke K, Varki A", "reference": { "type": "PubMed", "id": "21073341", "url": "https://pubmed.ncbi.nlm.nih.gov/21073341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21073341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hexosamine biosynthetic pathway mutations cause neuromuscular transmission defect.", "journal": "American journal of human genetics", "date": "2011", "authors": "Senderek J, Muller JS, Dusl M, Strom TM, Guergueltcheva V, Diepolder I, Laval SH, Maxwell S, Cossins J, Krause S, Muelas N, Vilchez JJ, Colomer J, Mallebrera CJ, Nascimento A, Nafissi S, Kariminejad A, Nilipour Y, Bozorgmehr B, Najmabadi H, Rodolico C, Sieb JP, Steinlein OK, Schlotter B, Schoser B, Kirschner J, Herrmann R, Voit T, Oldfors A, Lindbergh C, Urtizberea A, von der Hagen M, Hubner A, Palace J, Bushby K, Straub V, Beeson D, Abicht A, Lochmuller H", "reference": { "type": "PubMed", "id": "21310273", "url": "https://pubmed.ncbi.nlm.nih.gov/21310273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "Q06210", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q06210" }, { "id": "rs201322234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201322234" }, { "id": "rs201322234", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201322234" }, { "id": "rs201322234", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201322234" }, { "id": "rs201322234", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201322234#frequency_tab" }, { "id": "rs201322234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201322234" }, { "id": "21310273", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21310273" }, { "id": "8664562", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8664562" }, { "id": "rs201322234", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201322234" } ], "glycoeffect": [], "start_pos": 111, "end_pos": 111, "subjects_tested": "720", "subjects_positive": "1", "frequency": "0.1", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, carbohydrate synthesis and metabolism/nucleotide synthesis).", "chr_id": "2", "chr_pos": "69363563", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R111", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "GC", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:0110660", "recommended_name": { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenic syndrome 12", "description": "A congenital myasthenic syndrome characterized by autosomal recessive inheritance of onset of proximal muscle weakness in the first decade that generally responds well to acetylcholinesterase inhibitor treatment that has_material_basis_in homozygous or compound heterozygous mutation in the GFPT1 gene on chromosome 2p13." }, "synonyms": [ { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "CMS12", "description": "" }, { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenia 12 with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome 12", "description": "Any congenital myasthenic syndromes with glycosylation defect in which the cause of the disease is a mutation in the GFPT1 gene." }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "CMS12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "GFPT1 congenital myasthenic syndromes with glycosylation defect", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndromes with glycosylation defect caused by mutation in GFPT1", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenia, congenital, 12, with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, 12", "description": "" }, { "id": "MIM:610542", "resource": "MIM", "url": "https://www.omim.org/entry/610542", "name": "Myasthenic syndrome, congenital, 12", "description": "Myasthenic syndrome, congenital, 12" } ], "unlinked_id_list": [], "evidence": [ { "id": "610542", "database": "MIM", "url": "https://www.omim.org/entry/610542" }, { "id": "GFPT1", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/GFPT1/#!details" }, { "id": "2673", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2673#disease" }, { "id": "0110660", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110660" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q06210-1" }, { "evidence": [ { "id": "rs387906638", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906638" }, { "id": "rs387906638", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs387906638" }, { "id": "12467753", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12467753" }, { "id": "21310273", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21310273" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 15, "end_pos": 15, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, carbohydrate synthesis and metabolism/nucleotide synthesis.", "chr_id": "2", "chr_pos": "69374078", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T15", "disease": [ { "disease_id": "DOID:0110660", "recommended_name": { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenic syndrome 12", "description": "A congenital myasthenic syndrome characterized by autosomal recessive inheritance of onset of proximal muscle weakness in the first decade that generally responds well to acetylcholinesterase inhibitor treatment that has_material_basis_in homozygous or compound heterozygous mutation in the GFPT1 gene on chromosome 2p13." }, "synonyms": [ { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "CMS12", "description": "" }, { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenia 12 with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome 12", "description": "Any congenital myasthenic syndromes with glycosylation defect in which the cause of the disease is a mutation in the GFPT1 gene." }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "CMS12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "GFPT1 congenital myasthenic syndromes with glycosylation defect", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndromes with glycosylation defect caused by mutation in GFPT1", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenia, congenital, 12, with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, 12", "description": "" }, { "id": "MIM:610542", "resource": "MIM", "url": "https://www.omim.org/entry/610542", "name": "Myasthenic syndrome, congenital, 12", "description": "Myasthenic syndrome, congenital, 12" } ], "unlinked_id_list": [], "evidence": [ { "id": "610542", "database": "MIM", "url": "https://www.omim.org/entry/610542" }, { "id": "GFPT1", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/GFPT1/#!details" }, { "id": "2673", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2673#disease" }, { "id": "0110660", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110660" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000010000.00000000000000.000000000001000000.00001.10.000.001", "uniprot_canonical_ac": "Q06210-1" }, { "evidence": [ { "id": "rs1574066341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1574066341" }, { "id": "rs1574066341", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1574066341#frequency_tab" }, { "id": "rs1574066341", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1574066341" }, { "id": "21310273", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21310273" } ], "glycoeffect": [], "start_pos": 240, "end_pos": 240, "sequence_org": "W", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, carbohydrate synthesis and metabolism/nucleotide synthesis.", "chr_id": "2", "chr_pos": "69354279", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "W240", "disease": [ { "disease_id": "DOID:0110660", "recommended_name": { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenic syndrome 12", "description": "A congenital myasthenic syndrome characterized by autosomal recessive inheritance of onset of proximal muscle weakness in the first decade that generally responds well to acetylcholinesterase inhibitor treatment that has_material_basis_in homozygous or compound heterozygous mutation in the GFPT1 gene on chromosome 2p13." }, "synonyms": [ { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "CMS12", "description": "" }, { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenia 12 with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome 12", "description": "Any congenital myasthenic syndromes with glycosylation defect in which the cause of the disease is a mutation in the GFPT1 gene." }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "CMS12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "GFPT1 congenital myasthenic syndromes with glycosylation defect", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndromes with glycosylation defect caused by mutation in GFPT1", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenia, congenital, 12, with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, 12", "description": "" }, { "id": "MIM:610542", "resource": "MIM", "url": "https://www.omim.org/entry/610542", "name": "Myasthenic syndrome, congenital, 12", "description": "Myasthenic syndrome, congenital, 12" } ], "unlinked_id_list": [], "evidence": [ { "id": "610542", "database": "MIM", "url": "https://www.omim.org/entry/610542" }, { "id": "GFPT1", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/GFPT1/#!details" }, { "id": "2673", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2673#disease" }, { "id": "0110660", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110660" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000001000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q06210-1" }, { "evidence": [ { "id": "rs1574058076", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1574058076" }, { "id": "rs1574058076", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1574058076" }, { "id": "21310273", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21310273" } ], "glycoeffect": [], "start_pos": 366, "end_pos": 366, "sequence_org": "D", "sequence_mut": "Y", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, carbohydrate synthesis and metabolism/nucleotide synthesis.", "chr_id": "2", "chr_pos": "69345913", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D366", "disease": [ { "disease_id": "DOID:0110660", "recommended_name": { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenic syndrome 12", "description": "A congenital myasthenic syndrome characterized by autosomal recessive inheritance of onset of proximal muscle weakness in the first decade that generally responds well to acetylcholinesterase inhibitor treatment that has_material_basis_in homozygous or compound heterozygous mutation in the GFPT1 gene on chromosome 2p13." }, "synonyms": [ { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "CMS12", "description": "" }, { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenia 12 with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome 12", "description": "Any congenital myasthenic syndromes with glycosylation defect in which the cause of the disease is a mutation in the GFPT1 gene." }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "CMS12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "GFPT1 congenital myasthenic syndromes with glycosylation defect", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndromes with glycosylation defect caused by mutation in GFPT1", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenia, congenital, 12, with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, 12", "description": "" }, { "id": "MIM:610542", "resource": "MIM", "url": "https://www.omim.org/entry/610542", "name": "Myasthenic syndrome, congenital, 12", "description": "Myasthenic syndrome, congenital, 12" } ], "unlinked_id_list": [], "evidence": [ { "id": "610542", "database": "MIM", "url": "https://www.omim.org/entry/610542" }, { "id": "GFPT1", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/GFPT1/#!details" }, { "id": "2673", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2673#disease" }, { "id": "0110660", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110660" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000100000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q06210-1" }, { "evidence": [ { "id": "rs1671535986", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1671535986" }, { "id": "21310273", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21310273" } ], "glycoeffect": [], "start_pos": 76, "end_pos": 76, "sequence_org": "Q", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, carbohydrate synthesis and metabolism/nucleotide synthesis.", "chr_id": "2", "chr_pos": "69363670", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Q76", "disease": [ { "disease_id": "DOID:0110660", "recommended_name": { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenic syndrome 12", "description": "A congenital myasthenic syndrome characterized by autosomal recessive inheritance of onset of proximal muscle weakness in the first decade that generally responds well to acetylcholinesterase inhibitor treatment that has_material_basis_in homozygous or compound heterozygous mutation in the GFPT1 gene on chromosome 2p13." }, "synonyms": [ { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "CMS12", "description": "" }, { "id": "DOID:0110660", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110660", "name": "congenital myasthenia 12 with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome 12", "description": "Any congenital myasthenic syndromes with glycosylation defect in which the cause of the disease is a mutation in the GFPT1 gene." }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "CMS12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "GFPT1 congenital myasthenic syndromes with glycosylation defect", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndrome type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "congenital myasthenic syndromes with glycosylation defect caused by mutation in GFPT1", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenia, congenital, 12, with tubular aggregates", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, type 12", "description": "" }, { "id": "MONDO:0012518", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012518", "name": "myasthenic syndrome, congenital, 12", "description": "" }, { "id": "MIM:610542", "resource": "MIM", "url": "https://www.omim.org/entry/610542", "name": "Myasthenic syndrome, congenital, 12", "description": "Myasthenic syndrome, congenital, 12" } ], "unlinked_id_list": [], "evidence": [ { "id": "610542", "database": "MIM", "url": "https://www.omim.org/entry/610542" }, { "id": "GFPT1", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/GFPT1/#!details" }, { "id": "2673", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/2673#disease" }, { "id": "0110660", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110660" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000100000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q06210-1" } ], "record_id": "pubmed.21310273", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of muramyl peptides by NAGK is required for NOD2 activation.", "journal": "Nature", "date": "2022", "authors": "Stafford CA, Gassauer AM, de Oliveira Mann CC, Tanzer MC, Fessler E, Wefers B, Nagl D, Kuut G, Sulek K, Vasilopoulou C, Schwojer SJ, Wiest A, Pfautsch MK, Wurst W, Yabal M, Frohlich T, Mann M, Gisch N, Jae LT, Hornung V", "reference": { "type": "PubMed", "id": "36002575", "url": "https://pubmed.ncbi.nlm.nih.gov/36002575" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QZ08-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "Nagk", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K3Z0-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "Nod2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "D", "sequence_mut": "V", "comment": "Abolished ability to phosphorylate muramyl dipeptide.", "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" }, { "database": "PubMed", "id": "36002575", "url": "https://pubmed.ncbi.nlm.nih.gov/36002575" } ], "uniprot_canonical_ac": "Q9UJ70-1" } ], "record_id": "pubmed.36002575", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human renin-binding protein is the enzyme N-acetyl-D-glucosamine 2-epimerase.", "journal": "Journal of biochemistry", "date": "1999", "authors": "Takahashi S, Takahashi K, Kaneko T, Ogasawara H, Shindo S, Kobayashi M", "reference": { "type": "PubMed", "id": "9990133", "url": "https://pubmed.ncbi.nlm.nih.gov/9990133" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UJ70-1", "protein_name": "N-acetyl-D-glucosamine kinase", "gene_name": "NAGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51606-1", "protein_name": "N-acylglucosamine 2-epimerase", "gene_name": "RENBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16222-1", "protein_name": "UDP-N-acetylhexosamine pyrophosphorylase", "gene_name": "UAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95394-1", "protein_name": "Phosphoacetylglucosamine mutase", "gene_name": "PGM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94808-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2", "gene_name": "GFPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06210-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "GFPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y303-1", "protein_name": "N-acetylglucosamine-6-phosphate deacetylase", "gene_name": "AMDHD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UJ70", "url": "https://www.uniprot.org/uniprotkb/Q9UJ70" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9990133", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2000", "authors": "Xue Y, Canman J C, Lee C S, Nie Z, Yang D, Moreno G T, Young M K, Salmon E D, Wang W", "reference": { "type": "PubMed", "id": "11078522", "url": "https://pubmed.ncbi.nlm.nih.gov/11078522" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11078522", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning of the human polybromo-1 gene on chromosome 3p21.", "journal": "DNA Seq.", "date": "2002", "authors": "Horikawa I, Barrett JC", "reference": { "type": "PubMed", "id": "12487023", "url": "https://pubmed.ncbi.nlm.nih.gov/12487023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12487023", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 3p21 candidate tumor suppressor gene BAF180 is normally expressed in human lung cancer.", "journal": "Oncogene", "date": "2005", "authors": "Sekine Ikuo, Sato Mitsuo, Sunaga Noriaki, Toyooka Shinichi, Peyton Michael, Parsons Ramon, Wang Weidong, Gazdar Adi F, Minna John D", "reference": { "type": "PubMed", "id": "15735765", "url": "https://pubmed.ncbi.nlm.nih.gov/15735765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15735765", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into selective histone H3 recognition by the human polybromo bromodomain 2.", "journal": "Cell Res.", "date": "2010", "authors": "Charlop-Powers Zachary, Zeng Lei, Zhang Qiang, Zhou Ming-Ming", "reference": { "type": "PubMed", "id": "20368734", "url": "https://pubmed.ncbi.nlm.nih.gov/20368734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20368734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PBRM1 bromodomains associate with RNA to facilitate chromatin association.", "journal": "Nucleic acids research", "date": "2023-02-20", "authors": "De Silva Saumya M, Dhiman Alisha, Sood Surbhi, Mercedes Kilsia F, Simmons William J, Henen Morkos A, V\u00f6geli Beat, Dykhuizen Emily C, Musselman Catherine A", "reference": { "type": "PubMed", "id": "36808431", "url": "https://pubmed.ncbi.nlm.nih.gov/36808431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36808431", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PBRM1-deficient PBAF complexes target aberrant genomic loci to activate the NF-\u03baB pathway in clear cell renal cell carcinoma.", "journal": "Nature cell biology", "date": "2023-04-24", "authors": "Yao Xiaosai, Hong Jing Han, Nargund Amrita M, Ng Michelle Shu Wen, Heng Hong Lee, Li Zhimei, Guan Peiyong, Sugiura Masahiro, Chu Pek Lim, Wang Loo Chien, Ye Xiaofen, Qu James, Kwek Xiu Yi, Lim Jeffrey Chun Tatt, Ooi Wen Fong, Koh Joanna, Wang Zhenxun, Pan You-Fu, Ong Yan Shan, Tan Kiat-Yi, Goh Jian Yuan, Ng Sheng Rong, Pignata Luca, Huang Dachuan, Lezhava Alexander, Tay Su Ting, Lee Minghui, Yeo Xun Hui, Tam Wai Leong, Rha Sun Young, Li Shang, Guccione Ernesto, Futreal Andrew, Tan Jing, Yeong Joe Poh Sheng, Hong Wanjin, Yauch Robert, Chang Kenneth Tou-En, Sobota Radoslaw M, Tan Patrick, Teh Bin Tean", "reference": { "type": "PubMed", "id": "37095322", "url": "https://pubmed.ncbi.nlm.nih.gov/37095322" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37095322", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Relationship between body composition and PBRM1 mutations in clear cell renal cell carcinoma: a propensity score matching analysis.", "journal": "Revista da Associacao Medica Brasileira (1992)", "date": "2023", "authors": "Demirel Emin, Dilek Okan", "reference": { "type": "PubMed", "id": "37222312", "url": "https://pubmed.ncbi.nlm.nih.gov/37222312" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37222312", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multi-omics integration identifies cell-state-specific repression by PBRM1-PIAS1 cooperation.", "journal": "Cell genomics", "date": "2024-01-10", "authors": "Ho Patric J, Kweon Junghun, Blumensaadt Laura A, Neely Amy E, Kalika Elizabeth, Leon Daniel B, Oh Sanghyon, Stringer Cooper W P, Lloyd Sarah M, Ren Ziyou, Bao Xiaomin", "reference": { "type": "PubMed", "id": "38190100", "url": "https://pubmed.ncbi.nlm.nih.gov/38190100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75925-1", "protein_name": "E3 SUMO-protein ligase PIAS1", "gene_name": "PIAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38190100", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cancer-associated polybromo-1 bromodomain 4 missense variants variably impact bromodomain ligand binding and cell growth suppression.", "journal": "The Journal of biological chemistry", "date": "2024-04", "authors": "Bursch Karina L, Goetz Christopher J, Jiao Guanming, Nu\u00f1ez Raymundo, Olp Michael D, Dhiman Alisha, Khurana Mallika, Zimmermann Michael T, Urrutia Raul A, Dykhuizen Emily C, Smith Brian C", "reference": { "type": "PubMed", "id": "38460939", "url": "https://pubmed.ncbi.nlm.nih.gov/38460939" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86U86", "url": "https://www.uniprot.org/uniprotkb/Q86U86" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38460939", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear factor TDP-43 and SR proteins promote in vitro and in vivo CFTR exon 9 skipping.", "journal": "The EMBO journal", "date": "2001-04-02", "authors": "Buratti E, D\u00f6rk T, Zuccato E, Pagani F, Romano M, Baralle F E", "reference": { "type": "PubMed", "id": "11285240", "url": "https://pubmed.ncbi.nlm.nih.gov/11285240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11285240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization and functional implications of the RNA binding properties of nuclear factor TDP-43, a novel splicing regulator of CFTR exon 9.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Buratti E, Baralle FE", "reference": { "type": "PubMed", "id": "11470789", "url": "https://pubmed.ncbi.nlm.nih.gov/11470789" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 111, "sequence_org": "LIVLGL", "sequence_mut": "DIDLGD", "comment": "Completely abolishes RNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" }, { "database": "PubMed", "id": "11470789", "url": "https://pubmed.ncbi.nlm.nih.gov/11470789" } ], "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 106, "end_pos": 111, "sequence_org": "LIVLGL", "sequence_mut": "", "comment": "Completely abolishes RNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" }, { "database": "PubMed", "id": "11470789", "url": "https://pubmed.ncbi.nlm.nih.gov/11470789" } ], "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 106, "end_pos": 175, "sequence_org": "LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDC", "sequence_mut": "", "comment": "Completely abolishes RNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" }, { "database": "PubMed", "id": "11470789", "url": "https://pubmed.ncbi.nlm.nih.gov/11470789" } ], "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 147, "end_pos": 149, "sequence_org": "FGF", "sequence_mut": "LGL", "comment": "Highly reduces binding to RNA and DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" }, { "database": "PubMed", "id": "11470789", "url": "https://pubmed.ncbi.nlm.nih.gov/11470789" } ], "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 193, "end_pos": 257, "sequence_org": "VFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHI", "sequence_mut": "", "comment": "Alters but does not abolish RNA binding.", "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" }, { "database": "PubMed", "id": "11470789", "url": "https://pubmed.ncbi.nlm.nih.gov/11470789" } ], "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.11470789", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitinated TDP-43 in frontotemporal lobar degeneration and amyotrophic lateral sclerosis.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Neumann M, Sampathu DM, Kwong LK, Truax AC, Micsenyi MC, Chou TT, Bruce J, Schuck T, Grossman M, Clark CM, McCluskey LF, Miller BL, Masliah E, Mackenzie IR, Feldman H, Feiden W, Kretzschmar HA, Trojanowski JQ, Lee VM", "reference": { "type": "PubMed", "id": "17023659", "url": "https://pubmed.ncbi.nlm.nih.gov/17023659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17023659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP43 is a human low molecular weight neurofilament (hNFL) mRNA-binding protein.", "journal": "Molecular and cellular neurosciences", "date": "2007", "authors": "Strong MJ, Volkening K, Hammond R, Yang W, Strong W, Leystra-Lantz C, Shoesmith C", "reference": { "type": "PubMed", "id": "17481916", "url": "https://pubmed.ncbi.nlm.nih.gov/17481916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17481916", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP-43 A315T mutation in familial motor neuron disease.", "journal": "Annals of neurology", "date": "2008", "authors": "Gitcho MA, Baloh RH, Chakraverty S, Mayo K, Norton JB, Levitch D, Hatanpaa KJ, White CL 3rd, Bigio EH, Caselli R, Baker M, Al-Lozi MT, Morris JC, Pestronk A, Rademakers R, Goate AM, Cairns NJ", "reference": { "type": "PubMed", "id": "18288693", "url": "https://pubmed.ncbi.nlm.nih.gov/18288693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18288693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP-43 mutations in familial and sporadic amyotrophic lateral sclerosis.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Sreedharan J, Blair IP, Tripathi VB, Hu X, Vance C, Rogelj B, Ackerley S, Durnall JC, Williams KL, Buratti E, Baralle F, de Belleroche J, Mitchell JD, Leigh PN, Al-Chalabi A, Miller CC, Nicholson G, Shaw CE", "reference": { "type": "PubMed", "id": "18309045", "url": "https://pubmed.ncbi.nlm.nih.gov/18309045" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18309045", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TARDBP mutations in individuals with sporadic and familial amyotrophic lateral sclerosis.", "journal": "Nature genetics", "date": "2008", "authors": "Kabashi E, Valdmanis PN, Dion P, Spiegelman D, McConkey BJ, Vande Velde C, Bouchard JP, Lacomblez L, Pochigaeva K, Salachas F, Pradat PF, Camu W, Meininger V, Dupre N, Rouleau GA", "reference": { "type": "PubMed", "id": "18372902", "url": "https://pubmed.ncbi.nlm.nih.gov/18372902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18372902", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TARDBP mutations in amyotrophic lateral sclerosis with TDP-43 neuropathology: a genetic and histopathological analysis.", "journal": "The Lancet. Neurology", "date": "2008", "authors": "Van Deerlin VM, Leverenz JB, Bekris LM, Bird TD, Yuan W, Elman LB, Clay D, Wood EM, Chen-Plotkin AS, Martinez-Lage M, Steinbart E, McCluskey L, Grossman M, Neumann M, Wu IL, Yang WS, Kalb R, Galasko DR, Montine TJ, Trojanowski JQ, Lee VM, Schellenberg GD, Yu CE", "reference": { "type": "PubMed", "id": "18396105", "url": "https://pubmed.ncbi.nlm.nih.gov/18396105" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18396105", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP-43 mutation in familial amyotrophic lateral sclerosis.", "journal": "Annals of neurology", "date": "2008", "authors": "Yokoseki A, Shiga A, Tan CF, Tagawa A, Kaneko H, Koyama A, Eguchi H, Tsujino A, Ikeuchi T, Kakita A, Okamoto K, Nishizawa M, Takahashi H, Onodera O", "reference": { "type": "PubMed", "id": "18438952", "url": "https://pubmed.ncbi.nlm.nih.gov/18438952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18438952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Abnormal phosphorylation of Ser409/410 of TDP-43 in FTLD-U and ALS.", "journal": "FEBS letters", "date": "2008", "authors": "Inukai Y, Nonaka T, Arai T, Yoshida M, Hashizume Y, Beach TG, Buratti E, Baralle FE, Akiyama H, Hisanaga S, Hasegawa M", "reference": { "type": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser409", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.18656473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural determinants of the cellular localization and shuttling of TDP-43.", "journal": "J. Cell Sci.", "date": "2008", "authors": "Ayala Youhna M, Zago Paola, D'Ambrogio Andrea, Xu Ya-Fei, Petrucelli Leonard, Buratti Emanuele, Baralle Francisco E", "reference": { "type": "PubMed", "id": "18957508", "url": "https://pubmed.ncbi.nlm.nih.gov/18957508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18957508", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High frequency of TARDBP gene mutations in Italian patients with amyotrophic lateral sclerosis.", "journal": "Human mutation", "date": "2009", "authors": "Corrado L, Ratti A, Gellera C, Buratti E, Castellotti B, Carlomagno Y, Ticozzi N, Mazzini L, Testa L, Taroni F, Baralle FE, Silani V, D'Alfonso S", "reference": { "type": "PubMed", "id": "19224587", "url": "https://pubmed.ncbi.nlm.nih.gov/19224587" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19224587", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TAR DNA-Binding protein 43 accumulation in protein aggregate myopathies.", "journal": "Journal of neuropathology and experimental neurology", "date": "2009", "authors": "Olive M, Janue A, Moreno D, Gamez J, Torrejon-Escribano B, Ferrer I", "reference": { "type": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 403, "end_pos": 403, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" } ], "site_lbl": "Ser403", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 404, "end_pos": 404, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" } ], "site_lbl": "Ser404", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser409", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.19225410", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Neurodegenerative disorders and TDP-43].", "journal": "Brain and nerve = Shinkei kenkyu no shinpo", "date": "2009", "authors": "Nonaka T, Inukai Y, Arai T, Hasegawa M", "reference": { "type": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser409", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.19235466", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TARDBP mutations in motoneuron disease with frontotemporal lobar degeneration.", "journal": "Ann. Neurol.", "date": "2009", "authors": "Benajiba Lina, Le Ber Isabelle, Camuzat Agn\u00e8s, Lacoste Mathieu, Thomas-Anterion Catherine, Couratier Philippe, Legallic Solenn, Salachas Fran\u00e7ois, Hannequin Didier, Decousus Marielle, Lacomblez Lucette, Guedj Eric, Golfier V\u00e9ronique, Camu William, Dubois Bruno, Campion Dominique, Meininger Vincent, Brice Alexis,", "reference": { "type": "PubMed", "id": "19350673", "url": "https://pubmed.ncbi.nlm.nih.gov/19350673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19350673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional mapping of the interaction between TDP-43 and hnRNP A2 in vivo.", "journal": "Nucleic Acids Res.", "date": "2009", "authors": "D'Ambrogio Andrea, Buratti Emanuele, Stuani Cristiana, Guarnaccia Corrado, Romano Maurizio, Ayala Youhna M, Baralle Francisco E", "reference": { "type": "PubMed", "id": "19429692", "url": "https://pubmed.ncbi.nlm.nih.gov/19429692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22626-1", "protein_name": "Heterogeneous nuclear ribonucleoproteins A2/B1", "gene_name": "HNRNPA2B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19429692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation within TARDBP leads to frontotemporal dementia without motor neuron disease.", "journal": "Hum. Mutat.", "date": "2009", "authors": "Borroni B, Bonvicini C, Alberici A, Buratti E, Agosti C, Archetti S, Papetti A, Stuani C, Di Luca M, Gennarelli M, Padovani A", "reference": { "type": "PubMed", "id": "19655382", "url": "https://pubmed.ncbi.nlm.nih.gov/19655382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19655382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic variants in the promoter of TARDBP in sporadic amyotrophic lateral sclerosis.", "journal": "Neuromuscular disorders : NMD", "date": "2009", "authors": "Luquin N, Yu B, Saunderson RB, Trent RJ, Pamphlett R", "reference": { "type": "PubMed", "id": "19695877", "url": "https://pubmed.ncbi.nlm.nih.gov/19695877" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19695877", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Broad clinical phenotypes associated with TAR-DNA binding protein (TARDBP) mutations in amyotrophic lateral sclerosis.", "journal": "Neurogenetics", "date": "2010", "authors": "Kirby J, Goodall EF, Smith W, Highley JR, Masanzu R, Hartley JA, Hibberd R, Hollinger HC, Wharton SB, Morrison KE, Ince PG, McDermott CJ, Shaw PJ", "reference": { "type": "PubMed", "id": "19760257", "url": "https://pubmed.ncbi.nlm.nih.gov/19760257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19760257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP-43 is recruited to stress granules in conditions of oxidative insult.", "journal": "Journal of neurochemistry", "date": "2009-11", "authors": "Colombrita Claudia, Zennaro Eleonora, Fallini Claudia, Weber Markus, Sommacal Andreas, Buratti Emanuele, Silani Vincenzo, Ratti Antonia", "reference": { "type": "PubMed", "id": "19765185", "url": "https://pubmed.ncbi.nlm.nih.gov/19765185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19765185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP-43 dimerizes in human cells in culture.", "journal": "Cell. Mol. Neurobiol.", "date": "2010", "authors": "Shiina Yuki, Arima Kunimasa, Tabunoki Hiroko, Satoh Jun-ichi", "reference": { "type": "PubMed", "id": "20043239", "url": "https://pubmed.ncbi.nlm.nih.gov/20043239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20043239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ataxin-2 intermediate-length polyglutamine expansions are associated with increased risk for ALS.", "journal": "Nature", "date": "2010", "authors": "Elden AC, Kim HJ, Hart MP, Chen-Plotkin AS, Johnson BS, Fang X, Armakola M, Geser F, Greene R, Lu MM, Padmanabhan A, Clay-Falcone D, McCluskey L, Elman L, Juhr D, Gruber PJ, Rub U, Auburger G, Trojanowski JQ, Lee VM, Van Deerlin VM, Bonini NM, Gitler AD", "reference": { "type": "PubMed", "id": "20740007", "url": "https://pubmed.ncbi.nlm.nih.gov/20740007" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99700-1", "protein_name": "Ataxin-2", "gene_name": "ATXN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20740007", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation regulates proteasomal-mediated degradation and solubility of TAR DNA binding protein-43 C-terminal fragments.", "journal": "Molecular neurodegeneration", "date": "2010", "authors": "Zhang YJ, Gendron TF, Xu YF, Ko LW, Yen SH, Petrucelli L", "reference": { "type": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser409", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.20804554", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of TDP-43 aggregation by phosphorylation and p62/SQSTM1.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Brady OA, Meng P, Zheng Y, Mao Y, Hu F", "reference": { "type": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser409", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.21062285", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Large proportion of amyotrophic lateral sclerosis cases in Sardinia due to a single founder mutation of the TARDBP gene.", "journal": "Archives of neurology", "date": "2011", "authors": "Chio A, Borghero G, Pugliatti M, Ticca A, Calvo A, Moglia C, Mutani R, Brunetti M, Ossola I, Marrosu MG, Murru MR, Floris G, Cannas A, Parish LD, Cossu P, Abramzon Y, Johnson JO, Nalls MA, Arepalli S, Chong S, Hernandez DG, Traynor BJ, Restagno G", "reference": { "type": "PubMed", "id": "21220647", "url": "https://pubmed.ncbi.nlm.nih.gov/21220647" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00441-1", "protein_name": "Superoxide dismutase [Cu-Zn]", "gene_name": "SOD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21220647", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterizing the RNA targets and position-dependent splicing regulation by TDP-43.", "journal": "Nature neuroscience", "date": "2011-04", "authors": "Tollervey James R, Curk Toma\u017e, Rogelj Boris, Briese Michael, Cereda Matteo, Kayikci Melis, K\u00f6nig Julian, Hortob\u00e1gyi Tibor, Nishimura Agnes L, Zupunski Vera, Patani Rickie, Chandran Siddharthan, Rot Gregor, Zupan Bla\u017e, Shaw Christopher E, Ule Jernej", "reference": { "type": "PubMed", "id": "21358640", "url": "https://pubmed.ncbi.nlm.nih.gov/21358640" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21358640", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High frequency of the TARDBP p.Ala382Thr mutation in Sardinian patients with amyotrophic lateral sclerosis.", "journal": "Clinical genetics", "date": "2012", "authors": "Orru S, Manolakos E, Orru N, Kokotas H, Mascia V, Carcassi C, Petersen MB", "reference": { "type": "PubMed", "id": "21418058", "url": "https://pubmed.ncbi.nlm.nih.gov/21418058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21418058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epitope mapping of antibodies against TDP-43 and detection of protease-resistant fragments of pathological TDP-43 in amyotrophic lateral sclerosis and frontotemporal lobar degeneration.", "journal": "Biochemical and biophysical research communications", "date": "2012-01-06", "authors": "Tsuji Hiroshi, Nonaka Takashi, Yamashita Makiko, Masuda-Suzukake Masami, Kametani Fuyuki, Akiyama Haruhiko, Mann David M A, Tamaoka Akira, Hasegawa Masato", "reference": { "type": "PubMed", "id": "22133678", "url": "https://pubmed.ncbi.nlm.nih.gov/22133678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22133678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel TARDBP mutations in Nordic ALS patients.", "journal": "Journal of human genetics", "date": "2012", "authors": "Chiang HH, Andersen PM, Tysnes OB, Gredal O, Christensen PB, Graff C", "reference": { "type": "PubMed", "id": "22456481", "url": "https://pubmed.ncbi.nlm.nih.gov/22456481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22456481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDP-43 associates with stalled ribosomes and contributes to cell survival during cellular stress.", "journal": "Journal of neurochemistry", "date": "2013", "authors": "Higashi S, Kabuta T, Nagai Y, Tsuchiya Y, Akiyama H, Wada K", "reference": { "type": "PubMed", "id": "23398327", "url": "https://pubmed.ncbi.nlm.nih.gov/23398327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23398327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterizing TDP-43 interaction with its RNA targets.", "journal": "Nucleic acids research", "date": "2013-05", "authors": "Bhardwaj Amit, Myers Michael P, Buratti Emanuele, Baralle Francisco E", "reference": { "type": "PubMed", "id": "23519609", "url": "https://pubmed.ncbi.nlm.nih.gov/23519609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23519609", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquilin-2 (UBQLN2) binds with high affinity to the C-terminal region of TDP-43 and modulates TDP-43 levels in H4 cells: characterization of inhibition by nucleic acids and 4-aminoquinolines.", "journal": "Biochim. Biophys. Acta", "date": "2013", "authors": "Cassel Joel A, Reitz Allen B", "reference": { "type": "PubMed", "id": "23541532", "url": "https://pubmed.ncbi.nlm.nih.gov/23541532" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD9-1", "protein_name": "Ubiquilin-2", "gene_name": "UBQLN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23541532", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of UG-rich RNA recognition by the human splicing factor TDP-43.", "journal": "Nature structural & molecular biology", "date": "2013-12", "authors": "Lukavsky Peter J, Daujotyte Dalia, Tollervey James R, Ule Jernej, Stuani Cristiana, Buratti Emanuele, Baralle Francisco E, Damberger Fred F, Allain Fr\u00e9d\u00e9ric H-T", "reference": { "type": "PubMed", "id": "24240615", "url": "https://pubmed.ncbi.nlm.nih.gov/24240615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24240615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of TDP-43 RRM1-DNA complex reveals the specific recognition for UG- and TG-rich nucleic acids.", "journal": "Nucleic acids research", "date": "2014-04", "authors": "Kuo Pan-Hsien, Chiang Chien-Hao, Wang Yi-Ting, Doudeva Lyudmila G, Yuan Hanna S", "reference": { "type": "PubMed", "id": "24464995", "url": "https://pubmed.ncbi.nlm.nih.gov/24464995" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24464995", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the matrin 3 gene cause familial amyotrophic lateral sclerosis.", "journal": "Nat. Neurosci.", "date": "2014", "authors": "Johnson JO, Pioro EP, Boehringer A, Chia R, Feit H, Renton AE, Pliner HA, Abramzon Y, Marangi G, Winborn BJ, Gibbs JR, Nalls MA, Morgan S, Shoai M, Hardy J, Pittman A, Orrell RW, Malaspina A, Sidle KC, Fratta P, Harms MB, Baloh RH, Pestronk A, Weihl CC, Rogaeva E, Zinman L, Drory VE, Borghero G, Mora G, Calvo A, Rothstein JD, Drepper C, Sendtner M, Singleton AB, Taylor JP, Cookson MR, Restagno G, Sabatelli M, Bowser R, Chio A, Traynor BJ", "reference": { "type": "PubMed", "id": "24686783", "url": "https://pubmed.ncbi.nlm.nih.gov/24686783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20700-1", "protein_name": "Lamin-B1", "gene_name": "LMNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43243-1", "protein_name": "Matrin-3", "gene_name": "MATR3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs121434591", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121434591" }, { "id": "rs121434591", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121434591" }, { "id": "19344878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19344878" }, { "id": "24686783", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24686783" }, { "id": "25154462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25154462" }, { "id": "9837826", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9837826" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 85, "end_pos": 85, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "139307669", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S85", "disease": [ { "disease_id": "DOID:0060212", "recommended_name": { "id": "DOID:0060212", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060212", "name": "amyotrophic lateral sclerosis type 21", "description": "An amyotrophic lateral sclerosis that has_material_basis_in mutation in the MATR3 gene on chromosome 5." }, "synonyms": [ { "id": "DOID:0060212", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060212", "name": "ALS21", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "amyotrophic lateral sclerosis type 21", "description": "Any amyotrophic lateral sclerosis in which the cause of the disease is a mutation in the MATR3 gene." }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "ALS21", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "MATR3 amyotrophic lateral sclerosis", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "amyotrophic lateral sclerosis caused by mutation in MATR3", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "amyotrophic lateral sclerosis type 21", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "amyotrophic lateral sclerosis 21", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "myopathy, distal, 2", "description": "" }, { "id": "MONDO:0011632", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011632", "name": "vocal cord and pharyngeal dysfunction with distal myopathy", "description": "" }, { "id": "MIM:606070", "resource": "MIM", "url": "https://www.omim.org/entry/606070", "name": "Amyotrophic lateral sclerosis 21", "description": "Amyotrophic lateral sclerosis 21" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060212", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060212" }, { "id": "0060212", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060212" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000100000.00000001000000.000000000001000000.01001.11.100.001", "uniprot_canonical_ac": "P43243-1" } ], "record_id": "pubmed.24686783", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA-processing protein TDP-43 regulates FOXO-dependent protein quality control in stress response.", "journal": "PLoS genetics", "date": "2014", "authors": "Zhang T, Baldie G, Periz G, Wang J", "reference": { "type": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser409", "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13148" }, { "database": "PubMed", "id": "18656473", "url": "https://pubmed.ncbi.nlm.nih.gov/18656473" }, { "database": "PubMed", "id": "19225410", "url": "https://pubmed.ncbi.nlm.nih.gov/19225410" }, { "database": "PubMed", "id": "19235466", "url": "https://pubmed.ncbi.nlm.nih.gov/19235466" }, { "database": "PubMed", "id": "20804554", "url": "https://pubmed.ncbi.nlm.nih.gov/20804554" }, { "database": "PubMed", "id": "21062285", "url": "https://pubmed.ncbi.nlm.nih.gov/21062285" }, { "database": "PubMed", "id": "25329970", "url": "https://pubmed.ncbi.nlm.nih.gov/25329970" }, { "database": "PubMed", "id": "26301107", "url": "https://pubmed.ncbi.nlm.nih.gov/26301107" }, { "database": "PubMed", "id": "26980269", "url": "https://pubmed.ncbi.nlm.nih.gov/26980269" }, { "database": "PubMed", "id": "28599005", "url": "https://pubmed.ncbi.nlm.nih.gov/28599005" }, { "database": "PubMed", "id": "29334120", "url": "https://pubmed.ncbi.nlm.nih.gov/29334120" }, { "database": "PubMed", "id": "30120199", "url": "https://pubmed.ncbi.nlm.nih.gov/30120199" }, { "database": "PubMed", "id": "31306131", "url": "https://pubmed.ncbi.nlm.nih.gov/31306131" }, { "database": "PubMed", "id": "31529970", "url": "https://pubmed.ncbi.nlm.nih.gov/31529970" }, { "database": "PubMed", "id": "31834878", "url": "https://pubmed.ncbi.nlm.nih.gov/31834878" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "Q13148-1" } ], "record_id": "pubmed.25329970", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptidylprolyl isomerase A governs TARDBP function and assembly in heterogeneous nuclear ribonucleoprotein complexes.", "journal": "Brain : a journal of neurology", "date": "2015", "authors": "Lauranzano E, Pozzi S, Pasetto L, Stucchi R, Massignan T, Paolella K, Mombrini M, Nardo G, Lunetta C, Corbo M, Mora G, Bendotti C, Bonetto V", "reference": { "type": "PubMed", "id": "25678563", "url": "https://pubmed.ncbi.nlm.nih.gov/25678563" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13148-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "TARDBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09651-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A1", "gene_name": "HNRNPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07910-1", "protein_name": "Heterogeneous nuclear ribonucleoproteins C1/C2", "gene_name": "HNRNPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52272-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein M", "gene_name": "HNRNPM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q921F2-1", "protein_name": "TAR DNA-binding protein 43", "gene_name": "Tardbp", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P22626-1", "protein_name": "Heterogeneous nuclear ribonucleoproteins A2/B1", "gene_name": "HNRNPA2B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17742-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "Ppia", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P38159-1", "protein_name": "RNA-binding motif protein, X chromosome", "gene_name": "RBMX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61978-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "HNRNPK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 183, "sequence_org": "TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQS", "sequence_mut": "", "comment": "Loss of RNA-binding and reduced interaction with PPIA/CYPA.", "evidence": [ { "database": "UniProtKB", "id": "Q13148", "url": "https://www.uniprot.org/uniprotkb/Q13148" }, { "database": "PubMed", "id": "25678563", "url": "https://pubmed.ncbi.nlm.nih.gov/25678563" } ], "uniprot_canonical_ac": "Q13148-1" }, { "start_pos": 125, "end_pos": 125, "sequence_org": "K", "sequence_mut": "Q", "comment": "Acetylation-mimetic mutant; no effect on its interaction with TARDBP.", "evidence": [ { "database": "UniProtKB", "id": "P62937", "url": "https://www.uniprot.org/uniprotkb/P62937" }, { "database": "PubMed", "id": "25678563", "url": "https://pubmed.ncbi.nlm.nih.gov/25678563" } ], "uniprot_canonical_ac": "P62937-1" }, { "start_pos": 125, "end_pos": 125, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of acetylation and interaction with TARDBP.", "evidence": [ { "database": "UniProtKB", "id": "P62937", "url": "https://www.uniprot.org/uniprotkb/P62937" }, { "database": "PubMed", "id": "25678563", "url": "https://pubmed.ncbi.nlm.nih.gov/25678563" } ], "uniprot_canonical_ac": "P62937-1" }, { "start_pos": 55, "end_pos": 55, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of peptidyl-prolyl cis-trans isomerase activity. No loss of its interaction with BSG/CD147 or its ability to induce leukocyte chemotaxis. No effect on its interaction with MAP3K5/ASK1. Loss of its ability to negatively regulate oxidative stress-induced apoptosis mediated by MAP3K5/ASK1. Reduced interaction with TARDBP. No loss of interaction with influenza A virus matrix protein 1 or its ability to inhibit viral replication.", "evidence": [ { "database": "UniProtKB", "id": "P62937", "url": "https://www.uniprot.org/uniprotkb/P62937" }, { "database": "PubMed", "id": "25678563", "url": "https://pubmed.ncbi.nlm.nih.gov/25678563" }, { "database": "PubMed", "id": "19207730", "url": "https://pubmed.ncbi.nlm.nih.gov/19207730" }, { "database": "PubMed", "id": "21245143", "url": "https://pubmed.ncbi.nlm.nih.gov/21245143" }, { "database": "PubMed", "id": "26095851", "url": "https://pubmed.ncbi.nlm.nih.gov/26095851" } ], "uniprot_canonical_ac": "P62937-1" } ], "record_id": "pubmed.25678563", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]