[ { "title": "PAK5-mediated AIF phosphorylation inhibits its nuclear translocation and promotes breast cancer tumorigenesis.", "journal": "International journal of biological sciences", "date": "2021", "authors": "Xing Yao, Li Yang, Hu Bingtao, Han Fuyi, Zhao Xin, Zhang Hongyan, Li Yanshu, Li Danni, Li Jiabin, Jin Feng, Li Feng", "reference": { "type": "PubMed", "id": "33867848", "url": "https://pubmed.ncbi.nlm.nih.gov/33867848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95831-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "AIFM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P286-1", "protein_name": "Serine/threonine-protein kinase PAK 5", "gene_name": "PAK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95831", "url": "https://www.uniprot.org/uniprotkb/O95831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O95831", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95831" }, { "database": "PubMed", "id": "33867848", "url": "https://pubmed.ncbi.nlm.nih.gov/33867848" } ], "site_lbl": "Thr281", "uniprot_canonical_ac": "O95831-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9P286", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9P286" }, { "database": "PubMed", "id": "33867848", "url": "https://pubmed.ncbi.nlm.nih.gov/33867848" } ], "site_lbl": "Thr281", "uniprot_canonical_ac": "Q9P286-1" } ], "record_id": "pubmed.33867848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impaired AIF-CHCHD4 interaction and mitochondrial calcium overload contribute to auditory neuropathy spectrum disorder in patient-iPSC-derived neurons with AIFM1 variant.", "journal": "Cell death & disease", "date": "2023-06-26", "authors": "Qiu Yue, Wang Hongyang, Fan Mingjie, Pan Huaye, Guan Jing, Jiang Yangwei, Jia Zexiao, Wu Kaiwen, Zhou Hui, Zhuang Qianqian, Lei Zhaoying, Ding Xue, Cai Huajian, Dong Yufei, Yan Lei, Lin Aifu, Fu Yong, Zhang Dong, Yan Qingfeng, Wang Qiuju", "reference": { "type": "PubMed", "id": "37365177", "url": "https://pubmed.ncbi.nlm.nih.gov/37365177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95831-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "AIFM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4Q1-1", "protein_name": "Mitochondrial intermembrane space import and assembly protein 40", "gene_name": "CHCHD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95831", "url": "https://www.uniprot.org/uniprotkb/O95831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37365177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NADH improves AIF dimerization and inhibits apoptosis in iPSCs-derived neurons from patients with auditory neuropathy spectrum disorder.", "journal": "Hearing research", "date": "2024-01", "authors": "Qiu Yue, Wang Hongyang, Pan Huaye, Ding Xue, Guan Jing, Zhuang Qianqian, Wu Kaiwen, Lei Zhaoying, Cai Huajian, Dong Yufei, Zhou Hui, Lin Aifu, Wang Qiuju, Yan Qingfeng", "reference": { "type": "PubMed", "id": "38043402", "url": "https://pubmed.ncbi.nlm.nih.gov/38043402" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95831-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "AIFM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95831", "url": "https://www.uniprot.org/uniprotkb/O95831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38043402", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIF translocation into nucleus caused by Aifm1 R450Q mutation: generation and characterization of a mouse model for AUNX1.", "journal": "Human molecular genetics", "date": "2024-05-04", "authors": "Shi Tao, Chen Ziyi, Li Jin, Wang Hongyang, Wang Qiuju", "reference": { "type": "PubMed", "id": "38449065", "url": "https://pubmed.ncbi.nlm.nih.gov/38449065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95831-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "AIFM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z0X1-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "Aifm1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95831", "url": "https://www.uniprot.org/uniprotkb/O95831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38449065", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of mitochondrial apoptosis-inducing factor.", "journal": "Nature", "date": "1999", "authors": "Susin S A, Lorenzo H K, Zamzami N, Marzo I, Snow B E, Brothers G M, Mangion J, Jacotot E, Costantini P, Loeffler M, Larochette N, Goodlett D R, Aebersold R, Siderovski D P, Penninger J M, Kroemer G", "reference": { "type": "PubMed", "id": "9989411", "url": "https://pubmed.ncbi.nlm.nih.gov/9989411" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95831-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "AIFM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z0X1-1", "protein_name": "Apoptosis-inducing factor 1, mitochondrial", "gene_name": "Aifm1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95831", "url": "https://www.uniprot.org/uniprotkb/O95831" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9989411", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cysteine-rich domain of human ADAM 12 supports cell adhesion through syndecans and triggers signaling events that lead to beta1 integrin-dependent cell spreading.", "journal": "J. Cell Biol.", "date": "2000", "authors": "Iba K, Albrechtsen R, Gilpin B, Fr\u00f6hlich C, Loechel F, Zolkiewska A, Ishiguro K, Kojima T, Liu W, Langford J K, Sanderson R D, Brakebusch C, F\u00e4ssler R, Wewer U M", "reference": { "type": "PubMed", "id": "10831617", "url": "https://pubmed.ncbi.nlm.nih.gov/10831617" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10831617", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RACK1, a new ADAM12 interacting protein. Contribution to liver fibrogenesis.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Bourd-Boittin Katia, Le Pabic H\u00e9l\u00e8ne, Bonnier Dominique, L'Helgoualc'h Annie, Th\u00e9ret Nathalie", "reference": { "type": "PubMed", "id": "18621736", "url": "https://pubmed.ncbi.nlm.nih.gov/18621736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18621736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the disintegrin-metalloproteinases family reveals ADAM29 and ADAM7 are often mutated in melanoma.", "journal": "Human mutation", "date": "2011", "authors": "Wei X, Moncada-Pazos A, Cal S, Soria-Valles C, Gartner J, Rudloff U, Lin JC, Rosenberg SA, Lopez-Otin C, Samuels Y", "reference": { "type": "PubMed", "id": "21618342", "url": "https://pubmed.ncbi.nlm.nih.gov/21618342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2U9-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 7", "gene_name": "ADAM7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKF5-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 29", "gene_name": "ADAM29", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14672-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 10", "gene_name": "ADAM10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q7-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 18", "gene_name": "ADAM18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKQ2-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 28", "gene_name": "ADAM28", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZ11-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 33", "gene_name": "ADAM33", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21618342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A disintegrin and metalloproteinase-12 (ADAM12): function, roles in disease progression, and clinical implications.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Nyren-Erickson EK, Jones JM, Srivastava DK, Mallik S", "reference": { "type": "PubMed", "id": "23680494", "url": "https://pubmed.ncbi.nlm.nih.gov/23680494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23680494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MiR-135b-5p targets ADAM12 to suppress invasion and accelerate trophoblast apoptosis in preeclampsia.", "journal": "Placenta", "date": "2023-11", "authors": "Sun Bo, Jiang Taotao, Yong Jiayao, Peng Julan, Dong Shangkun, Gu Yanli, Ji Xinmei, Luo Liqiong, Chang Wen-Lin", "reference": { "type": "PubMed", "id": "37864886", "url": "https://pubmed.ncbi.nlm.nih.gov/37864886" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37864886", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ADAM12-Generated Basigin Ectodomain Binds \u03b21 Integrin and Enhances the Expression of Cancer-Related Extracellular Matrix Proteins.", "journal": "International journal of molecular sciences", "date": "2024-05-28", "authors": "Mygind Kasper J, Nikodemus Denise, Gnosa Sebastian, Kweder Ramya, Albrechtsen Nicolai J Wewer, Kveiborg Marie, Erler Janine T, Albrechtsen Reidar", "reference": { "type": "PubMed", "id": "38892056", "url": "https://pubmed.ncbi.nlm.nih.gov/38892056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35613-1", "protein_name": "Basigin", "gene_name": "BSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38892056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel, secreted form of human ADAM 12 (meltrin alpha) provokes myogenesis in vivo.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Gilpin B J, Loechel F, Mattei M G, Engvall E, Albrechtsen R, Wewer U M", "reference": { "type": "PubMed", "id": "9417060", "url": "https://pubmed.ncbi.nlm.nih.gov/9417060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9417060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human ADAM 12 (meltrin alpha) is an active metalloprotease.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Loechel F, Gilpin BJ, Engvall E, Albrechtsen R, Wewer UM", "reference": { "type": "PubMed", "id": "9642263", "url": "https://pubmed.ncbi.nlm.nih.gov/9642263" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O43184-1", "protein_name": "Disintegrin and metalloproteinase domain-containing protein 12", "gene_name": "ADAM12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43184", "url": "https://www.uniprot.org/uniprotkb/O43184" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9642263", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human alcohol dehydrogenase gene (ADH6) encoding an additional class of isozyme.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Yasunami M, Chen C S, Yoshida A", "reference": { "type": "PubMed", "id": "1881901", "url": "https://pubmed.ncbi.nlm.nih.gov/1881901" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P28332-1", "protein_name": "Alcohol dehydrogenase 6", "gene_name": "ADH6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P28332", "url": "https://www.uniprot.org/uniprotkb/P28332" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1881901", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of alcohol dehydrogenase polymorphisms and life-style factors with excessive alcohol intake within the Spanish population (EPIC-Spain).", "journal": "Addiction (Abingdon, England)", "date": "2012", "authors": "Munoz X, Amiano P, Celorrio D, Dorronsoro M, Sanchez MJ, Huerta JM, Barricarte A, Arriola L, Navarro C, Molina-Montes E, Chirlaque MD, Ardanaz E, Rodriguez L, Duell EJ, Hijona E, Herreros-Villanueva M, Sala N, Bujanda L", "reference": { "type": "PubMed", "id": "22690706", "url": "https://pubmed.ncbi.nlm.nih.gov/22690706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P28332-1", "protein_name": "Alcohol dehydrogenase 6", "gene_name": "ADH6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P28332", "url": "https://www.uniprot.org/uniprotkb/P28332" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22690706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.", "journal": "Human genetics", "date": "2013", "authors": "Zuo L, Wang K, Zhang XY, Pan X, Wang G, Tan Y, Zhong C, Krystal JH, State M, Zhang H, Luo X", "reference": { "type": "PubMed", "id": "23468174", "url": "https://pubmed.ncbi.nlm.nih.gov/23468174" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P28332-1", "protein_name": "Alcohol dehydrogenase 6", "gene_name": "ADH6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P28332", "url": "https://www.uniprot.org/uniprotkb/P28332" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23468174", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Computational studies of human class V alcohol dehydrogenase - the odd sibling.", "journal": "BMC biochemistry", "date": "2016", "authors": "Ostberg LJ, Persson B, Hoog JO", "reference": { "type": "PubMed", "id": "27455956", "url": "https://pubmed.ncbi.nlm.nih.gov/27455956" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P28332-1", "protein_name": "Alcohol dehydrogenase 6", "gene_name": "ADH6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P28332", "url": "https://www.uniprot.org/uniprotkb/P28332" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27455956", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF family proteins interact with the common neurotrophin receptor and modulate apoptosis induction.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Ye X, Mehlen P, Rabizadeh S, VanArsdale T, Zhang H, Shin H, Wang JJ, Leo E, Zapata J, Hauser CA, Reed JC, Bredesen DE", "reference": { "type": "PubMed", "id": "10514511", "url": "https://pubmed.ncbi.nlm.nih.gov/10514511" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y286-1", "protein_name": "Sialic acid-binding Ig-like lectin 7", "gene_name": "SIGLEC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07174-1", "protein_name": "Tumor necrosis factor receptor superfamily member 16", "gene_name": "Ngfr", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08138-1", "protein_name": "Tumor necrosis factor receptor superfamily member 16", "gene_name": "NGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10514511", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of TRAF4 in oxidative activation of c-Jun N-terminal kinase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Xu YC, Wu RF, Gu Y, Yang YS, Yang MC, Nwariaku FE, Terada LS", "reference": { "type": "PubMed", "id": "12023963", "url": "https://pubmed.ncbi.nlm.nih.gov/12023963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12023963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor necrosis factor receptor-associated factor (TRAF) 4 is a new binding partner for the p70S6 serine/threonine kinase.", "journal": "Leukemia research", "date": "2003-08", "authors": "Fleckenstein Diana S, Dirks Wilhelm G, Drexler Hans G, Quentmeier Hilmar", "reference": { "type": "PubMed", "id": "12801526", "url": "https://pubmed.ncbi.nlm.nih.gov/12801526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23443-1", "protein_name": "Ribosomal protein S6 kinase beta-1", "gene_name": "RPS6KB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12801526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 acts as a silencer in TLR-mediated signaling through the association with TRAF6 and TRIF.", "journal": "European journal of immunology", "date": "2005-08", "authors": "Takeshita Fumihiko, Ishii Ken J, Kobiyama Kouji, Kojima Yoshitsugu, Coban Cevayir, Sasaki Shin, Ishii Norihisa, Klinman Dennis M, Okuda Kenji, Akira Shizuo, Suzuki Koichi", "reference": { "type": "PubMed", "id": "16052631", "url": "https://pubmed.ncbi.nlm.nih.gov/16052631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16052631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MEKK4 is an effector of the embryonic TRAF4 for JNK activation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Abell AN, Johnson GL", "reference": { "type": "PubMed", "id": "16157600", "url": "https://pubmed.ncbi.nlm.nih.gov/16157600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q61382-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "Traf4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y6R4-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 4", "gene_name": "MAP3K4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O08648-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 4", "gene_name": "Map3k4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1361, "end_pos": 1361, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "O08648", "url": "https://www.uniprot.org/uniprotkb/O08648" }, { "database": "PubMed", "id": "16157600", "url": "https://pubmed.ncbi.nlm.nih.gov/16157600" }, { "database": "PubMed", "id": "9079650", "url": "https://pubmed.ncbi.nlm.nih.gov/9079650" } ], "uniprot_canonical_ac": "O08648-1" }, { "start_pos": 1361, "end_pos": 1361, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "O08648", "url": "https://www.uniprot.org/uniprotkb/O08648" }, { "database": "PubMed", "id": "16157600", "url": "https://pubmed.ncbi.nlm.nih.gov/16157600" }, { "database": "PubMed", "id": "9079650", "url": "https://pubmed.ncbi.nlm.nih.gov/9079650" } ], "uniprot_canonical_ac": "O08648-1" } ], "record_id": "pubmed.16157600", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subcellular targeting of oxidants during endothelial cell migration.", "journal": "J. Cell Biol.", "date": "2005", "authors": "Wu Ru Feng, Xu You Cheng, Ma Zhenyi, Nwariaku Fiemu E, Sarosi George A, Terada Lance S", "reference": { "type": "PubMed", "id": "16330715", "url": "https://pubmed.ncbi.nlm.nih.gov/16330715" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43294-1", "protein_name": "Transforming growth factor beta-1-induced transcript 1 protein", "gene_name": "TGFB1I1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16330715", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 is potently induced by TAp63 isoforms and localised according to differentiation in SCCHN.", "journal": "Cancer Biol. Ther.", "date": "2007", "authors": "Gu Xiaolian, Coates Philip J, MacCallum Stephanie F, Boldrup Linda, Sj\u00f6str\u00f6m Bj\u00f6rn, Nylander Karin", "reference": { "type": "PubMed", "id": "18087216", "url": "https://pubmed.ncbi.nlm.nih.gov/18087216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18087216", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor necrosis factor receptor-associated factor 4 is a dynamic tight junction-related shuttle protein involved in epithelium homeostasis.", "journal": "PloS one", "date": "2008", "authors": "K\u00e9dinger Val\u00e9rie, Alpy Fabien, Baguet Aur\u00e9lie, Polette Myriam, Stoll Isabelle, Chenard Marie-Pierre, Tomasetto Catherine, Rio Marie-Christine", "reference": { "type": "PubMed", "id": "18953416", "url": "https://pubmed.ncbi.nlm.nih.gov/18953416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18953416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin ligase Smurf1 targets TRAF family proteins for ubiquitination and degradation.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Li S, Lu K, Wang J, An L, Yang G, Chen H, Cui Y, Yin X, Xie P, Xing G, He F, Zhang L", "reference": { "type": "PubMed", "id": "19937093", "url": "https://pubmed.ncbi.nlm.nih.gov/19937093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 725, "end_pos": 725, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of enzyme activity, without abolishing FBXL15-mediated ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCE7", "url": "https://www.uniprot.org/uniprotkb/Q9HCE7" }, { "database": "PubMed", "id": "19937093", "url": "https://pubmed.ncbi.nlm.nih.gov/19937093" }, { "database": "PubMed", "id": "21572392", "url": "https://pubmed.ncbi.nlm.nih.gov/21572392" } ], "uniprot_canonical_ac": "Q9HCE7-1" } ], "record_id": "pubmed.19937093", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TNF receptor-associated factor 4 (TRAF4) is a novel binding partner of glycoprotein Ib and glycoprotein VI in human platelets.", "journal": "J. Thromb. Haemost.", "date": "2011", "authors": "Arthur J F, Shen Y, Gardiner E E, Coleman L, Murphy D, Kenny D, Andrews R K, Berndt M C", "reference": { "type": "PubMed", "id": "20946164", "url": "https://pubmed.ncbi.nlm.nih.gov/20946164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20946164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IkappaB kinase alpha phosphorylation of TRAF4 downregulates innate immune signaling.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Marinis JM, Hutti JE, Homer CR, Cobb BA, Cantley LC, McDonald C, Abbott DW", "reference": { "type": "PubMed", "id": "22547678", "url": "https://pubmed.ncbi.nlm.nih.gov/22547678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "O15111-1", "kinase_gene_name": "CHUK", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9BUZ4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BUZ4" }, { "database": "PubMed", "id": "22547678", "url": "https://pubmed.ncbi.nlm.nih.gov/22547678" } ], "site_lbl": "Ser426", "uniprot_canonical_ac": "Q9BUZ4-1" }, { "start_pos": 426, "end_pos": 426, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "iPTMnet", "id": "Q9BUZ4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BUZ4" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "22547678", "url": "https://pubmed.ncbi.nlm.nih.gov/22547678" } ], "site_lbl": "Ser426", "uniprot_canonical_ac": "Q9BUZ4-1" } ], "record_id": "pubmed.22547678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for unique specificity of human TRAF4 for platelets GPIbbeta and GPVI.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2017", "authors": "Kim Chang Min, Son Young-Jin, Kim Sunghwan, Kim Seo Yun, Park Hyun Ho", "reference": { "type": "PubMed", "id": "29073066", "url": "https://pubmed.ncbi.nlm.nih.gov/29073066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29073066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 binds to the juxtamembrane region of EGFR directly and promotes kinase activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Cai G, Zhu L, Chen X, Sun K, Liu C, Sen GC, Stark GR, Qin J, Li X", "reference": { "type": "PubMed", "id": "30352854", "url": "https://pubmed.ncbi.nlm.nih.gov/30352854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00533-1", "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30352854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 positively regulates the osteogenic differentiation of mesenchymal stem cells by acting as an E3 ubiquitin ligase to degrade Smurf2.", "journal": "Cell death and differentiation", "date": "2019", "authors": "Li J, Wang P, Xie Z, Wang S, Cen S, Li M, Liu W, Tang S, Ye G, Zheng G, Su H, Ma M, Wu X, Wu Y, Shen H", "reference": { "type": "PubMed", "id": "31076633", "url": "https://pubmed.ncbi.nlm.nih.gov/31076633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31076633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 acts as a fate checkpoint to regulate the adipogenic differentiation of MSCs by activating PKM2.", "journal": "EBioMedicine", "date": "2020-04", "authors": "Cen Shuizhong, Li Jinteng, Cai Zhaopeng, Pan Yiqian, Sun Zehang, Li Zhaofeng, Ye Guiwen, Zheng Guan, Li Ming, Liu Wenjie, Yu Wenhui, Wang Shan, Xie Zhongyu, Wang Peng, Shen Huiyong", "reference": { "type": "PubMed", "id": "32268273", "url": "https://pubmed.ncbi.nlm.nih.gov/32268273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14618-1", "protein_name": "Pyruvate kinase PKM", "gene_name": "PKM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32268273", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitination of the DNA-damage checkpoint kinase CHK1 by TRAF4 is required for CHK1 activation.", "journal": "Journal of hematology & oncology", "date": "2020", "authors": "Yu X, Li W, Liu H, Deng Q, Wang X, Hu H, Xu-Monette ZY, Xiong W, Lu Z, Young KH, Wang W, Li Y", "reference": { "type": "PubMed", "id": "32357935", "url": "https://pubmed.ncbi.nlm.nih.gov/32357935" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 18, "end_pos": 18, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of E3 ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" }, { "database": "PubMed", "id": "32357935", "url": "https://pubmed.ncbi.nlm.nih.gov/32357935" } ], "uniprot_canonical_ac": "Q9BUZ4-1" }, { "start_pos": 132, "end_pos": 132, "sequence_org": "K", "sequence_mut": "R", "comment": "Strong reduction of chromatin-associated CHK1 ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "O14757", "url": "https://www.uniprot.org/uniprotkb/O14757" }, { "database": "PubMed", "id": "32357935", "url": "https://pubmed.ncbi.nlm.nih.gov/32357935" } ], "uniprot_canonical_ac": "O14757-1" } ], "phosphorylation": [ { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM and ATR", "evidence": [ { "database": "UniProtKB", "id": "O14757", "url": "https://www.uniprot.org/uniprotkb/O14757" }, { "database": "PRO", "id": "O14757", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O14757" }, { "database": "iPTMnet", "id": "O14757", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14757" }, { "database": "PubMed", "id": "11390642", "url": "https://pubmed.ncbi.nlm.nih.gov/11390642" }, { "database": "PubMed", "id": "12588868", "url": "https://pubmed.ncbi.nlm.nih.gov/12588868" }, { "database": "PubMed", "id": "12676962", "url": "https://pubmed.ncbi.nlm.nih.gov/12676962" }, { "database": "PubMed", "id": "16456034", "url": "https://pubmed.ncbi.nlm.nih.gov/16456034" }, { "database": "PubMed", "id": "16629900", "url": "https://pubmed.ncbi.nlm.nih.gov/16629900" }, { "database": "PubMed", "id": "17015476", "url": "https://pubmed.ncbi.nlm.nih.gov/17015476" }, { "database": "PubMed", "id": "17242188", "url": "https://pubmed.ncbi.nlm.nih.gov/17242188" }, { "database": "PubMed", "id": "17912033", "url": "https://pubmed.ncbi.nlm.nih.gov/17912033" }, { "database": "PubMed", "id": "18166648", "url": "https://pubmed.ncbi.nlm.nih.gov/18166648" }, { "database": "PubMed", "id": "18247328", "url": "https://pubmed.ncbi.nlm.nih.gov/18247328" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18353973", "url": "https://pubmed.ncbi.nlm.nih.gov/18353973" }, { "database": "PubMed", "id": "18787399", "url": "https://pubmed.ncbi.nlm.nih.gov/18787399" }, { "database": "PubMed", "id": "18955550", "url": "https://pubmed.ncbi.nlm.nih.gov/18955550" }, { "database": "PubMed", "id": "19091954", "url": "https://pubmed.ncbi.nlm.nih.gov/19091954" }, { "database": "PubMed", "id": "19390600", "url": "https://pubmed.ncbi.nlm.nih.gov/19390600" }, { "database": "PubMed", "id": "19421147", "url": "https://pubmed.ncbi.nlm.nih.gov/19421147" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "20194642", "url": "https://pubmed.ncbi.nlm.nih.gov/20194642" }, { "database": "PubMed", "id": "20195506", "url": "https://pubmed.ncbi.nlm.nih.gov/20195506" }, { "database": "PubMed", "id": "20373286", "url": "https://pubmed.ncbi.nlm.nih.gov/20373286" }, { "database": "PubMed", "id": "20440263", "url": "https://pubmed.ncbi.nlm.nih.gov/20440263" }, { "database": "PubMed", "id": "21347609", "url": "https://pubmed.ncbi.nlm.nih.gov/21347609" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21440578", "url": "https://pubmed.ncbi.nlm.nih.gov/21440578" }, { "database": "PubMed", "id": "21851590", "url": "https://pubmed.ncbi.nlm.nih.gov/21851590" }, { "database": "PubMed", "id": "21870291", "url": "https://pubmed.ncbi.nlm.nih.gov/21870291" }, { "database": "PubMed", "id": "22319212", "url": "https://pubmed.ncbi.nlm.nih.gov/22319212" }, { "database": "PubMed", "id": "22623962", "url": "https://pubmed.ncbi.nlm.nih.gov/22623962" }, { "database": "PubMed", "id": "22686412", "url": "https://pubmed.ncbi.nlm.nih.gov/22686412" }, { "database": "PubMed", "id": "22743332", "url": "https://pubmed.ncbi.nlm.nih.gov/22743332" }, { "database": "PubMed", "id": "22855742", "url": "https://pubmed.ncbi.nlm.nih.gov/22855742" }, { "database": "PubMed", "id": "22977173", "url": "https://pubmed.ncbi.nlm.nih.gov/22977173" }, { "database": "PubMed", "id": "23220466", "url": "https://pubmed.ncbi.nlm.nih.gov/23220466" }, { "database": "PubMed", "id": "23383325", "url": "https://pubmed.ncbi.nlm.nih.gov/23383325" }, { "database": "PubMed", "id": "23396447", "url": "https://pubmed.ncbi.nlm.nih.gov/23396447" }, { "database": "PubMed", "id": "23597309", "url": "https://pubmed.ncbi.nlm.nih.gov/23597309" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "24244353", "url": "https://pubmed.ncbi.nlm.nih.gov/24244353" }, { "database": "PubMed", "id": "24376897", "url": "https://pubmed.ncbi.nlm.nih.gov/24376897" }, { "database": "PubMed", "id": "24500207", "url": "https://pubmed.ncbi.nlm.nih.gov/24500207" }, { "database": "PubMed", "id": "24753408", "url": "https://pubmed.ncbi.nlm.nih.gov/24753408" }, { "database": "PubMed", "id": "24913641", "url": "https://pubmed.ncbi.nlm.nih.gov/24913641" }, { "database": "PubMed", "id": "24996846", "url": "https://pubmed.ncbi.nlm.nih.gov/24996846" }, { "database": "PubMed", "id": "25104095", "url": "https://pubmed.ncbi.nlm.nih.gov/25104095" }, { "database": "PubMed", "id": "25216266", "url": "https://pubmed.ncbi.nlm.nih.gov/25216266" }, { "database": "PubMed", "id": "25217585", "url": "https://pubmed.ncbi.nlm.nih.gov/25217585" }, { "database": "PubMed", "id": "25249630", "url": "https://pubmed.ncbi.nlm.nih.gov/25249630" }, { "database": "PubMed", "id": "25283841", "url": "https://pubmed.ncbi.nlm.nih.gov/25283841" }, { "database": "PubMed", "id": "25301724", "url": "https://pubmed.ncbi.nlm.nih.gov/25301724" }, { "database": "PubMed", "id": "25460505", "url": "https://pubmed.ncbi.nlm.nih.gov/25460505" }, { "database": "PubMed", "id": "25474241", "url": "https://pubmed.ncbi.nlm.nih.gov/25474241" }, { "database": "PubMed", "id": "25565400", "url": "https://pubmed.ncbi.nlm.nih.gov/25565400" }, { "database": "PubMed", "id": "25593194", "url": "https://pubmed.ncbi.nlm.nih.gov/25593194" }, { "database": "PubMed", "id": "25904336", "url": "https://pubmed.ncbi.nlm.nih.gov/25904336" }, { "database": "PubMed", "id": "25916848", "url": "https://pubmed.ncbi.nlm.nih.gov/25916848" }, { "database": "PubMed", "id": "25965828", "url": "https://pubmed.ncbi.nlm.nih.gov/25965828" }, { "database": "PubMed", "id": "26057167", "url": "https://pubmed.ncbi.nlm.nih.gov/26057167" }, { "database": "PubMed", "id": "26114388", "url": "https://pubmed.ncbi.nlm.nih.gov/26114388" }, { "database": "PubMed", "id": "26161259", "url": "https://pubmed.ncbi.nlm.nih.gov/26161259" }, { "database": "PubMed", "id": "26271993", "url": "https://pubmed.ncbi.nlm.nih.gov/26271993" }, { "database": "PubMed", "id": "26295308", "url": "https://pubmed.ncbi.nlm.nih.gov/26295308" }, { "database": "PubMed", "id": "26439697", "url": "https://pubmed.ncbi.nlm.nih.gov/26439697" }, { "database": "PubMed", "id": "26542114", "url": "https://pubmed.ncbi.nlm.nih.gov/26542114" }, { "database": "PubMed", "id": "26658951", "url": "https://pubmed.ncbi.nlm.nih.gov/26658951" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26860083", "url": "https://pubmed.ncbi.nlm.nih.gov/26860083" }, { "database": "PubMed", "id": "27029031", "url": "https://pubmed.ncbi.nlm.nih.gov/27029031" }, { "database": "PubMed", "id": "27538817", "url": "https://pubmed.ncbi.nlm.nih.gov/27538817" }, { "database": "PubMed", "id": "27775084", "url": "https://pubmed.ncbi.nlm.nih.gov/27775084" }, { "database": "PubMed", "id": "27940557", "url": "https://pubmed.ncbi.nlm.nih.gov/27940557" }, { "database": "PubMed", "id": "28915668", "url": "https://pubmed.ncbi.nlm.nih.gov/28915668" }, { "database": "PubMed", "id": "29118324", "url": "https://pubmed.ncbi.nlm.nih.gov/29118324" }, { "database": "PubMed", "id": "29340034", "url": "https://pubmed.ncbi.nlm.nih.gov/29340034" }, { "database": "PubMed", "id": "29383140", "url": "https://pubmed.ncbi.nlm.nih.gov/29383140" }, { "database": "PubMed", "id": "29617433", "url": "https://pubmed.ncbi.nlm.nih.gov/29617433" }, { "database": "PubMed", "id": "29725502", "url": "https://pubmed.ncbi.nlm.nih.gov/29725502" }, { "database": "PubMed", "id": "29963769", "url": "https://pubmed.ncbi.nlm.nih.gov/29963769" }, { "database": "PubMed", "id": "30100999", "url": "https://pubmed.ncbi.nlm.nih.gov/30100999" }, { "database": "PubMed", "id": "30237520", "url": "https://pubmed.ncbi.nlm.nih.gov/30237520" }, { "database": "PubMed", "id": "30337689", "url": "https://pubmed.ncbi.nlm.nih.gov/30337689" }, { "database": "PubMed", "id": "30384048", "url": "https://pubmed.ncbi.nlm.nih.gov/30384048" }, { "database": "PubMed", "id": "30439567", "url": "https://pubmed.ncbi.nlm.nih.gov/30439567" }, { "database": "PubMed", "id": "30796221", "url": "https://pubmed.ncbi.nlm.nih.gov/30796221" }, { "database": "PubMed", "id": "31044505", "url": "https://pubmed.ncbi.nlm.nih.gov/31044505" }, { "database": "PubMed", "id": "31209037", "url": "https://pubmed.ncbi.nlm.nih.gov/31209037" }, { "database": "PubMed", "id": "32042960", "url": "https://pubmed.ncbi.nlm.nih.gov/32042960" }, { "database": "PubMed", "id": "32076484", "url": "https://pubmed.ncbi.nlm.nih.gov/32076484" }, { "database": "PubMed", "id": "32085572", "url": "https://pubmed.ncbi.nlm.nih.gov/32085572" }, { "database": "PubMed", "id": "32210727", "url": "https://pubmed.ncbi.nlm.nih.gov/32210727" }, { "database": "PubMed", "id": "32357935", "url": "https://pubmed.ncbi.nlm.nih.gov/32357935" }, { "database": "PubMed", "id": "32533099", "url": "https://pubmed.ncbi.nlm.nih.gov/32533099" }, { "database": "PubMed", "id": "32591500", "url": "https://pubmed.ncbi.nlm.nih.gov/32591500" }, { "database": "PubMed", "id": "32647134", "url": "https://pubmed.ncbi.nlm.nih.gov/32647134" }, { "database": "PubMed", "id": "32847043", "url": "https://pubmed.ncbi.nlm.nih.gov/32847043" }, { "database": "PubMed", "id": "33020410", "url": "https://pubmed.ncbi.nlm.nih.gov/33020410" }, { "database": "PubMed", "id": "33101488", "url": "https://pubmed.ncbi.nlm.nih.gov/33101488" }, { "database": "PubMed", "id": "33477536", "url": "https://pubmed.ncbi.nlm.nih.gov/33477536" }, { "database": "PubMed", "id": "35889508", "url": "https://pubmed.ncbi.nlm.nih.gov/35889508" }, { "database": "PubMed", "id": "12446774", "url": "https://pubmed.ncbi.nlm.nih.gov/12446774" }, { "database": "PubMed", "id": "12660173", "url": "https://pubmed.ncbi.nlm.nih.gov/12660173" }, { "database": "PubMed", "id": "12676583", "url": "https://pubmed.ncbi.nlm.nih.gov/12676583" }, { "database": "PubMed", "id": "14657349", "url": "https://pubmed.ncbi.nlm.nih.gov/14657349" }, { "database": "PubMed", "id": "15707391", "url": "https://pubmed.ncbi.nlm.nih.gov/15707391" }, { "database": "PubMed", "id": "15870257", "url": "https://pubmed.ncbi.nlm.nih.gov/15870257" } ], "site_lbl": "Ser317", "uniprot_canonical_ac": "O14757-1" }, { "start_pos": 345, "end_pos": 345, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM and ATR", "evidence": [ { "database": "UniProtKB", "id": "O14757", "url": "https://www.uniprot.org/uniprotkb/O14757" }, { "database": "IntAct", "id": "O14757", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14757*" }, { "database": "iPTMnet", "id": "O14757", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14757" }, { "database": "PubMed", "id": "20639859", "url": "https://pubmed.ncbi.nlm.nih.gov/20639859" }, { "database": "PRO", "id": "O14757", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O14757" }, { "database": "PubMed", "id": "10859164", "url": "https://pubmed.ncbi.nlm.nih.gov/10859164" }, { "database": "PubMed", "id": "11390642", "url": "https://pubmed.ncbi.nlm.nih.gov/11390642" }, { "database": "PubMed", "id": "11553781", "url": "https://pubmed.ncbi.nlm.nih.gov/11553781" }, { "database": "PubMed", "id": "11896572", "url": "https://pubmed.ncbi.nlm.nih.gov/11896572" }, { "database": "PubMed", "id": "12150968", "url": "https://pubmed.ncbi.nlm.nih.gov/12150968" }, { "database": "PubMed", "id": "12370755", "url": "https://pubmed.ncbi.nlm.nih.gov/12370755" }, { "database": "PubMed", "id": "12676962", "url": "https://pubmed.ncbi.nlm.nih.gov/12676962" }, { "database": "PubMed", "id": "12684226", "url": "https://pubmed.ncbi.nlm.nih.gov/12684226" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "13679850", "url": "https://pubmed.ncbi.nlm.nih.gov/13679850" }, { "database": "PubMed", "id": "14681223", "url": "https://pubmed.ncbi.nlm.nih.gov/14681223" }, { "database": "PubMed", "id": "15107605", "url": "https://pubmed.ncbi.nlm.nih.gov/15107605" }, { "database": "PubMed", "id": "15190204", "url": "https://pubmed.ncbi.nlm.nih.gov/15190204" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "16137618", "url": "https://pubmed.ncbi.nlm.nih.gov/16137618" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16461339", "url": "https://pubmed.ncbi.nlm.nih.gov/16461339" }, { "database": "PubMed", "id": "16629900", "url": "https://pubmed.ncbi.nlm.nih.gov/16629900" }, { "database": "PubMed", "id": "17015476", "url": "https://pubmed.ncbi.nlm.nih.gov/17015476" }, { "database": "PubMed", "id": "17210576", "url": "https://pubmed.ncbi.nlm.nih.gov/17210576" }, { "database": "PubMed", "id": "17236549", "url": "https://pubmed.ncbi.nlm.nih.gov/17236549" }, { "database": "PubMed", "id": "17242188", "url": "https://pubmed.ncbi.nlm.nih.gov/17242188" }, { "database": "PubMed", "id": "17495959", "url": "https://pubmed.ncbi.nlm.nih.gov/17495959" }, { "database": "PubMed", "id": "17634129", "url": "https://pubmed.ncbi.nlm.nih.gov/17634129" }, { "database": "PubMed", "id": "17638905", "url": "https://pubmed.ncbi.nlm.nih.gov/17638905" }, { "database": "PubMed", "id": "17982623", "url": "https://pubmed.ncbi.nlm.nih.gov/17982623" }, { "database": "PubMed", "id": "18071310", "url": "https://pubmed.ncbi.nlm.nih.gov/18071310" }, { "database": "PubMed", "id": "18247328", "url": "https://pubmed.ncbi.nlm.nih.gov/18247328" }, { "database": "PubMed", "id": "18353973", "url": "https://pubmed.ncbi.nlm.nih.gov/18353973" }, { "database": "PubMed", "id": "18495871", "url": "https://pubmed.ncbi.nlm.nih.gov/18495871" }, { "database": "PubMed", "id": "18787399", "url": "https://pubmed.ncbi.nlm.nih.gov/18787399" }, { "database": "PubMed", "id": "18955550", "url": "https://pubmed.ncbi.nlm.nih.gov/18955550" }, { "database": "PubMed", "id": "18983824", "url": "https://pubmed.ncbi.nlm.nih.gov/18983824" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19177015", "url": "https://pubmed.ncbi.nlm.nih.gov/19177015" }, { "database": "PubMed", "id": "19261750", "url": "https://pubmed.ncbi.nlm.nih.gov/19261750" }, { "database": "PubMed", "id": "19330022", "url": "https://pubmed.ncbi.nlm.nih.gov/19330022" }, { "database": "PubMed", "id": "19401701", "url": "https://pubmed.ncbi.nlm.nih.gov/19401701" }, { "database": "PubMed", "id": "19411857", "url": "https://pubmed.ncbi.nlm.nih.gov/19411857" }, { "database": "PubMed", "id": "19421147", "url": "https://pubmed.ncbi.nlm.nih.gov/19421147" }, { "database": "PubMed", "id": "19464357", "url": "https://pubmed.ncbi.nlm.nih.gov/19464357" }, { "database": "PubMed", "id": "19541796", "url": "https://pubmed.ncbi.nlm.nih.gov/19541796" }, { "database": "PubMed", "id": "19646247", "url": "https://pubmed.ncbi.nlm.nih.gov/19646247" }, { "database": "PubMed", "id": "19855428", "url": "https://pubmed.ncbi.nlm.nih.gov/19855428" }, { "database": "PubMed", "id": "20195506", "url": "https://pubmed.ncbi.nlm.nih.gov/20195506" }, { "database": "PubMed", "id": "20373286", "url": "https://pubmed.ncbi.nlm.nih.gov/20373286" }, { "database": "PubMed", "id": "20479464", "url": "https://pubmed.ncbi.nlm.nih.gov/20479464" }, { "database": "PubMed", "id": "20609246", "url": "https://pubmed.ncbi.nlm.nih.gov/20609246" }, { "database": "PubMed", "id": "20679434", "url": "https://pubmed.ncbi.nlm.nih.gov/20679434" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20976184", "url": "https://pubmed.ncbi.nlm.nih.gov/20976184" }, { "database": "PubMed", "id": "21289283", "url": "https://pubmed.ncbi.nlm.nih.gov/21289283" }, { "database": "PubMed", "id": "21321020", "url": "https://pubmed.ncbi.nlm.nih.gov/21321020" }, { "database": "PubMed", "id": "21440578", "url": "https://pubmed.ncbi.nlm.nih.gov/21440578" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21730979", "url": "https://pubmed.ncbi.nlm.nih.gov/21730979" }, { "database": "PubMed", "id": "21851590", "url": "https://pubmed.ncbi.nlm.nih.gov/21851590" }, { "database": "PubMed", "id": "21870291", "url": "https://pubmed.ncbi.nlm.nih.gov/21870291" }, { "database": "PubMed", "id": "21965652", "url": "https://pubmed.ncbi.nlm.nih.gov/21965652" }, { "database": "PubMed", "id": "22357623", "url": "https://pubmed.ncbi.nlm.nih.gov/22357623" }, { "database": "PubMed", "id": "22623962", "url": "https://pubmed.ncbi.nlm.nih.gov/22623962" }, { "database": "PubMed", "id": "22761726", "url": "https://pubmed.ncbi.nlm.nih.gov/22761726" }, { "database": "PubMed", "id": "22768280", "url": "https://pubmed.ncbi.nlm.nih.gov/22768280" }, { "database": "PubMed", "id": "22855742", "url": "https://pubmed.ncbi.nlm.nih.gov/22855742" }, { "database": "PubMed", "id": "22937147", "url": "https://pubmed.ncbi.nlm.nih.gov/22937147" }, { "database": "PubMed", "id": "23148684", "url": "https://pubmed.ncbi.nlm.nih.gov/23148684" }, { "database": "PubMed", "id": "23383325", "url": "https://pubmed.ncbi.nlm.nih.gov/23383325" }, { "database": "PubMed", "id": "23597309", "url": "https://pubmed.ncbi.nlm.nih.gov/23597309" }, { "database": "PubMed", "id": "23755068", "url": "https://pubmed.ncbi.nlm.nih.gov/23755068" }, { "database": "PubMed", "id": "23799366", "url": "https://pubmed.ncbi.nlm.nih.gov/23799366" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23861943", "url": "https://pubmed.ncbi.nlm.nih.gov/23861943" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23897887", "url": "https://pubmed.ncbi.nlm.nih.gov/23897887" }, { "database": "PubMed", "id": "24005565", "url": "https://pubmed.ncbi.nlm.nih.gov/24005565" }, { "database": "PubMed", "id": "24023735", "url": "https://pubmed.ncbi.nlm.nih.gov/24023735" }, { "database": "PubMed", "id": "24153426", "url": "https://pubmed.ncbi.nlm.nih.gov/24153426" }, { "database": "PubMed", "id": "24182986", "url": "https://pubmed.ncbi.nlm.nih.gov/24182986" }, { "database": "PubMed", "id": "24204313", "url": "https://pubmed.ncbi.nlm.nih.gov/24204313" }, { "database": "PubMed", "id": "24244353", "url": "https://pubmed.ncbi.nlm.nih.gov/24244353" }, { "database": "PubMed", "id": "24260231", "url": "https://pubmed.ncbi.nlm.nih.gov/24260231" }, { "database": "PubMed", "id": "24260532", "url": "https://pubmed.ncbi.nlm.nih.gov/24260532" }, { "database": "PubMed", "id": "24309929", "url": "https://pubmed.ncbi.nlm.nih.gov/24309929" }, { "database": "PubMed", "id": "24359526", "url": "https://pubmed.ncbi.nlm.nih.gov/24359526" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24753408", "url": "https://pubmed.ncbi.nlm.nih.gov/24753408" }, { "database": "PubMed", "id": "24758542", "url": "https://pubmed.ncbi.nlm.nih.gov/24758542" }, { "database": "PubMed", "id": "24812435", "url": "https://pubmed.ncbi.nlm.nih.gov/24812435" }, { "database": "PubMed", "id": "24853431", "url": "https://pubmed.ncbi.nlm.nih.gov/24853431" }, { "database": "PubMed", "id": "24913641", "url": "https://pubmed.ncbi.nlm.nih.gov/24913641" }, { "database": "PubMed", "id": "24996846", "url": "https://pubmed.ncbi.nlm.nih.gov/24996846" }, { "database": "PubMed", "id": "25016522", "url": "https://pubmed.ncbi.nlm.nih.gov/25016522" }, { "database": "PubMed", "id": "25104095", "url": "https://pubmed.ncbi.nlm.nih.gov/25104095" }, { "database": "PubMed", "id": "25249630", "url": "https://pubmed.ncbi.nlm.nih.gov/25249630" }, { "database": "PubMed", "id": "25283841", "url": "https://pubmed.ncbi.nlm.nih.gov/25283841" }, { "database": "PubMed", "id": "25301724", "url": "https://pubmed.ncbi.nlm.nih.gov/25301724" }, { "database": "PubMed", "id": "25316620", "url": "https://pubmed.ncbi.nlm.nih.gov/25316620" }, { "database": "PubMed", "id": "25336189", "url": "https://pubmed.ncbi.nlm.nih.gov/25336189" }, { "database": "PubMed", "id": "25375241", "url": "https://pubmed.ncbi.nlm.nih.gov/25375241" }, { "database": "PubMed", "id": "25460505", "url": "https://pubmed.ncbi.nlm.nih.gov/25460505" }, { "database": "PubMed", "id": "25474241", "url": "https://pubmed.ncbi.nlm.nih.gov/25474241" }, { "database": "PubMed", "id": "25486478", "url": "https://pubmed.ncbi.nlm.nih.gov/25486478" }, { "database": "PubMed", "id": "25527123", "url": "https://pubmed.ncbi.nlm.nih.gov/25527123" }, { "database": "PubMed", "id": "25565400", "url": "https://pubmed.ncbi.nlm.nih.gov/25565400" }, { "database": "PubMed", "id": "25700705", "url": "https://pubmed.ncbi.nlm.nih.gov/25700705" }, { "database": "PubMed", "id": "25880358", "url": "https://pubmed.ncbi.nlm.nih.gov/25880358" }, { "database": "PubMed", "id": "25884494", "url": "https://pubmed.ncbi.nlm.nih.gov/25884494" }, { "database": "PubMed", "id": "25904336", "url": "https://pubmed.ncbi.nlm.nih.gov/25904336" }, { "database": "PubMed", "id": "25916848", "url": "https://pubmed.ncbi.nlm.nih.gov/25916848" }, { "database": "PubMed", "id": "26039276", "url": "https://pubmed.ncbi.nlm.nih.gov/26039276" }, { "database": "PubMed", "id": "26057167", "url": "https://pubmed.ncbi.nlm.nih.gov/26057167" }, { "database": "PubMed", "id": "26114388", "url": "https://pubmed.ncbi.nlm.nih.gov/26114388" }, { "database": "PubMed", "id": "26161259", "url": "https://pubmed.ncbi.nlm.nih.gov/26161259" }, { "database": "PubMed", "id": "26208482", "url": "https://pubmed.ncbi.nlm.nih.gov/26208482" }, { "database": "PubMed", "id": "26271993", "url": "https://pubmed.ncbi.nlm.nih.gov/26271993" }, { "database": "PubMed", "id": "26295308", "url": "https://pubmed.ncbi.nlm.nih.gov/26295308" }, { "database": "PubMed", "id": "26312135", "url": "https://pubmed.ncbi.nlm.nih.gov/26312135" }, { "database": "PubMed", "id": "26438152", "url": "https://pubmed.ncbi.nlm.nih.gov/26438152" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26542114", "url": "https://pubmed.ncbi.nlm.nih.gov/26542114" }, { "database": "PubMed", "id": "26684013", "url": "https://pubmed.ncbi.nlm.nih.gov/26684013" }, { "database": "PubMed", "id": "26748709", "url": "https://pubmed.ncbi.nlm.nih.gov/26748709" }, { "database": "PubMed", "id": "26860083", "url": "https://pubmed.ncbi.nlm.nih.gov/26860083" }, { "database": "PubMed", "id": "26919204", "url": "https://pubmed.ncbi.nlm.nih.gov/26919204" }, { "database": "PubMed", "id": "27271602", "url": "https://pubmed.ncbi.nlm.nih.gov/27271602" }, { "database": "PubMed", "id": "27286446", "url": "https://pubmed.ncbi.nlm.nih.gov/27286446" }, { "database": "PubMed", "id": "27286453", "url": "https://pubmed.ncbi.nlm.nih.gov/27286453" }, { "database": "PubMed", "id": "27401717", "url": "https://pubmed.ncbi.nlm.nih.gov/27401717" }, { "database": "PubMed", "id": "27472395", "url": "https://pubmed.ncbi.nlm.nih.gov/27472395" }, { "database": "PubMed", "id": "27558808", "url": "https://pubmed.ncbi.nlm.nih.gov/27558808" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27643582", "url": "https://pubmed.ncbi.nlm.nih.gov/27643582" }, { "database": "PubMed", "id": "27685627", "url": "https://pubmed.ncbi.nlm.nih.gov/27685627" }, { "database": "PubMed", "id": "27888802", "url": "https://pubmed.ncbi.nlm.nih.gov/27888802" }, { "database": "PubMed", "id": "27940557", "url": "https://pubmed.ncbi.nlm.nih.gov/27940557" }, { "database": "PubMed", "id": "28025997", "url": "https://pubmed.ncbi.nlm.nih.gov/28025997" }, { "database": "PubMed", "id": "28042876", "url": "https://pubmed.ncbi.nlm.nih.gov/28042876" }, { "database": "PubMed", "id": "28049532", "url": "https://pubmed.ncbi.nlm.nih.gov/28049532" }, { "database": "PubMed", "id": "28180282", "url": "https://pubmed.ncbi.nlm.nih.gov/28180282" }, { "database": "PubMed", "id": "28264028", "url": "https://pubmed.ncbi.nlm.nih.gov/28264028" }, { "database": "PubMed", "id": "28415748", "url": "https://pubmed.ncbi.nlm.nih.gov/28415748" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28558031", "url": "https://pubmed.ncbi.nlm.nih.gov/28558031" }, { "database": "PubMed", "id": "28573382", "url": "https://pubmed.ncbi.nlm.nih.gov/28573382" }, { "database": "PubMed", "id": "28881656", "url": "https://pubmed.ncbi.nlm.nih.gov/28881656" }, { "database": "PubMed", "id": "28915668", "url": "https://pubmed.ncbi.nlm.nih.gov/28915668" }, { "database": "PubMed", "id": "28967905", "url": "https://pubmed.ncbi.nlm.nih.gov/28967905" }, { "database": "PubMed", "id": "28986587", "url": "https://pubmed.ncbi.nlm.nih.gov/28986587" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29074359", "url": "https://pubmed.ncbi.nlm.nih.gov/29074359" }, { "database": "PubMed", "id": "29092815", "url": "https://pubmed.ncbi.nlm.nih.gov/29092815" }, { "database": "PubMed", "id": "29118324", "url": "https://pubmed.ncbi.nlm.nih.gov/29118324" }, { "database": "PubMed", "id": "29163782", "url": "https://pubmed.ncbi.nlm.nih.gov/29163782" }, { "database": "PubMed", "id": "29221122", "url": "https://pubmed.ncbi.nlm.nih.gov/29221122" }, { "database": "PubMed", "id": "29242514", "url": "https://pubmed.ncbi.nlm.nih.gov/29242514" }, { "database": "PubMed", "id": "29340034", "url": "https://pubmed.ncbi.nlm.nih.gov/29340034" }, { "database": "PubMed", "id": "29383140", "url": "https://pubmed.ncbi.nlm.nih.gov/29383140" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29464074", "url": "https://pubmed.ncbi.nlm.nih.gov/29464074" }, { "database": "PubMed", "id": "29617433", "url": "https://pubmed.ncbi.nlm.nih.gov/29617433" }, { "database": "PubMed", "id": "29725502", "url": "https://pubmed.ncbi.nlm.nih.gov/29725502" }, { "database": "PubMed", "id": "29741650", "url": "https://pubmed.ncbi.nlm.nih.gov/29741650" }, { "database": "PubMed", "id": "29963769", "url": "https://pubmed.ncbi.nlm.nih.gov/29963769" }, { "database": "PubMed", "id": "30100999", "url": "https://pubmed.ncbi.nlm.nih.gov/30100999" }, { "database": "PubMed", "id": "30119887", "url": "https://pubmed.ncbi.nlm.nih.gov/30119887" }, { "database": "PubMed", "id": "30211163", "url": "https://pubmed.ncbi.nlm.nih.gov/30211163" }, { "database": "PubMed", "id": "30237857", "url": "https://pubmed.ncbi.nlm.nih.gov/30237857" }, { "database": "PubMed", "id": "30337689", "url": "https://pubmed.ncbi.nlm.nih.gov/30337689" }, { "database": "PubMed", "id": "30384048", "url": "https://pubmed.ncbi.nlm.nih.gov/30384048" }, { "database": "PubMed", "id": "30445466", "url": "https://pubmed.ncbi.nlm.nih.gov/30445466" }, { "database": "PubMed", "id": "30510197", "url": "https://pubmed.ncbi.nlm.nih.gov/30510197" }, { "database": "PubMed", "id": "30516086", "url": "https://pubmed.ncbi.nlm.nih.gov/30516086" }, { "database": "PubMed", "id": "30543688", "url": "https://pubmed.ncbi.nlm.nih.gov/30543688" }, { "database": "PubMed", "id": "30657978", "url": "https://pubmed.ncbi.nlm.nih.gov/30657978" }, { "database": "PubMed", "id": "30837643", "url": "https://pubmed.ncbi.nlm.nih.gov/30837643" }, { "database": "PubMed", "id": "30889383", "url": "https://pubmed.ncbi.nlm.nih.gov/30889383" }, { "database": "PubMed", "id": "30900384", "url": "https://pubmed.ncbi.nlm.nih.gov/30900384" }, { "database": "PubMed", "id": "31017975", "url": "https://pubmed.ncbi.nlm.nih.gov/31017975" }, { "database": "PubMed", "id": "31114910", "url": "https://pubmed.ncbi.nlm.nih.gov/31114910" }, { "database": "PubMed", "id": "31164689", "url": "https://pubmed.ncbi.nlm.nih.gov/31164689" }, { "database": "PubMed", "id": "31209037", "url": "https://pubmed.ncbi.nlm.nih.gov/31209037" }, { "database": "PubMed", "id": "31285446", "url": "https://pubmed.ncbi.nlm.nih.gov/31285446" }, { "database": "PubMed", "id": "31302002", "url": "https://pubmed.ncbi.nlm.nih.gov/31302002" }, { "database": "PubMed", "id": "31316063", "url": "https://pubmed.ncbi.nlm.nih.gov/31316063" }, { "database": "PubMed", "id": "31362447", "url": "https://pubmed.ncbi.nlm.nih.gov/31362447" }, { "database": "PubMed", "id": "31431503", "url": "https://pubmed.ncbi.nlm.nih.gov/31431503" }, { "database": "PubMed", "id": "31717700", "url": "https://pubmed.ncbi.nlm.nih.gov/31717700" }, { "database": "PubMed", "id": "31759252", "url": "https://pubmed.ncbi.nlm.nih.gov/31759252" }, { "database": "PubMed", "id": "31805725", "url": "https://pubmed.ncbi.nlm.nih.gov/31805725" }, { "database": "PubMed", "id": "31832331", "url": "https://pubmed.ncbi.nlm.nih.gov/31832331" }, { "database": "PubMed", "id": "32042960", "url": "https://pubmed.ncbi.nlm.nih.gov/32042960" }, { "database": "PubMed", "id": "32085572", "url": "https://pubmed.ncbi.nlm.nih.gov/32085572" }, { "database": "PubMed", "id": "32210727", "url": "https://pubmed.ncbi.nlm.nih.gov/32210727" }, { "database": "PubMed", "id": "32276518", "url": "https://pubmed.ncbi.nlm.nih.gov/32276518" }, { "database": "PubMed", "id": "32294924", "url": "https://pubmed.ncbi.nlm.nih.gov/32294924" }, { "database": "PubMed", "id": "32357935", "url": "https://pubmed.ncbi.nlm.nih.gov/32357935" }, { "database": "PubMed", "id": "32545536", "url": "https://pubmed.ncbi.nlm.nih.gov/32545536" }, { "database": "PubMed", "id": "32579780", "url": "https://pubmed.ncbi.nlm.nih.gov/32579780" }, { "database": "PubMed", "id": "32591500", "url": "https://pubmed.ncbi.nlm.nih.gov/32591500" }, { "database": "PubMed", "id": "32628111", "url": "https://pubmed.ncbi.nlm.nih.gov/32628111" }, { "database": "PubMed", "id": "32647134", "url": "https://pubmed.ncbi.nlm.nih.gov/32647134" }, { "database": "PubMed", "id": "32859084", "url": "https://pubmed.ncbi.nlm.nih.gov/32859084" }, { "database": "PubMed", "id": "33020410", "url": "https://pubmed.ncbi.nlm.nih.gov/33020410" }, { "database": "PubMed", "id": "33087136", "url": "https://pubmed.ncbi.nlm.nih.gov/33087136" }, { "database": "PubMed", "id": "33101488", "url": "https://pubmed.ncbi.nlm.nih.gov/33101488" }, { "database": "PubMed", "id": "33168956", "url": "https://pubmed.ncbi.nlm.nih.gov/33168956" }, { "database": "PubMed", "id": "33466733", "url": "https://pubmed.ncbi.nlm.nih.gov/33466733" }, { "database": "PubMed", "id": "33477536", "url": "https://pubmed.ncbi.nlm.nih.gov/33477536" }, { "database": "PubMed", "id": "33546122", "url": "https://pubmed.ncbi.nlm.nih.gov/33546122" }, { "database": "PubMed", "id": "33556369", "url": "https://pubmed.ncbi.nlm.nih.gov/33556369" }, { "database": "PubMed", "id": "33657372", "url": "https://pubmed.ncbi.nlm.nih.gov/33657372" }, { "database": "PubMed", "id": "33820915", "url": "https://pubmed.ncbi.nlm.nih.gov/33820915" }, { "database": "PubMed", "id": "33870196", "url": "https://pubmed.ncbi.nlm.nih.gov/33870196" }, { "database": "PubMed", "id": "12446774", "url": "https://pubmed.ncbi.nlm.nih.gov/12446774" }, { "database": "PubMed", "id": "12676583", "url": "https://pubmed.ncbi.nlm.nih.gov/12676583" }, { "database": "PubMed", "id": "12676925", "url": "https://pubmed.ncbi.nlm.nih.gov/12676925" }, { "database": "PubMed", "id": "14988723", "url": "https://pubmed.ncbi.nlm.nih.gov/14988723" }, { "database": "PubMed", "id": "15650047", "url": "https://pubmed.ncbi.nlm.nih.gov/15650047" }, { "database": "PubMed", "id": "15707391", "url": "https://pubmed.ncbi.nlm.nih.gov/15707391" }, { "database": "PubMed", "id": "15870257", "url": "https://pubmed.ncbi.nlm.nih.gov/15870257" }, { "database": "PubMed", "id": "19716789", "url": "https://pubmed.ncbi.nlm.nih.gov/19716789" } ], "site_lbl": "Ser345", "uniprot_canonical_ac": "O14757-1" } ], "record_id": "pubmed.32357935", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E3 ligase TRAF4 promotes IGF signaling by mediating atypical ubiquitination of IRS-1.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Yu W, Singh R, Wang Z, O'Malley BW, Yi P", "reference": { "type": "PubMed", "id": "33991522", "url": "https://pubmed.ncbi.nlm.nih.gov/33991522" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35568-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "IRS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1186, "end_pos": 1186, "sequence_org": "K", "sequence_mut": "R", "comment": "Significantly reduced TRAF4-mediated ubiquitination; when associated with R-1189.", "evidence": [ { "database": "UniProtKB", "id": "P35568", "url": "https://www.uniprot.org/uniprotkb/P35568" }, { "database": "PubMed", "id": "33991522", "url": "https://pubmed.ncbi.nlm.nih.gov/33991522" } ], "uniprot_canonical_ac": "P35568-1" }, { "start_pos": 1189, "end_pos": 1189, "sequence_org": "K", "sequence_mut": "R", "comment": "Significantly reduced TRAF4-mediated ubiquitination; when associated with R-1186.", "evidence": [ { "database": "UniProtKB", "id": "P35568", "url": "https://www.uniprot.org/uniprotkb/P35568" }, { "database": "PubMed", "id": "33991522", "url": "https://pubmed.ncbi.nlm.nih.gov/33991522" } ], "uniprot_canonical_ac": "P35568-1" } ], "record_id": "pubmed.33991522", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 Silencing Induces Cell Apoptosis and Improves Retinoic Acid Sensitivity in Human Neuroblastoma.", "journal": "Neurochemical research", "date": "2023-02-16", "authors": "Gu Yayun, Zhong Kun, Peng Lizhong, Ding Weihua, Zeng Xuhui", "reference": { "type": "PubMed", "id": "36795185", "url": "https://pubmed.ncbi.nlm.nih.gov/36795185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36795185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "USP7 mediates TRAF4 deubiquitination to facilitate the malignant phenotype of ovarian cancer via the RSK4/PI3K/AKT axis.", "journal": "Journal of cancer research and therapeutics", "date": "2023-02", "authors": "Wang Ying, Luo Xia, Wu Nayiyuan, Liao Qianjin, Wang Jing", "reference": { "type": "PubMed", "id": "37006049", "url": "https://pubmed.ncbi.nlm.nih.gov/37006049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37006049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF4 regulates ubiquitination-modulated survivin turnover and confers radioresistance.", "journal": "International journal of biological sciences", "date": "2024", "authors": "Liao Jinzhuang, Qing Xiang, Li Xiaoying, Gan Yu, Wang Ruirui, Han Shuangze, Li Wei, Song Wei", "reference": { "type": "PubMed", "id": "38164179", "url": "https://pubmed.ncbi.nlm.nih.gov/38164179" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38164179", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[TRAF4 promotes lung cancer development by activating tyrosine kinase of EGFR].", "journal": "Zhonghua zhong liu za zhi [Chinese journal of oncology]", "date": "2024-10-23", "authors": "Nie X M, Dong D F, Lin J F, Wu B Y, Cai G", "reference": { "type": "PubMed", "id": "39414598", "url": "https://pubmed.ncbi.nlm.nih.gov/39414598" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00533-1", "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39414598", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17.", "journal": "Genomics", "date": "1995", "authors": "Tomasetto C, Regnier C, Moog-Lutz C, Mattei MG, Chenard MP, Lidereau R, Basset P, Rio MC", "reference": { "type": "PubMed", "id": "7490069", "url": "https://pubmed.ncbi.nlm.nih.gov/7490069" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31949-1", "protein_name": "Protein S100-A11", "gene_name": "S100A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14533-1", "protein_name": "Keratin, type II cuticular Hb1", "gene_name": "KRT81", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q61542-1", "protein_name": "StAR-related lipid transfer protein 3", "gene_name": "Stard3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14849-1", "protein_name": "StAR-related lipid transfer protein 3", "gene_name": "STARD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14847-1", "protein_name": "LIM and SH3 domain protein 1", "gene_name": "LASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15234-1", "protein_name": "Protein CASC3", "gene_name": "CASC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7490069", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Presence of a new conserved domain in CART1, a novel member of the tumor necrosis factor receptor-associated protein family, which is expressed in breast carcinoma.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Regnier CH, Tomasetto C, Moog-Lutz C, Chenard MP, Wendling C, Basset P, Rio MC", "reference": { "type": "PubMed", "id": "7592751", "url": "https://pubmed.ncbi.nlm.nih.gov/7592751" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7592751", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF-4 expression in epithelial progenitor cells. Analysis in normal adult, fetal, and tumor tissues.", "journal": "Am. J. Pathol.", "date": "1998", "authors": "Krajewska M, Krajewski S, Zapata JM, Van Arsdale T, Gascoyne RD, Berern K, McFadden D, Shabaik A, Hugh J, Reynolds A, Clevenger CV, Reed JC", "reference": { "type": "PubMed", "id": "9626059", "url": "https://pubmed.ncbi.nlm.nih.gov/9626059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BUZ4-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "TRAF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36941-1", "protein_name": "Tumor necrosis factor receptor superfamily member 3", "gene_name": "LTBR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BUZ4", "url": "https://www.uniprot.org/uniprotkb/Q9BUZ4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9626059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternative splice variants encoding unstable protein domains exist in the human brain.", "journal": "J. Mol. Biol.", "date": "2004", "authors": "Homma K, Kikuno RF, Nagase T, Ohara O, Nishikawa K", "reference": { "type": "PubMed", "id": "15491607", "url": "https://pubmed.ncbi.nlm.nih.gov/15491607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O60336-1", "protein_name": "Mitogen-activated protein kinase-binding protein 1", "gene_name": "MAPKBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T49-1", "protein_name": "Protein phosphatase 1 regulatory inhibitor subunit 16B", "gene_name": "PPP1R16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92614-1", "protein_name": "Unconventional myosin-XVIIIa", "gene_name": "MYO18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP78-1", "protein_name": "ABC-type oligopeptide transporter ABCB9", "gene_name": "ABCB9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14155-4", "protein_name": "Rho guanine nucleotide exchange factor 7", "gene_name": "ARHGEF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94856-1", "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10586-1", "protein_name": "Receptor-type tyrosine-protein phosphatase F", "gene_name": "PTPRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60336", "url": "https://www.uniprot.org/uniprotkb/O60336" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15491607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The c-Jun N-terminal kinase (JNK)-binding protein (JNKBP1) acts as a negative regulator of NOD2 protein signaling by inhibiting its oligomerization process.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Lecat A, Di Valentin E, Somja J, Jourdan S, Fillet M, Kufer TA, Habraken Y, Sadzot C, Louis E, Delvenne P, Piette J, Legrand-Poels S", "reference": { "type": "PubMed", "id": "22700971", "url": "https://pubmed.ncbi.nlm.nih.gov/22700971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O60336-1", "protein_name": "Mitogen-activated protein kinase-binding protein 1", "gene_name": "MAPKBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60336", "url": "https://www.uniprot.org/uniprotkb/O60336" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22700971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and analysis of a novel dimerization domain shared by various members of c-Jun N-terminal kinase (JNK) scaffold proteins.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Cohen-Katsenelson K, Wasserman T, Darlyuk-Saadon I, Rabner A, Glaser F, Aronheim A", "reference": { "type": "PubMed", "id": "23341463", "url": "https://pubmed.ncbi.nlm.nih.gov/23341463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O60336-1", "protein_name": "Mitogen-activated protein kinase-binding protein 1", "gene_name": "MAPKBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43379-1", "protein_name": "WD repeat-containing protein 62", "gene_name": "WDR62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60336", "url": "https://www.uniprot.org/uniprotkb/O60336" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23341463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in MAPKBP1 Cause Juvenile or Late-Onset Cilia-Independent Nephronophthisis.", "journal": "American journal of human genetics", "date": "2017", "authors": "Macia MS, Halbritter J, Delous M, Bredrup C, Gutter A, Filhol E, Mellgren AEC, Leh S, Bizet A, Braun DA, Gee HY, Silbermann F, Henry C, Krug P, Bole-Feysot C, Nitschke P, Joly D, Nicoud P, Paget A, Haugland H, Brackmann D, Ahmet N, Sandford R, Cengiz N, Knappskog PM, Boman H, Linghu B, Yang F, Oakeley EJ, Saint Mezard P, Sailer AW, Johansson S, Rodahl E, Saunier S, Hildebrandt F, Benmerah A", "reference": { "type": "PubMed", "id": "28089251", "url": "https://pubmed.ncbi.nlm.nih.gov/28089251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O60336-1", "protein_name": "Mitogen-activated protein kinase-binding protein 1", "gene_name": "MAPKBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45984-1", "protein_name": "Mitogen-activated protein kinase 9", "gene_name": "MAPK9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43379-1", "protein_name": "WD repeat-containing protein 62", "gene_name": "WDR62", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS57-1", "protein_name": "Mitogen-activated protein kinase-binding protein 1", "gene_name": "Mapkbp1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60336", "url": "https://www.uniprot.org/uniprotkb/O60336" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28089251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel nephronophthisis-associated variants reveal functional importance of MAPKBP1 dimerization for centriolar recruitment.", "journal": "Kidney international", "date": "2020", "authors": "Schonauer R, Jin W, Ertel A, Nemitz-Kliemchen M, Panitz N, Hantmann E, Seidel A, Braun DA, Shril S, Hansen M, Shahzad K, Sandford R, Saunier S, Benmerah A, Bergmann C, Hildebrandt F, Halbritter J", "reference": { "type": "PubMed", "id": "32505465", "url": "https://pubmed.ncbi.nlm.nih.gov/32505465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O60336-1", "protein_name": "Mitogen-activated protein kinase-binding protein 1", "gene_name": "MAPKBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60336", "url": "https://www.uniprot.org/uniprotkb/O60336" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32505465", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Low frequency of ankyrin mutations in hereditary spherocytosis: identification of three novel mutations.", "journal": "Human mutation", "date": "2000", "authors": "Leite RC, Basseres DS, Ferreira JS, Alberto FL, Costa FF, Saad ST", "reference": { "type": "PubMed", "id": "11102985", "url": "https://pubmed.ncbi.nlm.nih.gov/11102985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11102985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The neural cell recognition molecule neurofascin interacts with syntenin-1 but not with syntenin-2, both of which reveal self-associating activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Koroll M, Rathjen FG, Volkmer H", "reference": { "type": "PubMed", "id": "11152476", "url": "https://pubmed.ncbi.nlm.nih.gov/11152476" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92823-1", "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12860-1", "protein_name": "Contactin-1", "gene_name": "CNTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JI92-1", "protein_name": "Syntenin-1", "gene_name": "Sdcbp", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P78357-1", "protein_name": "Contactin-associated protein 1", "gene_name": "CNTNAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43602-1", "protein_name": "Neuronal migration protein doublecortin", "gene_name": "DCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94856-1", "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KLN0-1", "protein_name": "Syntenin-2", "gene_name": "Sdcbp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O00560-1", "protein_name": "Syntenin-1", "gene_name": "SDCBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H190-1", "protein_name": "Syntenin-2", "gene_name": "SDCBP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11152476", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The hydrophilic domain of small ankyrin-1 interacts with the two N-terminal immunoglobulin domains of titin.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kontrogianni-Konstantopoulos Aikaterini, Bloch Robert J", "reference": { "type": "PubMed", "id": "12444090", "url": "https://pubmed.ncbi.nlm.nih.gov/12444090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WZ42-1", "protein_name": "Titin", "gene_name": "TTN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12444090", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of a 12 ANK repeat stack from human ankyrinR.", "journal": "The EMBO journal", "date": "2002-12-02", "authors": "Michaely Peter, Tomchick Diana R, Machius Mischa, Anderson Richard G W", "reference": { "type": "PubMed", "id": "12456646", "url": "https://pubmed.ncbi.nlm.nih.gov/12456646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12456646", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of an ankyrin-1 isoform to obscurin suggests a molecular link between the sarcoplasmic reticulum and myofibrils in striated muscles.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Bagnato P, Barone V, Giacomello E, Rossi D, Sorrentino V", "reference": { "type": "PubMed", "id": "12527750", "url": "https://pubmed.ncbi.nlm.nih.gov/12527750" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VST9-1", "protein_name": "Obscurin", "gene_name": "OBSCN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1824, "end_pos": 1824, "sequence_org": "T", "sequence_mut": "P", "comment": "Abolishes interaction with OBSCN (in isoform Mu17).", "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" }, { "database": "PubMed", "id": "12527750", "url": "https://pubmed.ncbi.nlm.nih.gov/12527750" } ], "uniprot_canonical_ac": "P16157-1" }, { "start_pos": 1826, "end_pos": 1826, "sequence_org": "K", "sequence_mut": "E", "comment": "Abolishes interaction with OBSCN (in isoform Mu17).", "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" }, { "database": "PubMed", "id": "12527750", "url": "https://pubmed.ncbi.nlm.nih.gov/12527750" } ], "uniprot_canonical_ac": "P16157-1" }, { "start_pos": 1829, "end_pos": 1829, "sequence_org": "R", "sequence_mut": "G", "comment": "Abolishes interaction with OBSCN (in isoform Mu17).", "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" }, { "database": "PubMed", "id": "12527750", "url": "https://pubmed.ncbi.nlm.nih.gov/12527750" } ], "uniprot_canonical_ac": "P16157-1" }, { "start_pos": 1830, "end_pos": 1830, "sequence_org": "K", "sequence_mut": "E", "comment": "Abolishes interaction with OBSCN (in isoform Mu17).", "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" }, { "database": "PubMed", "id": "12527750", "url": "https://pubmed.ncbi.nlm.nih.gov/12527750" } ], "uniprot_canonical_ac": "P16157-1" } ], "record_id": "pubmed.12527750", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA sequence for human erythrocyte ankyrin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Lambert S, Yu H, Prchal JT, Lawler J, Ruff P, Speicher D, Cheung MC, Kan YW, Palek J", "reference": { "type": "PubMed", "id": "1689849", "url": "https://pubmed.ncbi.nlm.nih.gov/1689849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1689849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Site-specific GlcNAcylation of human erythrocyte proteins: potential biomarker(s) for diabetes.", "journal": "Diabetes", "date": "2009", "authors": "Wang Z, Park K, Comer F, Hsieh-Wilson LC, Saudek CD, Hart GW", "reference": { "type": "PubMed", "id": "18984734", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78417-1", "protein_name": "Glutathione S-transferase omega-1", "gene_name": "GSTO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99808-1", "protein_name": "Equilibrative nucleoside transporter 1", "gene_name": "SLC29A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y226-1", "protein_name": "Solute carrier family 22 member 13", "gene_name": "SLC22A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04406-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase", "gene_name": "GAPDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75882-1", "protein_name": "Attractin", "gene_name": "ATRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00915-1", "protein_name": "Carbonic anhydrase 1", "gene_name": "CA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5C9Z4-1", "protein_name": "Nucleolar MIF4G domain-containing protein 1", "gene_name": "NOM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32119-1", "protein_name": "Peroxiredoxin-2", "gene_name": "PRDX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11166-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 1", "gene_name": "SLC2A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29972-1", "protein_name": "Aquaporin-1", "gene_name": "AQP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11171-1", "protein_name": "Protein 4.1", "gene_name": "EPB41", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16452-1", "protein_name": "Protein 4.2", "gene_name": "EPB42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00918-1", "protein_name": "Carbonic anhydrase 2", "gene_name": "CA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02042-1", "protein_name": "Hemoglobin subunit delta", "gene_name": "HBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PI47-1", "protein_name": "BTB/POZ domain-containing protein KCTD18", "gene_name": "KCTD18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75167-1", "protein_name": "Phosphatase and actin regulator 2", "gene_name": "PHACTR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28066-1", "protein_name": "Proteasome subunit alpha type-5", "gene_name": "PSMA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7G8-1", "protein_name": "Intermembrane lipid transfer protein VPS13B", "gene_name": "VPS13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13716-1", "protein_name": "Delta-aminolevulinic acid dehydratase", "gene_name": "ALAD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13798-1", "protein_name": "Acylamino-acid-releasing enzyme", "gene_name": "APEH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11217-1", "protein_name": "Glycogen phosphorylase, muscle form", "gene_name": "PYGM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00352-1", "protein_name": "Aldehyde dehydrogenase 1A1", "gene_name": "ALDH1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37840-1", "protein_name": "Alpha-synuclein", "gene_name": "SNCA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1162, "start_aa": "Ser", "end_pos": 1162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1162", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P16157", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16157" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P16157", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16157" }, { "id": "2881", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2881" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P16157-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 288, "start_aa": "Ser", "end_pos": 288, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser288", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P16157", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16157" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P16157", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16157" }, { "id": "2881", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2881" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P16157-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 794, "start_aa": "Ser", "end_pos": 794, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser794", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P16157", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16157" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P16157", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16157" }, { "id": "2881", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2881" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P16157-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 960, "start_aa": "Ser", "end_pos": 960, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser960", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P16157", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16157" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P16157", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16157" }, { "id": "2881", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2881" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P16157-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 13, "start_aa": "Ser", "end_pos": 13, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser13", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P78417", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P78417" }, { "id": "32870666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32870666" }, { "id": "40930100", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40930100" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P78417", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P78417" }, { "id": "2854", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2854" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P78417-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "Q99808", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q99808" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "Q99808", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q99808" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" }, { "id": "1219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1219" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q99808-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "Q9Y226", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y226" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9Y226-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 210, "start_aa": "Ser", "end_pos": 210, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser210", "evidence": [ { "id": "21300897", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21300897" }, { "id": "P04406", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04406" }, { "id": "24126823", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24126823" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "23332158", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23332158" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "23576270", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23576270" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "34931806", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34931806" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "18369606", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18369606" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "39990658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39990658" }, { "id": "P04406", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04406" }, { "id": "31373491", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31373491" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P04406-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 83, "start_aa": "Ser", "end_pos": 83, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser83", "evidence": [ { "id": "21300897", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21300897" }, { "id": "P04406", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04406" }, { "id": "24126823", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24126823" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "23332158", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23332158" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "23576270", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23576270" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "34931806", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34931806" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "18369606", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18369606" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "39990658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39990658" }, { "id": "P04406", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04406" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P04406-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02730", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02730" }, { "id": "P02730", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02730" }, { "id": "1024", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1024" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02730-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 224, "start_aa": "Ser", "end_pos": 224, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser224", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02730", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02730" }, { "id": "P02730", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02730" }, { "id": "1024", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1024" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02730-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 745, "start_aa": "Ser", "end_pos": 745, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser745", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02730", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02730" }, { "id": "P02730", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02730" }, { "id": "1024", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1024" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02730-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 733, "start_aa": "Ser", "end_pos": 733, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser733", "evidence": [ { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "O75882", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75882" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "O75882", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75882" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O75882-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 735, "start_aa": "Ser", "end_pos": 735, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser735", "evidence": [ { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "O75882", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75882" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "O75882", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75882" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O75882-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 130, "start_aa": "Ser", "end_pos": 130, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser130", "evidence": [ { "id": "24126823", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24126823" }, { "id": "P00915", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P00915", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P00915" }, { "id": "2846", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2846" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00915-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 218, "start_aa": "Ser", "end_pos": 218, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser218", "evidence": [ { "id": "24126823", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24126823" }, { "id": "P00915", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00915" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P00915", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P00915" }, { "id": "2846", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2846" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00915-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 114, "start_aa": "Ser", "end_pos": 114, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser114", "evidence": [ { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "P04040", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04040" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "P04040", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04040" }, { "id": "1925", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1925" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04040-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 254, "start_aa": "Ser", "end_pos": 254, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser254", "evidence": [ { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "P04040", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04040" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "P04040", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04040" }, { "id": "1925", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1925" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P04040-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 28, "start_aa": "Thr", "end_pos": 28, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr28", "evidence": [ { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "P04040", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04040" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "32938750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32938750" }, { "id": "P04040", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04040" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04040-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "P04040", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04040" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P04040-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "Q5C9Z4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5C9Z4" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "25367160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25367160" }, { "id": "Q5C9Z4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q5C9Z4" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q5C9Z4-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 653, "start_aa": "Thr", "end_pos": 653, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr653", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "Q5C9Z4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5C9Z4" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "25367160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25367160" }, { "id": "Q5C9Z4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q5C9Z4" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q5C9Z4-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 112, "start_aa": "Ser", "end_pos": 112, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser112", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P32119", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P32119" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "P32119", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P32119" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P32119-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 18, "start_aa": "Thr", "end_pos": 18, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr18", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P32119", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P32119" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "P32119", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P32119" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P32119-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 76, "start_aa": "Ser", "end_pos": 76, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser76", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P32119", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P32119" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P32119-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 79, "start_aa": "Ser", "end_pos": 79, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser79", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P32119", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P32119" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P32119-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 82, "start_aa": "Thr", "end_pos": 82, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr82", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P32119", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P32119" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P32119-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1297, "start_aa": "Ser", "end_pos": 1297, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1297", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11277", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11277" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P11277", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11277" }, { "id": "2860", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2860" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P11277-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1652, "start_aa": "Ser", "end_pos": 1652, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1652", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11277", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11277" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P11277", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11277" }, { "id": "2860", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2860" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11277-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1928, "start_aa": "Thr", "end_pos": 1928, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1928", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11277", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11277" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P11277", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11277" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11277-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1936, "start_aa": "Ser", "end_pos": 1936, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1936", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11277", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11277" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P11277", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11277" }, { "id": "2860", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2860" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11277-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 671, "start_aa": "Ser", "end_pos": 671, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser671", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11277", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11277" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P11277", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11277" }, { "id": "2860", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2860" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11277-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 767, "start_aa": "Ser", "end_pos": 767, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser767", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11277", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11277" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P11277", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11277" }, { "id": "2860", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2860" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P11277-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 465, "start_aa": "Ser", "end_pos": 465, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser465", "evidence": [ { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "P11166", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11166" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "41018975", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41018975" }, { "id": "40367522", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40367522" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "P11166", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11166" }, { "id": "573", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/573" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P11166-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 236, "start_aa": "Ser", "end_pos": 236, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser236", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P29972", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P29972" }, { "id": "P29972", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P29972" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P29972-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1250, "start_aa": "Ser", "end_pos": 1250, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1250", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P02549", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02549" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02549", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02549" }, { "id": "2880", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2880" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02549-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1737, "start_aa": "Ser", "end_pos": 1737, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1737", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "2880", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2880" } ], "filter_code": "000000000000000100000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02549-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1738, "start_aa": "Ser", "end_pos": 1738, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1738", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P02549", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02549" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02549", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02549" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02549-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 844, "start_aa": "Ser", "end_pos": 844, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser844", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "P02549", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02549" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02549", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P02549" }, { "id": "2880", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2880" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02549-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 491, "start_aa": "Ser", "end_pos": 491, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser491", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P11171", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11171" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "2808371", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2808371" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11171", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11171" }, { "id": "515", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/515" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11171-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 760, "start_aa": "Thr", "end_pos": 760, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr760", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "P11171", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11171" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "2808371", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2808371" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P11171", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11171" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11171-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 134, "start_aa": "Ser", "end_pos": 134, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser134", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P69905", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P69905" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "P69905", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P69905" }, { "id": "2851", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2851" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P69905-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 36, "start_aa": "Ser", "end_pos": 36, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser36", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P69905", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P69905" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "P69905", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P69905" }, { "id": "2851", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2851" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P69905-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 4, "start_aa": "Ser", "end_pos": 4, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser4", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P69905", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P69905" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "P69905", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P69905" }, { "id": "2851", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2851" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P69905-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 68, "start_aa": "Thr", "end_pos": 68, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr68", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P69905", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P69905" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P69905-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 82, "start_aa": "Ser", "end_pos": 82, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser82", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P69905", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P69905" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P69905-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 85, "start_aa": "Ser", "end_pos": 85, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser85", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P69905", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P69905" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P69905-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P07900", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07900" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "26853435", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26853435" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "22967762", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22967762" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "39990658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39990658" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07900-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 181, "start_aa": "Ser", "end_pos": 181, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser181", "evidence": [ { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "Q06830", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q06830" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "16408927", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "Q06830", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q06830" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q06830-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 82, "start_aa": "Ser", "end_pos": 82, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser82", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P16452", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P16452" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "P16452", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P16452" }, { "id": "2894", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2894" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P16452-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "P00918", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00918" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P00918-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P02042", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02042" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02042-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 183, "start_aa": "Ser", "end_pos": 183, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser183", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "Q6PI47", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PI47" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "29485866", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29485866" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "37541260", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" }, { "id": "Q6PI47", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PI47" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q6PI47-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 292, "start_aa": "Ser", "end_pos": 292, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser292", "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "Q6PI47", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6PI47" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "29485866", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29485866" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "32938750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32938750" }, { "id": "Q6PI47", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q6PI47" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q6PI47-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 50, "start_aa": "Ser", "end_pos": 50, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser50", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P68871", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68871" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "P68871", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68871" }, { "id": "2875", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2875" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P68871-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 73, "start_aa": "Ser", "end_pos": 73, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser73", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P68871", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68871" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "P68871", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68871" }, { "id": "2875", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2875" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P68871-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 85, "start_aa": "Thr", "end_pos": 85, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr85", "evidence": [ { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "P68871", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P68871" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "P68871", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P68871" }, { "id": "2875", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2875" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P68871-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "O75167", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75167" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O75167-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 198, "start_aa": "Ser", "end_pos": 198, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser198", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P28066", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P28066" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "P28066", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P28066" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P28066-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 63, "start_aa": "Ser", "end_pos": 63, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser63", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P28066", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P28066" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "P28066", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P28066" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P28066-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 6, "start_aa": "Ser", "end_pos": 6, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser6", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P28066", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P28066" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "26374642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26374642" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P28066-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 241, "start_aa": "Thr", "end_pos": 241, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr241", "evidence": [ { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "Q7Z7G8", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q7Z7G8" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q7Z7G8-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P13716", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13716" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13716-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "36580660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36580660" }, { "id": "P13798", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13798" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P13798-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P11217", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11217" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P11217-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "P00352", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P00352" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "26853435", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26853435" }, { "id": "30905621", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30905621" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P00352-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 42, "start_aa": "Ser", "end_pos": 42, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser42", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 54, "start_aa": "Thr", "end_pos": 54, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr54", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" }, { "id": "P37840", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P37840" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 59, "start_aa": "Thr", "end_pos": 59, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr59", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 64, "start_aa": "Thr", "end_pos": 64, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr64", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" }, { "id": "P37840", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P37840" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 72, "start_aa": "Thr", "end_pos": 72, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr72", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 75, "start_aa": "Thr", "end_pos": 75, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr75", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 81, "start_aa": "Thr", "end_pos": 81, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr81", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P37840-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 87, "start_aa": "Ser", "end_pos": 87, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser87", "evidence": [ { "id": "39082221", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39082221" }, { "id": "P37840", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P37840" }, { "id": "28673834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28673834" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "41146299", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41146299" }, { "id": "31753312", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31753312" }, { "id": "18984734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18984734" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38351230", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38351230" }, { "id": "38347213", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38347213" }, { "id": "38047498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38047498" }, { "id": "P37840", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P37840" }, { "id": "2893", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2893" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P37840-1" } ], "record_id": "pubmed.18984734", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 75 }, { "field": "total_sites", "count": 75 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 75 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 75 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 66 }, { "field": "exact_o_linked_sites", "count": 66 }, { "field": "exact_o_linked_glycan_sites", "count": 66 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 9 }, { "field": "fuzzy_o_linked_sites", "count": 9 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 9 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 75 }, { "field": "total_sites", "count": 75 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 75 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 75 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 66 }, { "field": "exact_o_linked_sites", "count": 66 }, { "field": "exact_o_linked_glycan_sites", "count": 66 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 9 }, { "field": "fuzzy_o_linked_sites", "count": 9 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 9 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asparagine and aspartate hydroxylation of the cytoskeletal ankyrin family is catalyzed by factor-inhibiting hypoxia-inducible factor.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Yang M, Ge W, Chowdhury R, Claridge TD, Kramer HB, Schmierer B, McDonough MA, Gong L, Kessler BM, Ratcliffe PJ, Coleman ML, Schofield CJ", "reference": { "type": "PubMed", "id": "21177872", "url": "https://pubmed.ncbi.nlm.nih.gov/21177872" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWT6-1", "protein_name": "Hypoxia-inducible factor 1-alpha inhibitor", "gene_name": "HIF1AN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02357-1", "protein_name": "Ankyrin-1", "gene_name": "Ank1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 201, "end_pos": 201, "sequence_org": "D", "sequence_mut": "A", "comment": "Prevents suppression of HIFCAD activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9NWT6", "url": "https://www.uniprot.org/uniprotkb/Q9NWT6" }, { "database": "PubMed", "id": "18611856", "url": "https://pubmed.ncbi.nlm.nih.gov/18611856" }, { "database": "PubMed", "id": "21177872", "url": "https://pubmed.ncbi.nlm.nih.gov/21177872" }, { "database": "PubMed", "id": "12080085", "url": "https://pubmed.ncbi.nlm.nih.gov/12080085" } ], "uniprot_canonical_ac": "Q9NWT6-1" }, { "start_pos": 201, "end_pos": 201, "sequence_org": "D", "sequence_mut": "E", "comment": "Loss of HIF1AAsn hydroxylation activity. Slightly stimulates 2-oxoglutarate turnover.", "evidence": [ { "database": "UniProtKB", "id": "Q9NWT6", "url": "https://www.uniprot.org/uniprotkb/Q9NWT6" }, { "database": "PubMed", "id": "18611856", "url": "https://pubmed.ncbi.nlm.nih.gov/18611856" }, { "database": "PubMed", "id": "12080085", "url": "https://pubmed.ncbi.nlm.nih.gov/12080085" }, { "database": "PubMed", "id": "21177872", "url": "https://pubmed.ncbi.nlm.nih.gov/21177872" } ], "uniprot_canonical_ac": "Q9NWT6-1" }, { "start_pos": 201, "end_pos": 201, "sequence_org": "D", "sequence_mut": "G", "comment": "No impact on HIF1AAsn hydroxylation activity. Loss of Asp hydroxylation ability. Strongly stimulates 2-oxoglutarate turnover. Loss of HIF1AAsn hydroxylation activity and slight stimulation of 2-oxoglutarate turnover; when associated with R-296.", "evidence": [ { "database": "UniProtKB", "id": "Q9NWT6", "url": "https://www.uniprot.org/uniprotkb/Q9NWT6" }, { "database": "PubMed", "id": "18611856", "url": "https://pubmed.ncbi.nlm.nih.gov/18611856" }, { "database": "PubMed", "id": "21177872", "url": "https://pubmed.ncbi.nlm.nih.gov/21177872" }, { "database": "PubMed", "id": "12080085", "url": "https://pubmed.ncbi.nlm.nih.gov/12080085" } ], "uniprot_canonical_ac": "Q9NWT6-1" }, { "start_pos": 239, "end_pos": 239, "sequence_org": "Q", "sequence_mut": "H", "comment": "No effect on Asp hydroxylation ability.", "evidence": [ { "database": "UniProtKB", "id": "Q9NWT6", "url": "https://www.uniprot.org/uniprotkb/Q9NWT6" }, { "database": "PubMed", "id": "21177872", "url": "https://pubmed.ncbi.nlm.nih.gov/21177872" } ], "uniprot_canonical_ac": "Q9NWT6-1" } ], "record_id": "pubmed.21177872", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of cDNA for human erythrocyte ankyrin indicates a repeated structure with homology to tissue-differentiation and cell-cycle control proteins.", "journal": "Nature", "date": "1990", "authors": "Lux S E, John K M, Bennett V", "reference": { "type": "PubMed", "id": "2137557", "url": "https://pubmed.ncbi.nlm.nih.gov/2137557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2137557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mapping the binding sites of human erythrocyte ankyrin for the anion exchanger and spectrin.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Davis L H, Bennett V", "reference": { "type": "PubMed", "id": "2141335", "url": "https://pubmed.ncbi.nlm.nih.gov/2141335" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2141335", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structurally similar but functionally diverse ZU5 domains in human erythrocyte ankyrin.", "journal": "J. Mol. Biol.", "date": "2012", "authors": "Yasunaga Mai, Ipsaro Jonathan J, Mondrag\u00f3n Alfonso", "reference": { "type": "PubMed", "id": "22310050", "url": "https://pubmed.ncbi.nlm.nih.gov/22310050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22310050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A protease cascade regulates release of the human malaria parasite Plasmodium falciparum from host red blood cells.", "journal": "Nature microbiology", "date": "2018", "authors": "Thomas JA, Tan MSY, Bisson C, Borg A, Umrekar TR, Hackett F, Hale VL, Vizcay-Barrena G, Fleck RA, Snijders AP, Saibil HR, Blackman MJ", "reference": { "type": "PubMed", "id": "29459732", "url": "https://pubmed.ncbi.nlm.nih.gov/29459732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29459732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Architecture of the human erythrocyte ankyrin-1 complex.", "journal": "Nature structural & molecular biology", "date": "2022-07", "authors": "Vallese Francesca, Kim Kookjoo, Yen Laura Y, Johnston Jake D, Noble Alex J, Cal\u00ec Tito, Clarke Oliver Biggs", "reference": { "type": "PubMed", "id": "35835865", "url": "https://pubmed.ncbi.nlm.nih.gov/35835865" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02094-1", "protein_name": "Ammonium transporter Rh type A", "gene_name": "RHAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18577-1", "protein_name": "Blood group Rh(CE) polypeptide", "gene_name": "RHCE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29972-1", "protein_name": "Aquaporin-1", "gene_name": "AQP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16452-1", "protein_name": "Protein 4.2", "gene_name": "EPB42", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7TVZ&bu=0&command=select+.B:642;+center+selection;+zoom+selection" }, "start_pos": 642, "start_aa": "Asn", "end_pos": 642, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn642", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02730#ptm_processing" }, { "id": "10861210", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10861210" }, { "id": "24121512", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24121512" }, { "id": "35835865", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35835865" }, { "id": "10364201", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10364201" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "10585855", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10585855" }, { "id": "11876646", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11876646" }, { "id": "16096263", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16096263" }, { "id": "10191257", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10191257" }, { "id": "7TVZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TVZ" }, { "id": "7TW0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TW0" }, { "id": "7TW2", "database": "PDB", "url": "https://www.rcsb.org/structure/7TW2" }, { "id": "7UZ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7UZ3" }, { "id": "7V07", "database": "PDB", "url": "https://www.rcsb.org/structure/7V07" }, { "id": "7V0K", "database": "PDB", "url": "https://www.rcsb.org/structure/7V0K" }, { "id": "8CS9", "database": "PDB", "url": "https://www.rcsb.org/structure/8CS9" }, { "id": "8CT3", "database": "PDB", "url": "https://www.rcsb.org/structure/8CT3" }, { "id": "8CTE", "database": "PDB", "url": "https://www.rcsb.org/structure/8CTE" }, { "id": "8T3R", "database": "PDB", "url": "https://www.rcsb.org/structure/8T3R" }, { "id": "8T3U", "database": "PDB", "url": "https://www.rcsb.org/structure/8T3U" }, { "id": "8T44", "database": "PDB", "url": "https://www.rcsb.org/structure/8T44" }, { "id": "8T45", "database": "PDB", "url": "https://www.rcsb.org/structure/8T45" }, { "id": "8T47", "database": "PDB", "url": "https://www.rcsb.org/structure/8T47" }, { "id": "9MNG", "database": "PDB", "url": "https://www.rcsb.org/structure/9MNG" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "P02730-1" } ], "record_id": "pubmed.35835865", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "A novel splicing mutation of ANK1 is associated with phenotypic heterogeneity of hereditary spherocytosis in a Chinese family.", "journal": "Biochimica et biophysica acta. Molecular basis of disease", "date": "2023-01-01", "authors": "Xu Linlin, Wei Xiaofeng, Liang Guanxia, Zhu Dina, Zhang Yanxia, Zhang Yang, Shang Xuan", "reference": { "type": "PubMed", "id": "36336297", "url": "https://pubmed.ncbi.nlm.nih.gov/36336297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36336297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeted next-generation sequencing identifies novel deleterious variants in ANK1 gene causing severe hereditary spherocytosis in Indian patients: expanding the molecular and clinical spectrum.", "journal": "Molecular genetics and genomics : MGG", "date": "2023-03", "authors": "More Tejashree Anil, Devendra Rati, Dongerdiye Rashmi, Warang Prashant, Kedar Prabhakar", "reference": { "type": "PubMed", "id": "36598564", "url": "https://pubmed.ncbi.nlm.nih.gov/36598564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36598564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "De novo variations of ANK1 gene caused hereditary spherocytosis in two Chinese children by affecting pre-mRNA splicing.", "journal": "BMC pediatrics", "date": "2023-01-16", "authors": "Wang Yang, Huang Lan, Zhu Yao, An Xizhou, Li Jiacheng, Zhen Jiangwei, Yu Jie", "reference": { "type": "PubMed", "id": "36647015", "url": "https://pubmed.ncbi.nlm.nih.gov/36647015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36647015", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sex differences of the shared genetic landscapes between type 2 diabetes and peripheral artery disease in East Asians and Europeans.", "journal": "Human genetics", "date": "2023-07", "authors": "Lu Zhiya, Zhang Haoyang, Yang Yuanhao, Zhao Huiying", "reference": { "type": "PubMed", "id": "37341850", "url": "https://pubmed.ncbi.nlm.nih.gov/37341850" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37341850", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Whole-genome sequencing identifies variants in ANK1, LRRN1, HAS1, and other genes and regulatory regions for stroke in type 1 diabetes.", "journal": "Scientific reports", "date": "2024-06-11", "authors": "Antikainen Anni A, Haukka Jani K, Kumar Anmol, Syreeni Anna, H\u00e4gg-Holmberg Stefanie, Ylinen Anni, Kilpel\u00e4inen Elina, Kyt\u00f6l\u00e4 Anastasia, Palotie Aarno, Putaala Jukka, Thorn Lena M, Harjutsalo Valma, Groop Per-Henrik, Sandholm Niina,", "reference": { "type": "PubMed", "id": "38862513", "url": "https://pubmed.ncbi.nlm.nih.gov/38862513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXK5-1", "protein_name": "Leucine-rich repeat neuronal protein 1", "gene_name": "LRRN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92839-1", "protein_name": "Hyaluronan synthase 1", "gene_name": "HAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38862513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ANK repeats of erythrocyte ankyrin form two distinct but cooperative binding sites for the erythrocyte anion exchanger.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Michaely P, Bennett V", "reference": { "type": "PubMed", "id": "7665627", "url": "https://pubmed.ncbi.nlm.nih.gov/7665627" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7665627", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ankyrin-1 mutations are a major cause of dominant and recessive hereditary spherocytosis.", "journal": "Nature genetics", "date": "1996", "authors": "Eber SW, Gonzalez JM, Lux ML, Scarpa AL, Tse WT, Dornwell M, Herbers J, Kugler W, Ozcan R, Pekrun A, Gallagher PG, Schroter W, Forget BG, Lux SE", "reference": { "type": "PubMed", "id": "8640229", "url": "https://pubmed.ncbi.nlm.nih.gov/8640229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8640229", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neurofascin induces neurites by heterophilic interactions with axonal NrCAM while NrCAM requires F11 on the axonal surface to extend neurites.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Volkmer H, Leuschner R, Zacharias U, Rathjen FG", "reference": { "type": "PubMed", "id": "8922386", "url": "https://pubmed.ncbi.nlm.nih.gov/8922386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92823-1", "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12860-1", "protein_name": "Contactin-1", "gene_name": "CNTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78357-1", "protein_name": "Contactin-associated protein 1", "gene_name": "CNTNAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43602-1", "protein_name": "Neuronal migration protein doublecortin", "gene_name": "DCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94856-1", "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00560-1", "protein_name": "Syntenin-1", "gene_name": "SDCBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8922386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and organization of the human ankyrin-1 gene. Basis for complexity of pre-mRNA processing.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Gallagher P G, Tse W T, Scarpa A L, Lux S E, Forget B G", "reference": { "type": "PubMed", "id": "9235914", "url": "https://pubmed.ncbi.nlm.nih.gov/9235914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9235914", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The phosphorylation state of the FIGQY tyrosine of neurofascin determines ankyrin-binding activity and patterns of cell segregation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Tuvia S, Garver TD, Bennett V", "reference": { "type": "PubMed", "id": "9371782", "url": "https://pubmed.ncbi.nlm.nih.gov/9371782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92823-1", "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12860-1", "protein_name": "Contactin-1", "gene_name": "CNTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78357-1", "protein_name": "Contactin-associated protein 1", "gene_name": "CNTNAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43602-1", "protein_name": "Neuronal migration protein doublecortin", "gene_name": "DCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94856-1", "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00560-1", "protein_name": "Syntenin-1", "gene_name": "SDCBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9371782", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An alternate promoter directs expression of a truncated, muscle-specific isoform of the human ankyrin 1 gene.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Gallagher PG, Forget BG", "reference": { "type": "PubMed", "id": "9430667", "url": "https://pubmed.ncbi.nlm.nih.gov/9430667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14500-1", "protein_name": "ATP-sensitive inward rectifier potassium channel 12", "gene_name": "KCNJ12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9430667", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural requirements for association of neurofascin with ankyrin.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang X, Davis JQ, Carpenter S, Bennett V", "reference": { "type": "PubMed", "id": "9804856", "url": "https://pubmed.ncbi.nlm.nih.gov/9804856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92823-1", "protein_name": "Neuronal cell adhesion molecule", "gene_name": "NRCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12860-1", "protein_name": "Contactin-1", "gene_name": "CNTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78357-1", "protein_name": "Contactin-associated protein 1", "gene_name": "CNTNAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43602-1", "protein_name": "Neuronal migration protein doublecortin", "gene_name": "DCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94856-1", "protein_name": "Neurofascin", "gene_name": "NFASC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00560-1", "protein_name": "Syntenin-1", "gene_name": "SDCBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16157", "url": "https://www.uniprot.org/uniprotkb/P16157" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9804856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two novel fusion genes, AIF1L-ETV6 and ABL1-AIF1L, result together with ETV6-ABL1 from a single chromosomal rearrangement in acute lymphoblastic leukemia with prenatal origin.", "journal": "Genes, chromosomes & cancer", "date": "2018", "authors": "Lukes J Jr, Potuckova E, Sramkova L, Stary J, Starkova J, Trka J, Votava F, Zuna J, Zaliova M", "reference": { "type": "PubMed", "id": "29726059", "url": "https://pubmed.ncbi.nlm.nih.gov/29726059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQI0-1", "protein_name": "Allograft inflammatory factor 1-like", "gene_name": "AIF1L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQI0", "url": "https://www.uniprot.org/uniprotkb/Q9BQI0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29726059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIF1L regulates actomyosin contractility and filopodial extensions in human podocytes.", "journal": "PloS one", "date": "2018", "authors": "Yasuda-Yamahara M, Rogg M, Yamahara K, Maier JI, Huber TB, Schell C", "reference": { "type": "PubMed", "id": "30001384", "url": "https://pubmed.ncbi.nlm.nih.gov/30001384" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQI0-1", "protein_name": "Allograft inflammatory factor 1-like", "gene_name": "AIF1L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQI0", "url": "https://www.uniprot.org/uniprotkb/Q9BQI0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30001384", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human homolog of Additional sex combs, additional sex combs-like 1, maps to chromosome 20q11.", "journal": "Gene", "date": "2003", "authors": "Fisher Cynthia L, Berger Joel, Randazzo Filippo, Brock Hugh W", "reference": { "type": "PubMed", "id": "12657473", "url": "https://pubmed.ncbi.nlm.nih.gov/12657473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12657473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations of polycomb-associated gene ASXL1 in myelodysplastic syndromes and chronic myelomonocytic leukaemia.", "journal": "Br. J. Haematol.", "date": "2009", "authors": "Gelsi-Boyer V\u00e9ronique, Trouplin Virginie, Ad\u00e9la\u00efde Jos\u00e9, Bonansea Julien, Cervera Nathalie, Carbuccia Nadine, Lagarde Arnaud, Prebet Thomas, Nezri Meyer, Sainty Danielle, Olschwang Sylviane, Xerri Luc, Chaffanet Max, Mozziconacci Marie-Jo\u00eblle, Vey Norbert, Birnbaum Daniel", "reference": { "type": "PubMed", "id": "19388938", "url": "https://pubmed.ncbi.nlm.nih.gov/19388938" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19388938", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ASXL1 represses retinoic acid receptor-mediated transcription through associating with HP1 and LSD1.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Lee Sang-Wang, Cho Yang-Sook, Na Jung-Min, Park Ui-Hyun, Kang Myengmo, Kim Eun-Joo, Um Soo-Jong", "reference": { "type": "PubMed", "id": "19880879", "url": "https://pubmed.ncbi.nlm.nih.gov/19880879" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83916-1", "protein_name": "Chromobox protein homolog 1", "gene_name": "CBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60341-1", "protein_name": "Lysine-specific histone demethylase 1A", "gene_name": "KDM1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59598-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "Asxl1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19880879", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Frequent mutation of the polycomb-associated gene ASXL1 in the myelodysplastic syndromes and in acute myeloid leukemia.", "journal": "Leukemia", "date": "2010", "authors": "Boultwood J, Perry J, Pellagatti A, Fernandez-Mercado M, Fernandez-Santamaria C, Calasanz M J, Larrayoz M J, Garcia-Delgado M, Giagounidis A, Malcovati L, Della Porta M G, J\u00e4dersten M, Killick S, Hellstr\u00f6m-Lindberg E, Cazzola M, Wainscoat J S", "reference": { "type": "PubMed", "id": "20182461", "url": "https://pubmed.ncbi.nlm.nih.gov/20182461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20182461", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "De novo nonsense mutations in ASXL1 cause Bohring-Opitz syndrome.", "journal": "Nat. Genet.", "date": "2011", "authors": "Hoischen Alexander, van Bon Bregje W M, Rodr\u00edguez-Santiago Benjam\u00edn, Gilissen Christian, Vissers Lisenka E L M, de Vries Petra, Janssen Irene, van Lier Bart, Hastings Rob, Smithson Sarah F, Newbury-Ecob Ruth, Kjaergaard Susanne, Goodship Judith, McGowan Ruth, Bartholdi Deborah, Rauch Anita, Peippo Maarit, Cobben Jan M, Wieczorek Dagmar, Gillessen-Kaesbach Gabriele, Veltman Joris A, Brunner Han G, de Vries Bert B B A", "reference": { "type": "PubMed", "id": "21706002", "url": "https://pubmed.ncbi.nlm.nih.gov/21706002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21706002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MBD5 and MBD6 interact with the human PR-DUB complex through their methyl-CpG-binding domain.", "journal": "Proteomics", "date": "2014", "authors": "Baymaz HI, Fournier A, Laget S, Ji Z, Jansen PW, Smits AH, Ferry L, Mensinga A, Poser I, Sharrocks A, Defossez PA, Vermeulen M", "reference": { "type": "PubMed", "id": "24634419", "url": "https://pubmed.ncbi.nlm.nih.gov/24634419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P85037-1", "protein_name": "Forkhead box protein K1", "gene_name": "FOXK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q76L83-1", "protein_name": "Putative Polycomb group protein ASXL2", "gene_name": "ASXL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DN6-1", "protein_name": "Methyl-CpG-binding domain protein 6", "gene_name": "MBD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P267-1", "protein_name": "Methyl-CpG-binding domain protein 5", "gene_name": "MBD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01167-1", "protein_name": "Forkhead box protein K2", "gene_name": "FOXK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24634419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel ASXL1-OGT axis plays roles in H3K4 methylation and tumor suppression in myeloid malignancies.", "journal": "Leukemia", "date": "2018", "authors": "Inoue D, Fujino T, Sheridan P, Zhang YZ, Nagase R, Horikawa S, Li Z, Matsui H, Kanai A, Saika M, Yamaguchi R, Kozuka-Hata H, Kawabata KC, Yokoyama A, Goyama S, Inaba T, Imoto S, Miyano S, Xu M, Yang FC, Oyama M, Kitamura T", "reference": { "type": "PubMed", "id": "29556021", "url": "https://pubmed.ncbi.nlm.nih.gov/29556021" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 199, "start_aa": "Ser", "end_pos": 199, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser199", "evidence": [ { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "Q8IXJ9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8IXJ9" }, { "id": "29556021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29556021" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "Q8IXJ9", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q8IXJ9" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q8IXJ9-1" } ], "record_id": "pubmed.29556021", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAP1 complex promotes transcription by opposing PRC1-mediated H2A ubiquitylation.", "journal": "Nature communications", "date": "2019", "authors": "Campagne A, Lee MK, Zielinski D, Michaud A, Le Corre S, Dingli F, Chen H, Shahidian LZ, Vassilev I, Servant N, Loew D, Pasmant E, Postel-Vinay S, Wassef M, Margueron R", "reference": { "type": "PubMed", "id": "30664650", "url": "https://pubmed.ncbi.nlm.nih.gov/30664650" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51610-1", "protein_name": "Host cell factor 1", "gene_name": "HCFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P85037-1", "protein_name": "Forkhead box protein K1", "gene_name": "FOXK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NB78-1", "protein_name": "Lysine-specific histone demethylase 2", "gene_name": "KDM1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q76L83-1", "protein_name": "Putative Polycomb group protein ASXL2", "gene_name": "ASXL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0F0-1", "protein_name": "Putative Polycomb group protein ASXL3", "gene_name": "ASXL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01167-1", "protein_name": "Forkhead box protein K2", "gene_name": "FOXK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30664650", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAP1/ASXL complex modulation regulates epithelial-mesenchymal transition during trophoblast differentiation and invasion.", "journal": "eLife", "date": "2021", "authors": "Perez-Garcia V, Lea G, Lopez-Jimenez P, Okkenhaug H, Burton GJ, Moffett A, Turco MY, Hemberger M", "reference": { "type": "PubMed", "id": "34170818", "url": "https://pubmed.ncbi.nlm.nih.gov/34170818" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59598-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "Asxl1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99PU7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "Bap1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34170818", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MBD5 and MBD6 stabilize the BAP1 complex and promote BAP1-dependent cancer.", "journal": "Genome biology", "date": "2022-09-30", "authors": "Tsuboyama Natsumi, Szczepanski Aileen Patricia, Zhao Zibo, Wang Lu", "reference": { "type": "PubMed", "id": "36180891", "url": "https://pubmed.ncbi.nlm.nih.gov/36180891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9V727-1", "protein_name": "Polycomb group protein Asx", "gene_name": "Asx", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7K5N4-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase calypso", "gene_name": "caly", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q76L83-1", "protein_name": "Putative Polycomb group protein ASXL2", "gene_name": "ASXL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0F0-1", "protein_name": "Putative Polycomb group protein ASXL3", "gene_name": "ASXL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DN6-1", "protein_name": "Methyl-CpG-binding domain protein 6", "gene_name": "MBD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P267-1", "protein_name": "Methyl-CpG-binding domain protein 5", "gene_name": "MBD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8JR92-1", "protein_name": "Methyl-CpG-binding domain protein 5/6 homolog sba", "gene_name": "sba", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 61, "end_pos": 61, "sequence_org": "K", "sequence_mut": "A", "comment": "Disrupts interaction with ASXL1/2/3; when associated with A-66.", "evidence": [ { "database": "UniProtKB", "id": "Q96DN6", "url": "https://www.uniprot.org/uniprotkb/Q96DN6" }, { "database": "PubMed", "id": "36180891", "url": "https://pubmed.ncbi.nlm.nih.gov/36180891" } ], "uniprot_canonical_ac": "Q96DN6-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "C", "sequence_mut": "A", "comment": "Disrupts interaction with ASXL1/2/3; when associated with A-61.", "evidence": [ { "database": "UniProtKB", "id": "Q96DN6", "url": "https://www.uniprot.org/uniprotkb/Q96DN6" }, { "database": "PubMed", "id": "36180891", "url": "https://pubmed.ncbi.nlm.nih.gov/36180891" } ], "uniprot_canonical_ac": "Q96DN6-1" } ], "record_id": "pubmed.36180891", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Basis of the H2AK119\u00a0specificity of the Polycomb repressive deubiquitinase.", "journal": "Nature", "date": "2023-04", "authors": "Ge Weiran, Yu Cong, Li Jingjing, Yu Zhenyu, Li Xiaorong, Zhang Yan, Liu Chao-Pei, Li Yingfeng, Tian Changlin, Zhang Xinzheng, Li Guohong, Zhu Bing, Xu Rui-Ming", "reference": { "type": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 262, "end_pos": 262, "sequence_org": "T", "sequence_mut": "W", "comment": "Reduced PR-DUB complex deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome, but no disruption of PR-DUB nucleosome association.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q8IXJ9-1" }, { "start_pos": 267, "end_pos": 267, "sequence_org": "L", "sequence_mut": "R", "comment": "Reduced PR-DUB complex deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome, but no disruption of PR-DUB nucleosome association.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q8IXJ9-1" }, { "start_pos": 56, "end_pos": 60, "sequence_org": "RRSRR", "sequence_mut": "AASAA", "comment": "Probably disrupts interaction with the histone H2A-H2B acidic patch. Severely attenuates deubiquitination of histone H2AK119ub1 substrates in the context of the nucleosome but does not disrupt nucleosome interaction.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 697, "end_pos": 729, "sequence_org": "SVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ", "sequence_mut": "", "comment": "Abolishes deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome, probably due to disruption of nucleosome interaction. Does not affect deubiquitination of H2AK119ub1 on free histones.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 699, "end_pos": 699, "sequence_org": "R", "sequence_mut": "W", "comment": "Slight or no reduction of deubiquitination efficiency towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 699, "end_pos": 702, "sequence_org": "RRRQ", "sequence_mut": "", "comment": "Severely reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome but only mildly disrupts nucleosome interaction.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 700, "end_pos": 700, "sequence_org": "R", "sequence_mut": "Q", "comment": "Slightly reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 701, "end_pos": 701, "sequence_org": "R", "sequence_mut": "C", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 702, "end_pos": 702, "sequence_org": "Q", "sequence_mut": "", "comment": "Slightly reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 703, "end_pos": 703, "sequence_org": "G", "sequence_mut": "P", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 703, "end_pos": 703, "sequence_org": "G", "sequence_mut": "R", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 708, "end_pos": 708, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 711, "end_pos": 718, "sequence_org": "KQRKPDRR", "sequence_mut": "", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome, probably due to disruption of nucleosome interaction. Does not affect deubiquitination of H2AK119ub1 on free histones.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 711, "end_pos": 729, "sequence_org": "KQRKPDRRKRSRPYKAKRQ", "sequence_mut": "", "comment": "Disrupts nucleosome interaction and abolishes deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome. Does not affect deubiquitination of H2AK119ub1 on free histones.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 713, "end_pos": 713, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 718, "end_pos": 729, "sequence_org": "RKRSRPYKAKRQ", "sequence_mut": "", "comment": "Disrupts nucleosome interaction and reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" } ], "uniprot_canonical_ac": "Q92560-1" } ], "record_id": "pubmed.36991118", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of histone H2A lysine 119 deubiquitination by Polycomb repressive deubiquitinase BAP1/ASXL1.", "journal": "Science advances", "date": "2023-08-09", "authors": "Thomas Jonathan F, Valencia-S\u00e1nchez Marco Igor, Tamburri Simone, Gloor Susan L, Rustichelli Samantha, God\u00ednez-L\u00f3pez Victoria, De Ioannes Pablo, Lee Rachel, Abini-Agbomson Stephen, Gretarsson Kristjan, Burg Jonathan M, Hickman Allison R, Sun Lu, Gopinath Saarang, Taylor Hailey F, Sun Zu-Wen, Ezell Ryan J, Vaidya Anup, Meiners Matthew J, Cheek Marcus A, Rice William J, Svetlov Vladimir, Nudler Evgeny, Lu Chao, Keogh Michael-Christopher, Pasini Diego, Armache Karim-Jean", "reference": { "type": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 243, "end_pos": 246, "sequence_org": "KRNR", "sequence_mut": "AANA", "comment": "Reduced PR-DUB complex deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome, but no disruption of PR-DUB nucleosome association.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q8IXJ9-1" }, { "start_pos": 336, "end_pos": 346, "sequence_org": "RIRQEMEKEKK", "sequence_mut": "AIAQEMEAEAA", "comment": "Reduced PR-DUB complex deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome, but no disruption of PR-DUB nucleosome association.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q8IXJ9-1" }, { "start_pos": 56, "end_pos": 56, "sequence_org": "R", "sequence_mut": "C", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 56, "end_pos": 60, "sequence_org": "RRSRR", "sequence_mut": "AASAA", "comment": "Probably disrupts interaction with the histone H2A-H2B acidic patch. Severely attenuates deubiquitination of histone H2AK119ub1 substrates in the context of the nucleosome but does not disrupt nucleosome interaction.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 59, "end_pos": 59, "sequence_org": "R", "sequence_mut": "W", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 699, "end_pos": 699, "sequence_org": "R", "sequence_mut": "W", "comment": "Slight or no reduction of deubiquitination efficiency towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 699, "end_pos": 700, "sequence_org": "RR", "sequence_mut": "DD", "comment": "Reduced nucleosomal binding.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 699, "end_pos": 701, "sequence_org": "RRR", "sequence_mut": "AAA", "comment": "Reduced nucleosomal binding.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" }, { "start_pos": 701, "end_pos": 701, "sequence_org": "R", "sequence_mut": "C", "comment": "Reduces deubiquitination activity towards H2AK119ub1 substrates in the context of the nucleosome.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "36991118", "url": "https://pubmed.ncbi.nlm.nih.gov/36991118" }, { "database": "PubMed", "id": "37556531", "url": "https://pubmed.ncbi.nlm.nih.gov/37556531" } ], "uniprot_canonical_ac": "Q92560-1" } ], "record_id": "pubmed.37556531", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive genomic profiling reveals molecular subsets of ASXL1-mutated myeloid neoplasms.", "journal": "Leukemia & lymphoma", "date": "2023-11-03", "authors": "Johnson Steven M, Haberberger James, Galeotti Jonathan, Ramkissoon Lori, Coombs Catherine C, Richardson Daniel R, Foster Matthew C, Duncan Daniel, Montgomery Nathan D, Ferguson Naomi L, Zeidner Joshua F", "reference": { "type": "PubMed", "id": "37921062", "url": "https://pubmed.ncbi.nlm.nih.gov/37921062" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37921062", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clonal haematopoiesis of indeterminate potential and atrial fibrillation: an east Asian cohort study.", "journal": "European heart journal", "date": "2024-01-17", "authors": "Ahn Hyo-Jeong, An Hong Yul, Ryu Gangpyo, Lim Jiwoo, Sun Choonghyun, Song Han, Choi Su-Yeon, Lee Heesun, Maurer Taylor, Nachun Daniel, Kwon Soonil, Lee So-Ryoung, Lip Gregory Y H, Oh Seil, Jaiswal Siddhartha, Koh Youngil, Choi Eue-Keun", "reference": { "type": "PubMed", "id": "38231881", "url": "https://pubmed.ncbi.nlm.nih.gov/38231881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38231881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altered erythropoiesis via JAK2 and ASXL1 mutations in myeloproliferative neoplasms.", "journal": "Experimental hematology", "date": "2024-04", "authors": "Collins Taylor B, Laranjeira Angelo B A, Kong Tim, Fulbright Mary C, Fisher Daniel A C, Sturgeon Christopher M, Batista Luis F Z, Oh Stephen T", "reference": { "type": "PubMed", "id": "38340948", "url": "https://pubmed.ncbi.nlm.nih.gov/38340948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38340948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human ASXL1-Mutant Hematopoiesis Is Driven by a Truncated Protein Associated with Aberrant Deubiquitination of H2AK119.", "journal": "Blood cancer discovery", "date": "2024-05-01", "authors": "K\u00f6hnke Thomas, Nuno Kevin A, Alder Catherine C, Gars Eric J, Phan Paul, Fan Amy C, Majeti Ravindra", "reference": { "type": "PubMed", "id": "38359087", "url": "https://pubmed.ncbi.nlm.nih.gov/38359087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38359087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Relationship between DTA Mutations and Thromboembolism in Patients with Myeloproliferative Neoplasms].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2024-06", "authors": "Wang Min, Zhao Hong-Yu, Li Da-Qi, Chen Ping", "reference": { "type": "PubMed", "id": "38926973", "url": "https://pubmed.ncbi.nlm.nih.gov/38926973" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K1-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3A", "gene_name": "DNMT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6N021-1", "protein_name": "Methylcytosine dioxygenase TET2", "gene_name": "TET2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38926973", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdc42 and Rac1 regulate the interaction of IQGAP1 with beta-catenin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Fukata M, Kuroda S, Nakagawa M, Kawajiri A, Itoh N, Shoji I, Matsuura Y, Yonehara S, Fujisawa H, Kikuchi A, Kaibuchi K", "reference": { "type": "PubMed", "id": "10473551", "url": "https://pubmed.ncbi.nlm.nih.gov/10473551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30622-3", "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13576-1", "protein_name": "Ras GTPase-activating-like protein IQGAP2", "gene_name": "IQGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63261-1", "protein_name": "Actin, cytoplasmic 2", "gene_name": "ACTG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10473551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rac1 and Cdc42 capture microtubules through IQGAP1 and CLIP-170.", "journal": "Cell", "date": "2002", "authors": "Fukata M, Watanabe T, Noritake J, Nakagawa M, Yamaga M, Kuroda S, Matsuura Y, Iwamatsu A, Perez F, Kaibuchi K", "reference": { "type": "PubMed", "id": "12110184", "url": "https://pubmed.ncbi.nlm.nih.gov/12110184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30622-3", "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13576-1", "protein_name": "Ras GTPase-activating-like protein IQGAP2", "gene_name": "IQGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63261-1", "protein_name": "Actin, cytoplasmic 2", "gene_name": "ACTG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12110184", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rho GTPases have diverse effects on the organization of the actin filament system.", "journal": "The Biochemical journal", "date": "2004", "authors": "Aspenstrom P, Fransson A, Saras J", "reference": { "type": "PubMed", "id": "14521508", "url": "https://pubmed.ncbi.nlm.nih.gov/14521508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13153-1", "protein_name": "Serine/threonine-protein kinase PAK 1", "gene_name": "PAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X7-1", "protein_name": "ARF GTPase-activating protein GIT1", "gene_name": "GIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13177-1", "protein_name": "Serine/threonine-protein kinase PAK 2", "gene_name": "PAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUY9-1", "protein_name": "DEP domain-containing protein 1B", "gene_name": "DEPDC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L33-1", "protein_name": "Rho-related GTP-binding protein RhoV", "gene_name": "RHOV", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWW6-1", "protein_name": "Rho GTPase-activating protein 12", "gene_name": "ARHGAP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H792-1", "protein_name": "Inactive tyrosine-protein kinase PEAK1", "gene_name": "PEAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03001-7", "protein_name": "Dystonin", "gene_name": "DST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDM6-1", "protein_name": "Disks large homolog 5", "gene_name": "DLG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAA9-1", "protein_name": "Vang-like protein 1", "gene_name": "VANGL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06753-1", "protein_name": "Tropomyosin alpha-3 chain", "gene_name": "TPM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43303-1", "protein_name": "Centriolar coiled-coil protein of 110 kDa", "gene_name": "CCP110", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29317-1", "protein_name": "Ephrin type-A receptor 2", "gene_name": "EPHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXI1-1", "protein_name": "Mitochondrial Rho GTPase 2", "gene_name": "RHOT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXI2-1", "protein_name": "Mitochondrial Rho GTPase 1", "gene_name": "RHOT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYG5-1", "protein_name": "Partitioning defective 6 homolog beta", "gene_name": "PARD6B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00610-1", "protein_name": "Clathrin heavy chain 1", "gene_name": "CLTC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IW35-1", "protein_name": "Centrosomal protein of 97 kDa", "gene_name": "CEP97", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14155-4", "protein_name": "Rho guanine nucleotide exchange factor 7", "gene_name": "ARHGEF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KM6-1", "protein_name": "Zinc finger protein 512B", "gene_name": "ZNF512B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14161-1", "protein_name": "ARF GTPase-activating protein GIT2", "gene_name": "GIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RTY4-1", "protein_name": "Unconventional myosin-IXa", "gene_name": "MYO9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NNW5-1", "protein_name": "tRNA (34-2'-O)-methyltransferase regulator WDR6", "gene_name": "WDR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93008-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 9X", "gene_name": "USP9X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z6J0-1", "protein_name": "E3 ubiquitin-protein ligase SH3RF1", "gene_name": "SH3RF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67936-1", "protein_name": "Tropomyosin alpha-4 chain", "gene_name": "TPM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43396-1", "protein_name": "Thioredoxin-like protein 1", "gene_name": "TXNL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16584-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 11", "gene_name": "MAP3K11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96013-1", "protein_name": "Serine/threonine-protein kinase PAK 4", "gene_name": "PAK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPB6-1", "protein_name": "Partitioning defective 6 homolog alpha", "gene_name": "PARD6A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 13, "end_pos": 13, "sequence_org": "A", "sequence_mut": "V", "comment": "Causes constitutive activation inducing an aggregation of the mitochondrial network.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXI1", "url": "https://www.uniprot.org/uniprotkb/Q8IXI1" }, { "database": "PubMed", "id": "16630562", "url": "https://pubmed.ncbi.nlm.nih.gov/16630562" }, { "database": "PubMed", "id": "14521508", "url": "https://pubmed.ncbi.nlm.nih.gov/14521508" } ], "uniprot_canonical_ac": "Q8IXI1-1" }, { "start_pos": 13, "end_pos": 13, "sequence_org": "P", "sequence_mut": "V", "comment": "Causes constitutive activation inducing an aggregation of the mitochondrial network.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXI2", "url": "https://www.uniprot.org/uniprotkb/Q8IXI2" }, { "database": "PubMed", "id": "16630562", "url": "https://pubmed.ncbi.nlm.nih.gov/16630562" }, { "database": "PubMed", "id": "14521508", "url": "https://pubmed.ncbi.nlm.nih.gov/14521508" }, { "database": "PubMed", "id": "12482879", "url": "https://pubmed.ncbi.nlm.nih.gov/12482879" } ], "uniprot_canonical_ac": "Q8IXI2-1" } ], "record_id": "pubmed.14521508", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of IQGAP1 modulates its binding to Cdc42, revealing a new type of rho-GTPase regulator.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Grohmanova K, Schlaepfer D, Hess D, Gutierrez P, Beck M, Kroschewski R", "reference": { "type": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02156-1", "protein_name": "Protein kinase C epsilon type", "gene_name": "PRKCE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1443, "end_pos": 1443, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "21349850", "url": "https://pubmed.ncbi.nlm.nih.gov/21349850" } ], "site_lbl": "Ser1443", "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "kinase_uniprot_canonical_ac": "Q02156-1", "kinase_gene_name": "PRKCE", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, { "database": "PubMed", "id": "21349850", "url": "https://pubmed.ncbi.nlm.nih.gov/21349850" } ], "site_lbl": "Ser1443", "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCE", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "21349850", "url": "https://pubmed.ncbi.nlm.nih.gov/21349850" }, { "database": "PubMed", "id": "27815503", "url": "https://pubmed.ncbi.nlm.nih.gov/27815503" }, { "database": "PubMed", "id": "28739799", "url": "https://pubmed.ncbi.nlm.nih.gov/28739799" }, { "database": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser1443", "uniprot_canonical_ac": "P46940-1" } ], "record_id": "pubmed.15355962", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IQGAP1 promotes neurite outgrowth in a phosphorylation-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Li Z, McNulty DE, Marler KJ, Lim L, Hall C, Annan RS, Sacks DB", "reference": { "type": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1441, "end_pos": 1441, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes neurite outgrowth promoting activity; when associated with A-1443.", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" } ], "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1441, "end_pos": 1441, "sequence_org": "S", "sequence_mut": "E", "comment": "Strongly enhances neurite outgrowth promoting activity; when associated with A-1443.", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" } ], "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes neurite outgrowth promoting activity; when associated with A-1441.", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" } ], "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "sequence_org": "S", "sequence_mut": "D", "comment": "Strongly enhances neurite outgrowth promoting activity; when associated with A-1441.", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" } ], "uniprot_canonical_ac": "P46940-1" } ], "phosphorylation": [ { "start_pos": 1441, "end_pos": 1441, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "27815503", "url": "https://pubmed.ncbi.nlm.nih.gov/27815503" }, { "database": "PubMed", "id": "28739799", "url": "https://pubmed.ncbi.nlm.nih.gov/28739799" } ], "site_lbl": "Ser1441", "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "21349850", "url": "https://pubmed.ncbi.nlm.nih.gov/21349850" } ], "site_lbl": "Ser1443", "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "kinase_uniprot_canonical_ac": "Q02156-1", "kinase_gene_name": "PRKCE", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, { "database": "PubMed", "id": "21349850", "url": "https://pubmed.ncbi.nlm.nih.gov/21349850" } ], "site_lbl": "Ser1443", "uniprot_canonical_ac": "P46940-1" }, { "start_pos": 1443, "end_pos": 1443, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCE", "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" }, { "database": "iPTMnet", "id": "P46940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46940" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "15695813", "url": "https://pubmed.ncbi.nlm.nih.gov/15695813" }, { "database": "PubMed", "id": "21349850", "url": "https://pubmed.ncbi.nlm.nih.gov/21349850" }, { "database": "PubMed", "id": "27815503", "url": "https://pubmed.ncbi.nlm.nih.gov/27815503" }, { "database": "PubMed", "id": "28739799", "url": "https://pubmed.ncbi.nlm.nih.gov/28739799" }, { "database": "PubMed", "id": "15355962", "url": "https://pubmed.ncbi.nlm.nih.gov/15355962" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser1443", "uniprot_canonical_ac": "P46940-1" } ], "record_id": "pubmed.15695813", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophosphorylation-dependent degradation of Pak1, triggered by the Rho-family GTPase, Chp.", "journal": "The Biochemical journal", "date": "2007", "authors": "Weisz Hubsman M, Volinsky N, Manser E, Yablonski D, Aronheim A", "reference": { "type": "PubMed", "id": "17355222", "url": "https://pubmed.ncbi.nlm.nih.gov/17355222" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13153-1", "protein_name": "Serine/threonine-protein kinase PAK 1", "gene_name": "PAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X7-1", "protein_name": "ARF GTPase-activating protein GIT1", "gene_name": "GIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13177-1", "protein_name": "Serine/threonine-protein kinase PAK 2", "gene_name": "PAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUY9-1", "protein_name": "DEP domain-containing protein 1B", "gene_name": "DEPDC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L33-1", "protein_name": "Rho-related GTP-binding protein RhoV", "gene_name": "RHOV", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWW6-1", "protein_name": "Rho GTPase-activating protein 12", "gene_name": "ARHGAP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H792-1", "protein_name": "Inactive tyrosine-protein kinase PEAK1", "gene_name": "PEAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03001-7", "protein_name": "Dystonin", "gene_name": "DST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDM6-1", "protein_name": "Disks large homolog 5", "gene_name": "DLG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAA9-1", "protein_name": "Vang-like protein 1", "gene_name": "VANGL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06753-1", "protein_name": "Tropomyosin alpha-3 chain", "gene_name": "TPM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43303-1", "protein_name": "Centriolar coiled-coil protein of 110 kDa", "gene_name": "CCP110", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29317-1", "protein_name": "Ephrin type-A receptor 2", "gene_name": "EPHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYG5-1", "protein_name": "Partitioning defective 6 homolog beta", "gene_name": "PARD6B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00610-1", "protein_name": "Clathrin heavy chain 1", "gene_name": "CLTC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IW35-1", "protein_name": "Centrosomal protein of 97 kDa", "gene_name": "CEP97", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14155-4", "protein_name": "Rho guanine nucleotide exchange factor 7", "gene_name": "ARHGEF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KM6-1", "protein_name": "Zinc finger protein 512B", "gene_name": "ZNF512B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14161-1", "protein_name": "ARF GTPase-activating protein GIT2", "gene_name": "GIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RTY4-1", "protein_name": "Unconventional myosin-IXa", "gene_name": "MYO9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NNW5-1", "protein_name": "tRNA (34-2'-O)-methyltransferase regulator WDR6", "gene_name": "WDR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93008-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 9X", "gene_name": "USP9X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z6J0-1", "protein_name": "E3 ubiquitin-protein ligase SH3RF1", "gene_name": "SH3RF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67936-1", "protein_name": "Tropomyosin alpha-4 chain", "gene_name": "TPM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43396-1", "protein_name": "Thioredoxin-like protein 1", "gene_name": "TXNL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16584-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 11", "gene_name": "MAP3K11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96013-1", "protein_name": "Serine/threonine-protein kinase PAK 4", "gene_name": "PAK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPB6-1", "protein_name": "Partitioning defective 6 homolog alpha", "gene_name": "PARD6A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17355222", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of lamellipodia formation and cell invasion by CLIP-170 in invasive human breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Suzuki K, Takahashi K", "reference": { "type": "PubMed", "id": "18237546", "url": "https://pubmed.ncbi.nlm.nih.gov/18237546" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30622-3", "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13576-1", "protein_name": "Ras GTPase-activating-like protein IQGAP2", "gene_name": "IQGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63261-1", "protein_name": "Actin, cytoplasmic 2", "gene_name": "ACTG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18237546", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Menin interacts with IQGAP1 to enhance intercellular adhesion of beta-cells.", "journal": "Oncogene", "date": "2009", "authors": "Yan J, Yang Y, Zhang H, King C, Kan HM, Cai Y, Yuan CX, Bloom GS, Hua X", "reference": { "type": "PubMed", "id": "19079338", "url": "https://pubmed.ncbi.nlm.nih.gov/19079338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30622-3", "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13576-1", "protein_name": "Ras GTPase-activating-like protein IQGAP2", "gene_name": "IQGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63261-1", "protein_name": "Actin, cytoplasmic 2", "gene_name": "ACTG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19079338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rac1 activation inhibits E-cadherin-mediated adherens junctions via binding to IQGAP1 in pancreatic carcinoma cells.", "journal": "Cell communication and signaling : CCS", "date": "2009", "authors": "Hage B, Meinel K, Baum I, Giehl K, Menke A", "reference": { "type": "PubMed", "id": "19737400", "url": "https://pubmed.ncbi.nlm.nih.gov/19737400" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30622-3", "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "CLIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13576-1", "protein_name": "Ras GTPase-activating-like protein IQGAP2", "gene_name": "IQGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VI3-1", "protein_name": "Ras GTPase-activating-like protein IQGAP3", "gene_name": "IQGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63261-1", "protein_name": "Actin, cytoplasmic 2", "gene_name": "ACTG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19737400", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IQGAP1 translocates to the nucleus in early S-phase and contributes to cell cycle progression after DNA replication arrest.", "journal": "The international journal of biochemistry & cell biology", "date": "2011-01", "authors": "Johnson Michael, Sharma Manisha, Brocardo Mariana G, Henderson Beric R", "reference": { "type": "PubMed", "id": "20883816", "url": "https://pubmed.ncbi.nlm.nih.gov/20883816" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JKF1-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "Iqgap1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46940", "url": "https://www.uniprot.org/uniprotkb/P46940" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20883816", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]