[ { "title": "MELK aggravates lung adenocarcinoma by regulating EZH2 ubiquitination and H3K27me3 histone methylation of LATS2.", "journal": "Journal of cellular and molecular medicine", "date": "2024-04", "authors": "Yu Hui, Xu Xianrong, Zhu Lirong, Chen Shengjie, He Jincheng", "reference": { "type": "PubMed", "id": "38652219", "url": "https://pubmed.ncbi.nlm.nih.gov/38652219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NRM7-1", "protein_name": "Serine/threonine-protein kinase LATS2", "gene_name": "LATS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14680-1", "protein_name": "Maternal embryonic leucine zipper kinase", "gene_name": "MELK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NRM7", "url": "https://www.uniprot.org/uniprotkb/Q9NRM7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38652219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Ste20-like protein kinase, Mst1, dimerizes and contains an inhibitory domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Creasy CL, Ambrose DM, Chernoff J", "reference": { "type": "PubMed", "id": "8702870", "url": "https://pubmed.ncbi.nlm.nih.gov/8702870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NRM7-1", "protein_name": "Serine/threonine-protein kinase LATS2", "gene_name": "LATS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07157-1", "protein_name": "Tight junction protein 1", "gene_name": "TJP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13043-1", "protein_name": "Serine/threonine-protein kinase 4", "gene_name": "STK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H8S9-1", "protein_name": "MOB kinase activator 1A", "gene_name": "MOB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B6-1", "protein_name": "Protein salvador homolog 1", "gene_name": "SAV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13188-1", "protein_name": "Serine/threonine-protein kinase 3", "gene_name": "STK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UDY2-1", "protein_name": "Tight junction protein 2", "gene_name": "TJP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IX03-1", "protein_name": "Protein KIBRA", "gene_name": "WWC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75161-1", "protein_name": "Nephrocystin-4", "gene_name": "NPHP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14641-1", "protein_name": "Segment polarity protein dishevelled homolog DVL-2", "gene_name": "DVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY63-1", "protein_name": "Angiomotin-like protein 1", "gene_name": "AMOTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2J4-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "AMOTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95835-1", "protein_name": "Serine/threonine-protein kinase LATS1", "gene_name": "LATS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L9L4-1", "protein_name": "MOB kinase activator 1B", "gene_name": "MOB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31946-1", "protein_name": "14-3-3 protein beta/alpha", "gene_name": "YWHAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NRM7", "url": "https://www.uniprot.org/uniprotkb/Q9NRM7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8702870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caspase-mediated activation and induction of apoptosis by the mammalian Ste20-like kinase Mst1.", "journal": "The EMBO journal", "date": "1998", "authors": "Graves JD, Gotoh Y, Draves KE, Ambrose D, Han DK, Wright M, Chernoff J, Clark EA, Krebs EG", "reference": { "type": "PubMed", "id": "9545236", "url": "https://pubmed.ncbi.nlm.nih.gov/9545236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NRM7-1", "protein_name": "Serine/threonine-protein kinase LATS2", "gene_name": "LATS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07157-1", "protein_name": "Tight junction protein 1", "gene_name": "TJP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13043-1", "protein_name": "Serine/threonine-protein kinase 4", "gene_name": "STK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H8S9-1", "protein_name": "MOB kinase activator 1A", "gene_name": "MOB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B6-1", "protein_name": "Protein salvador homolog 1", "gene_name": "SAV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13188-1", "protein_name": "Serine/threonine-protein kinase 3", "gene_name": "STK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UDY2-1", "protein_name": "Tight junction protein 2", "gene_name": "TJP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IX03-1", "protein_name": "Protein KIBRA", "gene_name": "WWC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75161-1", "protein_name": "Nephrocystin-4", "gene_name": "NPHP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14641-1", "protein_name": "Segment polarity protein dishevelled homolog DVL-2", "gene_name": "DVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY63-1", "protein_name": "Angiomotin-like protein 1", "gene_name": "AMOTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2J4-1", "protein_name": "Angiomotin-like protein 2", "gene_name": "AMOTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95835-1", "protein_name": "Serine/threonine-protein kinase LATS1", "gene_name": "LATS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L9L4-1", "protein_name": "MOB kinase activator 1B", "gene_name": "MOB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31946-1", "protein_name": "14-3-3 protein beta/alpha", "gene_name": "YWHAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NRM7", "url": "https://www.uniprot.org/uniprotkb/Q9NRM7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q13043", "url": "https://www.uniprot.org/uniprotkb/Q13043" }, { "database": "PRO", "id": "Q13043", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13043" }, { "database": "iPTMnet", "id": "Q13043", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13043" }, { "database": "PubMed", "id": "11278283", "url": "https://pubmed.ncbi.nlm.nih.gov/11278283" }, { "database": "PubMed", "id": "9545236", "url": "https://pubmed.ncbi.nlm.nih.gov/9545236" } ], "site_lbl": "Thr183", "uniprot_canonical_ac": "Q13043-1" } ], "record_id": "pubmed.9545236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.", "journal": "Blood", "date": "1999", "authors": "Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD, Koeffler HP", "reference": { "type": "PubMed", "id": "10233885", "url": "https://pubmed.ncbi.nlm.nih.gov/10233885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10233885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCAAT/enhancer binding protein epsilon is a potential retinoid target gene in acute promyelocytic leukemia treatment.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Park DJ, Chumakov AM, Vuong PT, Chih DY, Gombart AF, Miller WH Jr, Koeffler HP", "reference": { "type": "PubMed", "id": "10330422", "url": "https://pubmed.ncbi.nlm.nih.gov/10330422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10330422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic structure of the human retinoic acid receptor-alpha1 gene.", "journal": "Mamm. Genome", "date": "1999", "authors": "Hjalt T A, Murray J C", "reference": { "type": "PubMed", "id": "10337631", "url": "https://pubmed.ncbi.nlm.nih.gov/10337631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10337631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serine 157, a retinoic acid receptor alpha residue phosphorylated by protein kinase C in vitro, is involved in RXR.RARalpha heterodimerization and transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Delmotte MH, Tahayato A, Formstecher P, Lefebvre P", "reference": { "type": "PubMed", "id": "10608897", "url": "https://pubmed.ncbi.nlm.nih.gov/10608897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "10608897", "url": "https://pubmed.ncbi.nlm.nih.gov/10608897" } ], "site_lbl": "Ser157", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.10608897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.", "journal": "EMBO J.", "date": "2000", "authors": "Rastinejad F, Wagner T, Zhao Q, Khorasanizadeh S", "reference": { "type": "PubMed", "id": "10698945", "url": "https://pubmed.ncbi.nlm.nih.gov/10698945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10698945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of a heterodimeric complex of RAR and RXR ligand-binding domains.", "journal": "Mol. Cell", "date": "2000", "authors": "Bourguet W, Vivat V, Wurtz J M, Chambon P, Gronemeyer H, Moras D", "reference": { "type": "PubMed", "id": "10882070", "url": "https://pubmed.ncbi.nlm.nih.gov/10882070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28700-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "Rxra", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10882070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dominant-negative mutations of CEBPA, encoding CCAAT/enhancer binding protein-alpha (C/EBPalpha), in acute myeloid leukemia.", "journal": "Nature genetics", "date": "2001", "authors": "Pabst T, Mueller BU, Zhang P, Radomska HS, Narravula S, Schnittger S, Behre G, Hiddemann W, Tenen DG", "reference": { "type": "PubMed", "id": "11242107", "url": "https://pubmed.ncbi.nlm.nih.gov/11242107" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11242107", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "c-Myc is a critical target for c/EBPalpha in granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Johansen LM, Iwama A, Lodie TA, Sasaki K, Felsher DW, Golub TR, Tenen DG", "reference": { "type": "PubMed", "id": "11340171", "url": "https://pubmed.ncbi.nlm.nih.gov/11340171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11340171", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCAAT/enhancer-binding protein-alpha cooperates with p21 to inhibit cyclin-dependent kinase-2 activity and induces growth arrest independent of DNA binding.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harris TE, Albrecht JH, Nakanishi M, Darlington GJ", "reference": { "type": "PubMed", "id": "11369759", "url": "https://pubmed.ncbi.nlm.nih.gov/11369759" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11369759", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.", "journal": "Molecular cell", "date": "2001", "authors": "Wang H, Iakova P, Wilde M, Welm A, Goode T, Roesler WJ, Timchenko NA", "reference": { "type": "PubMed", "id": "11684017", "url": "https://pubmed.ncbi.nlm.nih.gov/11684017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11684017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoic acid receptor alpha1 variants, RARalpha1DeltaB and RARalpha1DeltaBC, define a new class of nuclear receptor isoforms.", "journal": "Nucleic Acids Res.", "date": "2001", "authors": "Parrado A, Despouy G, Kra\u00efba R, Le Pogam C, Dupas S, Choquette M, Robledo M, Larghero J, Bui H, Le Gall I, Rochette-Egly C, Chomienne C, Padua R A", "reference": { "type": "PubMed", "id": "11812818", "url": "https://pubmed.ncbi.nlm.nih.gov/11812818" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11812818", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPalpha triggers proteasome-dependent degradation of cdk4 during growth arrest.", "journal": "The EMBO journal", "date": "2002", "authors": "Wang H, Goode T, Iakova P, Albrecht JH, Timchenko NA", "reference": { "type": "PubMed", "id": "11867521", "url": "https://pubmed.ncbi.nlm.nih.gov/11867521" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11867521", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "XPD mutations prevent TFIIH-dependent transactivation by nuclear receptors and phosphorylation of RARalpha.", "journal": "Cell", "date": "2002", "authors": "Keriel A, Stary A, Sarasin A, Rochette-Egly C, Egly JM", "reference": { "type": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P50613-1", "kinase_gene_name": "CDK7", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.11955452", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ERAP140, a conserved tissue-specific nuclear receptor coactivator.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Shao W, Halachmi S, Brown M", "reference": { "type": "PubMed", "id": "11971969", "url": "https://pubmed.ncbi.nlm.nih.gov/11971969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI08-1", "protein_name": "Nuclear receptor coactivator 7", "gene_name": "NCOA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37231-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "PPARG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6DFV7-1", "protein_name": "Nuclear receptor coactivator 7", "gene_name": "Ncoa7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P10828-1", "protein_name": "Thyroid hormone receptor beta", "gene_name": "THRB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 511, "end_pos": 517, "sequence_org": "LNIHEDL", "sequence_mut": "ANAHEDA", "comment": "No action on the E2-induced ESR1 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q8NI08", "url": "https://www.uniprot.org/uniprotkb/Q8NI08" }, { "database": "PubMed", "id": "11971969", "url": "https://pubmed.ncbi.nlm.nih.gov/11971969" } ], "uniprot_canonical_ac": "Q8NI08-1" }, { "start_pos": 522, "end_pos": 523, "sequence_org": "LI", "sequence_mut": "AA", "comment": "Abolishes completely the E2-induced ESR1 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q8NI08", "url": "https://www.uniprot.org/uniprotkb/Q8NI08" }, { "database": "PubMed", "id": "11971969", "url": "https://pubmed.ncbi.nlm.nih.gov/11971969" } ], "uniprot_canonical_ac": "Q8NI08-1" } ], "record_id": "pubmed.11971969", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Promoter of FGF8 reveals a unique regulation by unliganded RARalpha.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Brondani V, Klimkait T, Egly JM, Hamy F", "reference": { "type": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.12054865", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calreticulin interacts with C/EBPalpha and C/EBPbeta mRNAs and represses translation of C/EBP proteins.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Timchenko LT, Iakova P, Welm AL, Cai ZJ, Timchenko NA", "reference": { "type": "PubMed", "id": "12242300", "url": "https://pubmed.ncbi.nlm.nih.gov/12242300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12242300", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytogenetics, FISH and RT-PCR analysis of acute promyelocytic leukemia: structure of the fusion point in a case lacking classic t(15;17) translocation.", "journal": "Leuk. Lymphoma", "date": "2003", "authors": "Fujita Kazuhiro, Oba Remi, Harada Hiroshi, Mori Hiraku, Niikura Haruo, Isoyama Keiichi, Omine Mitsuhiro", "reference": { "type": "PubMed", "id": "12691149", "url": "https://pubmed.ncbi.nlm.nih.gov/12691149" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29590-1", "protein_name": "Protein PML", "gene_name": "PML", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12691149", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcription activation function of C/EBPalpha is required for induction of granulocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Keeshan K, Santilli G, Corradini F, Perrotti D, Calabretta B", "reference": { "type": "PubMed", "id": "12702500", "url": "https://pubmed.ncbi.nlm.nih.gov/12702500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12702500", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The amino terminal and E2F interaction domains are critical for C/EBP alpha-mediated induction of granulopoietic development of hematopoietic cells.", "journal": "Blood", "date": "2003", "authors": "D'Alo' F, Johansen LM, Nelson EA, Radomska HS, Evans EK, Zhang P, Nerlov C, Tenen DG", "reference": { "type": "PubMed", "id": "12869508", "url": "https://pubmed.ncbi.nlm.nih.gov/12869508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12869508", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Restoration of C/EBPalpha expression in a BCR-ABL+ cell line induces terminal granulocytic differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tavor S, Park DJ, Gery S, Vuong PT, Gombart AF, Koeffler HP", "reference": { "type": "PubMed", "id": "14517214", "url": "https://pubmed.ncbi.nlm.nih.gov/14517214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14517214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoid X receptor regulates Nur77/TR3-dependent apoptosis [corrected] by modulating its nuclear export and mitochondrial targeting.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Cao X, Liu W, Lin F, Li H, Kolluri SK, Lin B, Han YH, Dawson MI, Zhang XK", "reference": { "type": "PubMed", "id": "15509776", "url": "https://pubmed.ncbi.nlm.nih.gov/15509776" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22736-1", "protein_name": "Nuclear receptor subfamily 4immunitygroup A member 1", "gene_name": "NR4A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 357, "end_pos": 360, "sequence_org": "MRDM", "sequence_mut": "ARDA", "comment": "Abolishes nuclear export.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "15509776", "url": "https://pubmed.ncbi.nlm.nih.gov/15509776" } ], "uniprot_canonical_ac": "P19793-1" }, { "start_pos": 418, "end_pos": 430, "sequence_org": "LLLRLPALRSIGL", "sequence_mut": "ALARLPALRSIGA", "comment": "Abolishes nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "15509776", "url": "https://pubmed.ncbi.nlm.nih.gov/15509776" } ], "uniprot_canonical_ac": "P19793-1" } ], "record_id": "pubmed.15509776", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "c-Jun N-terminal kinase contributes to aberrant retinoid signaling in lung cancer cells by phosphorylating and inducing proteasomal degradation of retinoic acid receptor alpha.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Srinivas H, Juroske DM, Kalyankrishna S, Cody DD, Price RE, Xu XC, Narayanan R, Weigel NL, Kurie JM", "reference": { "type": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" } ], "site_lbl": "Thr181", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" } ], "site_lbl": "Thr181", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 445, "end_pos": 445, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" } ], "site_lbl": "Ser445", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 445, "end_pos": 445, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" } ], "site_lbl": "Ser445", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" } ], "site_lbl": "Ser461", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://pubmed.ncbi.nlm.nih.gov/15657432" } ], "site_lbl": "Ser461", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.15657432", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The peptidyl-prolyl isomerase Pin1 regulates phospho-Ser77 retinoic acid receptor alpha stability.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Brondani V, Schefer Q, Hamy F, Klimkait T", "reference": { "type": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.15670742", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement of the coiled-coil domain of PML-RARalpha oncoprotein for localization, sumoylation, and inhibition of monocyte differentiation.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kim YE, Kim DY, Lee JM, Kim ST, Han TH, Ahn JH", "reference": { "type": "PubMed", "id": "15809060", "url": "https://pubmed.ncbi.nlm.nih.gov/15809060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29590-1", "protein_name": "Protein PML", "gene_name": "PML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63279-1", "protein_name": "SUMO-conjugating enzyme UBC9", "gene_name": "UBE2I", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 88, "end_pos": 88, "sequence_org": "C", "sequence_mut": "S", "comment": "No nuclear microspeckle location, no sumoylation and loss of intrinsic transcriptional repressor activity of PML-RARA oncoprotein; when associated with R-89.", "evidence": [ { "database": "UniProtKB", "id": "P29590", "url": "https://www.uniprot.org/uniprotkb/P29590" }, { "database": "PubMed", "id": "15809060", "url": "https://pubmed.ncbi.nlm.nih.gov/15809060" } ], "uniprot_canonical_ac": "P29590-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "P", "sequence_mut": "R", "comment": "No nuclear microspeckle location, no sumoylation and loss of intrinsic transcriptional repressor activity of PML-RARA oncoprotein; when associated with S-88.", "evidence": [ { "database": "UniProtKB", "id": "P29590", "url": "https://www.uniprot.org/uniprotkb/P29590" }, { "database": "PubMed", "id": "15809060", "url": "https://pubmed.ncbi.nlm.nih.gov/15809060" } ], "uniprot_canonical_ac": "P29590-1" } ], "record_id": "pubmed.15809060", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling.", "journal": "Cell", "date": "2005", "authors": "Epping MT, Wang L, Edel MJ, Carlee L, Hernandez M, Bernards R", "reference": { "type": "PubMed", "id": "16179254", "url": "https://pubmed.ncbi.nlm.nih.gov/16179254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78395-1", "protein_name": "Melanoma antigen preferentially expressed in tumors", "gene_name": "PRAME", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 470, "end_pos": 471, "sequence_org": "LL", "sequence_mut": "VV", "comment": "Loss of interaction with RARA and defective in repressing RARA signaling.", "evidence": [ { "database": "UniProtKB", "id": "P78395", "url": "https://www.uniprot.org/uniprotkb/P78395" }, { "database": "PubMed", "id": "16179254", "url": "https://pubmed.ncbi.nlm.nih.gov/16179254" } ], "uniprot_canonical_ac": "P78395-1" } ], "record_id": "pubmed.16179254", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclin H binding to the RARalpha activation function (AF)-2 domain directs phosphorylation of the AF-1 domain by cyclin-dependent kinase 7.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Bour G, Gaillard E, Bruck N, Lalevee S, Plassat JL, Busso D, Samama JP, Rochette-Egly C", "reference": { "type": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.16275922", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt phosphorylates and suppresses the transactivation of retinoic acid receptor alpha.", "journal": "The Biochemical journal", "date": "2006", "authors": "Srinivas H, Xia D, Moore NL, Uray IP, Kim H, Ma L, Weigel NL, Brown PH, Kurie JM", "reference": { "type": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 154, "end_pos": 154, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on PKB/AKT1-mediated phosphorylation. No repression of transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 157, "end_pos": 157, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on PKB/AKT1-mediated phosphorylation. Repressed transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 95, "end_pos": 95, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on PKB/AKT1-mediated phosphorylation. Repressed transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes PKB/AKT1-mediated phosphorylation. Repressed transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" } ], "uniprot_canonical_ac": "P10276-1" } ], "phosphorylation": [ { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKB/AKT1", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://pubmed.ncbi.nlm.nih.gov/16417524" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.16417524", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Additional sex comb-like 1 (ASXL1), in cooperation with SRC-1, acts as a ligand-dependent coactivator for retinoic acid receptor.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cho YS, Kim EJ, Park UH, Sin HS, Um SJ", "reference": { "type": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXJ9-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "ASXL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59598-1", "protein_name": "Polycomb group protein ASXL1", "gene_name": "Asxl1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P28700-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "Rxra", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 409, "end_pos": 410, "sequence_org": "LI", "sequence_mut": "AA", "comment": "Abolishes interaction with ASXL1 and NCOA1.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 412, "end_pos": 412, "sequence_org": "E", "sequence_mut": "Q", "comment": "Impairs interaction with ASXL1 and NCOA1; when associated with Q-415.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 413, "end_pos": 414, "sequence_org": "ML", "sequence_mut": "AA", "comment": "Abolishes interaction with ASXL1 and NCOA1.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 415, "end_pos": 415, "sequence_org": "E", "sequence_mut": "Q", "comment": "Impairs interaction with ASXL1 and NCOA1; when associated with Q-412.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 1108, "end_pos": 1108, "sequence_org": "V", "sequence_mut": "A", "comment": "Abolishes interaction with RARA.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "Q8IXJ9-1" }, { "start_pos": 1111, "end_pos": 1111, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with RARA.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ9", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ9" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "Q8IXJ9-1" }, { "start_pos": 455, "end_pos": 456, "sequence_org": "FL", "sequence_mut": "AA", "comment": "Abolishes interaction with ASXL1 and NCOA1.", "evidence": [ { "database": "UniProtKB", "id": "P28700", "url": "https://www.uniprot.org/uniprotkb/P28700" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "P28700-1" }, { "start_pos": 459, "end_pos": 460, "sequence_org": "ML", "sequence_mut": "AA", "comment": "Abolishes interaction with ASXL1 and NCOA1.", "evidence": [ { "database": "UniProtKB", "id": "P28700", "url": "https://www.uniprot.org/uniprotkb/P28700" }, { "database": "PubMed", "id": "16606617", "url": "https://pubmed.ncbi.nlm.nih.gov/16606617" } ], "uniprot_canonical_ac": "P28700-1" } ], "record_id": "pubmed.16606617", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPbeta is required for 'emergency' granulopoiesis.", "journal": "Nature immunology", "date": "2006", "authors": "Hirai H, Zhang P, Dayaram T, Hetherington CJ, Mizuno S, Imanishi J, Akashi K, Tenen DG", "reference": { "type": "PubMed", "id": "16751774", "url": "https://pubmed.ncbi.nlm.nih.gov/16751774" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16751774", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation by PKA potentiates retinoic acid receptor alpha activity by means of increasing interaction with and phosphorylation by cyclin H/cdk7.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gaillard E, Bruck N, Brelivet Y, Bour G, Lalevee S, Bauer A, Poch O, Moras D, Rochette-Egly C", "reference": { "type": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PubMed", "id": "20215566", "url": "https://pubmed.ncbi.nlm.nih.gov/20215566" } ], "site_lbl": "Ser369", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.16769902", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.", "journal": "Nature medicine", "date": "2006", "authors": "Skokowa J, Cario G, Uenalan M, Schambach A, Germeshausen M, Battmer K, Zeidler C, Lehmann U, Eder M, Baum C, Grosschedl R, Stanulla M, Scherr M, Welte K", "reference": { "type": "PubMed", "id": "17063141", "url": "https://pubmed.ncbi.nlm.nih.gov/17063141" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17063141", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CaMKII regulates retinoic acid receptor transcriptional activity and the differentiation of myeloid leukemia cells.", "journal": "The Journal of clinical investigation", "date": "2007", "authors": "Si J, Mueller L, Collins SJ", "reference": { "type": "PubMed", "id": "17431504", "url": "https://pubmed.ncbi.nlm.nih.gov/17431504" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "Q13555-1", "kinase_gene_name": "CAMK2G", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "17431504", "url": "https://pubmed.ncbi.nlm.nih.gov/17431504" } ], "site_lbl": "Thr210", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.17431504", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RIF-1, a novel nuclear receptor corepressor that associates with the nuclear matrix.", "journal": "J. Cell. Biochem.", "date": "2007", "authors": "Li HJ, Haque ZK, Chen A, Mendelsohn M", "reference": { "type": "PubMed", "id": "17455211", "url": "https://pubmed.ncbi.nlm.nih.gov/17455211" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T3J3-1", "protein_name": "Ligand-dependent nuclear receptor-interacting factor 1", "gene_name": "LRIF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 628, "end_pos": 630, "sequence_org": "KKR", "sequence_mut": "AAA", "comment": "Slightly reduces nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "Q5T3J3", "url": "https://www.uniprot.org/uniprotkb/Q5T3J3" }, { "database": "PubMed", "id": "17455211", "url": "https://pubmed.ncbi.nlm.nih.gov/17455211" } ], "uniprot_canonical_ac": "Q5T3J3-1" }, { "start_pos": 642, "end_pos": 644, "sequence_org": "KKR", "sequence_mut": "AAA", "comment": "Abolishes nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "Q5T3J3", "url": "https://www.uniprot.org/uniprotkb/Q5T3J3" }, { "database": "PubMed", "id": "17455211", "url": "https://pubmed.ncbi.nlm.nih.gov/17455211" } ], "uniprot_canonical_ac": "Q5T3J3-1" } ], "record_id": "pubmed.17455211", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Yoshida H, Ichikawa H, Tagata Y, Katsumoto T, Ohnishi K, Akao Y, Naoe T, Pandolfi PP, Kitabayashi I", "reference": { "type": "PubMed", "id": "17562868", "url": "https://pubmed.ncbi.nlm.nih.gov/17562868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17562868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.", "journal": "Oncogene", "date": "2008", "authors": "Matsushita H, Nakajima H, Nakamura Y, Tsukamoto H, Tanaka Y, Jin G, Yabe M, Asai S, Ono R, Nosaka T, Sugita K, Morimoto A, Hayashi Y, Hotta T, Ando K, Miyachi H", "reference": { "type": "PubMed", "id": "18776924", "url": "https://pubmed.ncbi.nlm.nih.gov/18776924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18776924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A coordinated phosphorylation cascade initiated by p38MAPK/MSK1 directs RARalpha to target promoters.", "journal": "The EMBO journal", "date": "2009", "authors": "Bruck N, Vitoux D, Ferry C, Duong V, Bauer A, de The H, Rochette-Egly C", "reference": { "type": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11416-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "Rara", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q60974-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "Ncor1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "O75582-1", "kinase_gene_name": "RPS6KA5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" } ], "site_lbl": "Ser369", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PubMed", "id": "20215566", "url": "https://pubmed.ncbi.nlm.nih.gov/20215566" } ], "site_lbl": "Ser369", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and RPS6KA5", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "IntAct", "id": "P11416", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11416*" }, { "database": "iPTMnet", "id": "P11416", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11416" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PubMed", "id": "7476969", "url": "https://pubmed.ncbi.nlm.nih.gov/7476969" } ], "site_lbl": "Ser369", "uniprot_canonical_ac": "P11416-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "IntAct", "id": "P11416", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11416*" }, { "database": "iPTMnet", "id": "P11416", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11416" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PRO", "id": "P11416", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P11416" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P11416-1" } ], "mutagenesis": [ { "start_pos": 369, "end_pos": 369, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation and prevents phosphorylation of S-77.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" } ], "uniprot_canonical_ac": "P11416-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreases phosphorylation and no effect on interaction with CDK7. Strongly reduces transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "uniprot_canonical_ac": "P11416-1" } ], "record_id": "pubmed.19078967", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.", "journal": "Nature", "date": "2009", "authors": "Fujiki Ryoji, Chikanishi Toshihiro, Hashiba Waka, Ito Hiroaki, Takada Ichiro, Roeder Robert G, Kitagawa Hirochika, Kato Shigeaki", "reference": { "type": "PubMed", "id": "19377461", "url": "https://pubmed.ncbi.nlm.nih.gov/19377461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15208-1", "protein_name": "Serine/threonine-protein kinase 38", "gene_name": "STK38", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51610-1", "protein_name": "Host cell factor 1", "gene_name": "HCFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZD2-1", "protein_name": "Histone reader KMT2E", "gene_name": "KMT2E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15294-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "OGT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 440, "start_aa": "Thr", "end_pos": 440, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr440", "evidence": [ { "id": "Q8IZD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8IZD2#ptm_processing" }, { "id": "26678539", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26678539" }, { "id": "19377461", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19377461" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000001000000.00.01001", "uniprot_canonical_ac": "Q8IZD2-1" } ], "record_id": "pubmed.19377461", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "ZNF536, a novel zinc finger protein specifically expressed in the brain, negatively regulates neuron differentiation by repressing retinoic acid-induced gene transcription.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Qin Z, Ren F, Xu X, Ren Y, Li H, Wang Y, Zhai Y, Chang Z", "reference": { "type": "PubMed", "id": "19398580", "url": "https://pubmed.ncbi.nlm.nih.gov/19398580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K083-1", "protein_name": "Zinc finger protein 536", "gene_name": "Zfp536; Znf536", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O15090-1", "protein_name": "Zinc finger protein 536", "gene_name": "ZNF536", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19398580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence.", "journal": "Molecular biology reports", "date": "2010", "authors": "Cai R, Cai X, Chen B, Xu W, Lu J", "reference": { "type": "PubMed", "id": "20661648", "url": "https://pubmed.ncbi.nlm.nih.gov/20661648" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20661648", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.", "journal": "Blood", "date": "2011", "authors": "Haefliger S, Klebig C, Schaubitzer K, Schardt J, Timchenko N, Mueller BU, Pabst T", "reference": { "type": "PubMed", "id": "21471526", "url": "https://pubmed.ncbi.nlm.nih.gov/21471526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21471526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a functional promoter for the human retinoic acid receptor-alpha (hRAR-alpha).", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Brand N J, Petkovich M, Chambon P", "reference": { "type": "PubMed", "id": "2175878", "url": "https://pubmed.ncbi.nlm.nih.gov/2175878" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2175878", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.", "journal": "Leukemia research", "date": "2012", "authors": "Diakiw SM, Kok CH, To LB, Lewis ID, Brown AL, D'Andrea RJ", "reference": { "type": "PubMed", "id": "21993314", "url": "https://pubmed.ncbi.nlm.nih.gov/21993314" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21993314", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoid-regulated FGF8f secretion by osteoblasts bypasses retinoid stimuli to mediate granulocytic differentiation of myeloid leukemia cells.", "journal": "Molecular cancer therapeutics", "date": "2012-02", "authors": "Chaudhry Parvesh, Yang Xiaochun, Wagner Michael, Jong Ambrose, Wu Lingtao", "reference": { "type": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.22135230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Familial focal segmental glomerulosclerosis (FSGS)-linked alpha-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Khurana S, Chakraborty S, Lam M, Liu Y, Su YT, Zhao X, Saleem MA, Mathieson PW, Bruggeman LA, Kao HY", "reference": { "type": "PubMed", "id": "22351778", "url": "https://pubmed.ncbi.nlm.nih.gov/22351778" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37231-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "PPARG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 87, "end_pos": 88, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Reduced interaction with RARA. Loss of the transcriptional coac tivator activity toward RARA.", "evidence": [ { "database": "UniProtKB", "id": "O43707", "url": "https://www.uniprot.org/uniprotkb/O43707" }, { "database": "PubMed", "id": "22351778", "url": "https://pubmed.ncbi.nlm.nih.gov/22351778" } ], "uniprot_canonical_ac": "O43707-1" } ], "record_id": "pubmed.22351778", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of wild-type or mutants forms of CEBPA alter normal human hematopoiesis.", "journal": "Leukemia", "date": "2012", "authors": "Quintana-Bustamante O, Lan-Lan Smith S, Griessinger E, Reyal Y, Vargaftig J, Lister TA, Fitzgibbon J, Bonnet D", "reference": { "type": "PubMed", "id": "22371011", "url": "https://pubmed.ncbi.nlm.nih.gov/22371011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22371011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPalpha and DEK coordinately regulate myeloid differentiation.", "journal": "Blood", "date": "2012", "authors": "Koleva RI, Ficarro SB, Radomska HS, Carrasco-Alfonso MJ, Alberta JA, Webber JT, Luckey CJ, Marcucci G, Tenen DG, Marto JA", "reference": { "type": "PubMed", "id": "22474248", "url": "https://pubmed.ncbi.nlm.nih.gov/22474248" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49715", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49715" }, { "database": "PubMed", "id": "14701740", "url": "https://pubmed.ncbi.nlm.nih.gov/14701740" }, { "database": "PubMed", "id": "16446383", "url": "https://pubmed.ncbi.nlm.nih.gov/16446383" }, { "database": "PubMed", "id": "16807249", "url": "https://pubmed.ncbi.nlm.nih.gov/16807249" }, { "database": "PubMed", "id": "19544470", "url": "https://pubmed.ncbi.nlm.nih.gov/19544470" }, { "database": "PubMed", "id": "20101026", "url": "https://pubmed.ncbi.nlm.nih.gov/20101026" }, { "database": "PubMed", "id": "21912254", "url": "https://pubmed.ncbi.nlm.nih.gov/21912254" }, { "database": "PubMed", "id": "22212957", "url": "https://pubmed.ncbi.nlm.nih.gov/22212957" }, { "database": "PubMed", "id": "22349414", "url": "https://pubmed.ncbi.nlm.nih.gov/22349414" }, { "database": "PubMed", "id": "22474248", "url": "https://pubmed.ncbi.nlm.nih.gov/22474248" }, { "database": "PubMed", "id": "22797303", "url": "https://pubmed.ncbi.nlm.nih.gov/22797303" }, { "database": "PubMed", "id": "23814099", "url": "https://pubmed.ncbi.nlm.nih.gov/23814099" }, { "database": "PubMed", "id": "25753223", "url": "https://pubmed.ncbi.nlm.nih.gov/25753223" } ], "site_lbl": "Ser21", "uniprot_canonical_ac": "P49715-1" } ], "record_id": "pubmed.22474248", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.", "journal": "Nature medicine", "date": "2012", "authors": "Skokowa J, Klimiankou M, Klimenkova O, Lan D, Gupta K, Hussein K, Carrizosa E, Kusnetsova I, Li Z, Sustmann C, Ganser A, Zeidler C, Kreipe HH, Burkhardt J, Grosschedl R, Welte K", "reference": { "type": "PubMed", "id": "23001182", "url": "https://pubmed.ncbi.nlm.nih.gov/23001182" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23001182", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.", "journal": "International journal of oncology", "date": "2014", "authors": "Iriyama N, Yuan B, Yoshino Y, Hatta Y, Horikoshi A, Aizawa S, Takei M, Takeuchi J, Takagi N, Toyoda H", "reference": { "type": "PubMed", "id": "24379003", "url": "https://pubmed.ncbi.nlm.nih.gov/24379003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24379003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.", "journal": "Scientific reports", "date": "2014", "authors": "Federzoni EA, Humbert M, Torbett BE, Behre G, Fey MF, Tschan MP", "reference": { "type": "PubMed", "id": "24584857", "url": "https://pubmed.ncbi.nlm.nih.gov/24584857" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24584857", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E1A-dependent trans-activation of the human MYC promoter is mediated by the E2F factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hiebert SW, Lipp M, Nevins JR", "reference": { "type": "PubMed", "id": "2524830", "url": "https://pubmed.ncbi.nlm.nih.gov/2524830" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2524830", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-191 promotes tumorigenesis of human colorectal cancer through targeting C/EBPbeta.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang XF, Li KK, Gao L, Li SZ, Chen K, Zhang JB, Wang D, Tu RF, Zhang JX, Tao KX, Wang G, Zhang XD", "reference": { "type": "PubMed", "id": "25784653", "url": "https://pubmed.ncbi.nlm.nih.gov/25784653" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25784653", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluating frequency of PML-RARA mutations and conferring resistance to arsenic trioxide-based therapy in relapsed acute promyelocytic leukemia patients.", "journal": "Annals of hematology", "date": "2015", "authors": "Lou Y, Ma Y, Sun J, Ye X, Pan H, Wang Y, Qian W, Meng H, Mai W, He J, Tong H, Jin J", "reference": { "type": "PubMed", "id": "26294332", "url": "https://pubmed.ncbi.nlm.nih.gov/26294332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26294332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoid X receptor activation reverses age-related deficiencies in myelin debris phagocytosis and remyelination.", "journal": "Brain", "date": "2015", "authors": "Natrajan Muktha S, de la Fuente Alerie G, Crawford Abbe H, Linehan Eimear, Nu\u00f1ez Vanessa, Johnson Kory R, Wu Tianxia, Fitzgerald Denise C, Ricote Mercedes, Bielekova Bibiana, Franklin Robin J M", "reference": { "type": "PubMed", "id": "26463675", "url": "https://pubmed.ncbi.nlm.nih.gov/26463675" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28702-1", "protein_name": "Retinoic acid receptor RXR-beta", "gene_name": "RXRB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28700-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "Rxra", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26463675", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear factor E2F mediates basic transcription and trans-activation by E1a of the human MYC promoter.", "journal": "Genes & development", "date": "1989", "authors": "Thalmeier K, Synovzik H, Mertz R, Winnacker EL, Lipp M", "reference": { "type": "PubMed", "id": "2721961", "url": "https://pubmed.ncbi.nlm.nih.gov/2721961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2721961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human retinoic acid receptor which belongs to the family of nuclear receptors.", "journal": "Nature", "date": "1987", "authors": "Petkovich M, Brand N J, Krust A, Chambon P", "reference": { "type": "PubMed", "id": "2825025", "url": "https://pubmed.ncbi.nlm.nih.gov/2825025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2825025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a receptor for the morphogen retinoic acid.", "journal": "Nature", "date": "1987", "authors": "Giguere V, Ong E S, Segui P, Evans R M", "reference": { "type": "PubMed", "id": "2825036", "url": "https://pubmed.ncbi.nlm.nih.gov/2825036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2825036", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C/EBPalpha overrides epigenetic reprogramming by oncogenic transcription factors in acute myeloid leukemia.", "journal": "Blood advances", "date": "2018", "authors": "Loke J, Chin PS, Keane P, Pickin A, Assi SA, Ptasinska A, Imperato MR, Cockerill PN, Bonifer C", "reference": { "type": "PubMed", "id": "29431622", "url": "https://pubmed.ncbi.nlm.nih.gov/29431622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29431622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear hormone receptors: Ancient 9aaTAD and evolutionally gained NCoA activation pathways.", "journal": "J. Steroid Biochem. Mol. Biol.", "date": "2019", "authors": "Piskacek Martin, Havelka Marek, Jendruchova Kristina, Knight Andrea", "reference": { "type": "PubMed", "id": "30468856", "url": "https://pubmed.ncbi.nlm.nih.gov/30468856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37231-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "PPARG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41235-1", "protein_name": "Hepatocyte nuclear factor 4-alpha", "gene_name": "HNF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11473-1", "protein_name": "Vitamin D3 receptor", "gene_name": "VDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30468856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of retinoic acid receptor alpha phosphorylation represses the progression of triple-negative breast cancer via transactivating miR-3074-5p to target DHRS3.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2021", "authors": "Lou S, Gao H, Hong H, Zhu Z, Zhao H", "reference": { "type": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75911-1", "protein_name": "Short-chain dehydrogenase/reductase 3", "gene_name": "DHRS3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" } ], "record_id": "pubmed.33902658", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PML::RARA and GATA2 proteins interact via DNA templates to induce aberrant self-renewal in mouse and human hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-04-30", "authors": "Katerndahl Casey D S, Rogers Olivia R S, Day Ryan B, Xu Ziheng, Helton Nichole M, Ramakrishnan Sai Mukund, Miller Christopher A, Ley Timothy J", "reference": { "type": "PubMed", "id": "38648485", "url": "https://pubmed.ncbi.nlm.nih.gov/38648485" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29590-1", "protein_name": "Protein PML", "gene_name": "PML", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60953-1", "protein_name": "Protein PML", "gene_name": "Pml", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38648485", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autoregulation of the human C/EBP alpha gene by stimulation of upstream stimulatory factor binding.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Timchenko N, Wilson DR, Taylor LR, Abdelsayed S, Wilde M, Sawadogo M, Darlington GJ", "reference": { "type": "PubMed", "id": "7862113", "url": "https://pubmed.ncbi.nlm.nih.gov/7862113" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7862113", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PLZF-RAR alpha fusion proteins generated from the variant t(11;17)(q23;q21) translocation in acute promyelocytic leukemia inhibit ligand-dependent transactivation of wild-type retinoic acid receptors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Chen Z, Guidez F, Rousselot P, Agadir A, Chen SJ, Wang ZY, Degos L, Zelent A, Waxman S, Chomienne C", "reference": { "type": "PubMed", "id": "8302850", "url": "https://pubmed.ncbi.nlm.nih.gov/8302850" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8302850", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion.", "journal": "Blood", "date": "1996", "authors": "Redner R L, Rush E A, Faas S, Rudert W A, Corey S J", "reference": { "type": "PubMed", "id": "8562957", "url": "https://pubmed.ncbi.nlm.nih.gov/8562957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06748-1", "protein_name": "Nucleophosmin", "gene_name": "NPM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8562957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells.", "journal": "Blood", "date": "1996", "authors": "Smith LT, Hohaus S, Gonzalez DA, Dziennis SE, Tenen DG", "reference": { "type": "PubMed", "id": "8695841", "url": "https://pubmed.ncbi.nlm.nih.gov/8695841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8695841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCAAT/enhancer-binding protein alpha (C/EBP alpha) inhibits cell proliferation through the p21 (WAF-1/CIP-1/SDI-1) protein.", "journal": "Genes & development", "date": "1996", "authors": "Timchenko NA, Wilde M, Nakanishi M, Smith JR, Darlington GJ", "reference": { "type": "PubMed", "id": "8846917", "url": "https://pubmed.ncbi.nlm.nih.gov/8846917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8846917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG, Xanthopoulos KG", "reference": { "type": "PubMed", "id": "9177240", "url": "https://pubmed.ncbi.nlm.nih.gov/9177240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15744-1", "protein_name": "CCAAT/enhancer-binding protein epsilon", "gene_name": "CEBPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99062-1", "protein_name": "Granulocyte colony-stimulating factor receptor", "gene_name": "CSF3R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13951-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "CBFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13887-1", "protein_name": "Krueppel-like factor 5", "gene_name": "KLF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35659-1", "protein_name": "Protein DEK", "gene_name": "DEK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01543-1", "protein_name": "Friend leukemia integration 1 transcription factor", "gene_name": "FLI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10242-1", "protein_name": "Transcriptional activator Myb", "gene_name": "MYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17947-1", "protein_name": "Transcription factor PU.1", "gene_name": "SPI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23769-1", "protein_name": "Endothelial transcription factor GATA-2", "gene_name": "GATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99684-1", "protein_name": "Zinc finger protein Gfi-1", "gene_name": "GFI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9177240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stimulation of RAR alpha activation function AF-1 through binding to the general transcription factor TFIIH and phosphorylation by CDK7.", "journal": "Cell", "date": "1997", "authors": "Rochette-Egly C, Adam S, Rossignol M, Egly JM, Chambon P", "reference": { "type": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11416-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "Rara", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VD76-1", "protein_name": "General transcription factor IIH subunit 3", "gene_name": "Gtf2h3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P50613-1", "kinase_gene_name": "CDK7", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" }, { "database": "PRO", "id": "P10276", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://pubmed.ncbi.nlm.nih.gov/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://pubmed.ncbi.nlm.nih.gov/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://pubmed.ncbi.nlm.nih.gov/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://pubmed.ncbi.nlm.nih.gov/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://pubmed.ncbi.nlm.nih.gov/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://pubmed.ncbi.nlm.nih.gov/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://pubmed.ncbi.nlm.nih.gov/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P10276-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "IntAct", "id": "P11416", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11416*" }, { "database": "iPTMnet", "id": "P11416", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11416" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PRO", "id": "P11416", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P11416" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P11416-1" } ], "mutagenesis": [ { "start_pos": 449, "end_pos": 449, "sequence_org": "S", "sequence_mut": "A", "comment": "No change in phosphorylation levels and no effect on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "uniprot_canonical_ac": "P11416-1" }, { "start_pos": 456, "end_pos": 456, "sequence_org": "S", "sequence_mut": "A", "comment": "No change in phosphorylation levels and no effect on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "uniprot_canonical_ac": "P11416-1" }, { "start_pos": 461, "end_pos": 461, "sequence_org": "S", "sequence_mut": "A", "comment": "No change in phosphorylation levels and no effect on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "uniprot_canonical_ac": "P11416-1" }, { "start_pos": 74, "end_pos": 74, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation, no effect on transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "uniprot_canonical_ac": "P11416-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreases phosphorylation and no effect on interaction with CDK7. Strongly reduces transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprotkb/P11416" }, { "database": "PubMed", "id": "19078967", "url": "https://pubmed.ncbi.nlm.nih.gov/19078967" }, { "database": "PubMed", "id": "9230306", "url": "https://pubmed.ncbi.nlm.nih.gov/9230306" } ], "uniprot_canonical_ac": "P11416-1" } ], "record_id": "pubmed.9230306", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.", "journal": "Cell", "date": "1997-08-08", "authors": "Chen H, Lin R J, Schiltz R L, Chakravarti D, Nash A, Nagy L, Privalsky M L, Nakatani Y, Evans R M", "reference": { "type": "PubMed", "id": "9267036", "url": "https://pubmed.ncbi.nlm.nih.gov/9267036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10276-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "RARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10827-1", "protein_name": "Thyroid hormone receptor alpha", "gene_name": "THRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11473-1", "protein_name": "Vitamin D3 receptor", "gene_name": "VDR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprotkb/P10276" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9267036", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibitory phosphorylation of PP1alpha catalytic subunit during the G(1)/S transition.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Liu CW, Wang RH, Dohadwala M, Schonthal AH, Villa-Moruzzi E, Berndt N", "reference": { "type": "PubMed", "id": "10506210", "url": "https://pubmed.ncbi.nlm.nih.gov/10506210" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16732323", "url": "https://pubmed.ncbi.nlm.nih.gov/16732323" }, { "database": "PubMed", "id": "18088087", "url": "https://pubmed.ncbi.nlm.nih.gov/18088087" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "9122166", "url": "https://pubmed.ncbi.nlm.nih.gov/9122166" }, { "database": "PubMed", "id": "10506210", "url": "https://pubmed.ncbi.nlm.nih.gov/10506210" }, { "database": "PubMed", "id": "21331744", "url": "https://pubmed.ncbi.nlm.nih.gov/21331744" }, { "database": "PubMed", "id": "25556058", "url": "https://pubmed.ncbi.nlm.nih.gov/25556058" }, { "database": "PubMed", "id": "26891914", "url": "https://pubmed.ncbi.nlm.nih.gov/26891914" }, { "database": "PubMed", "id": "9197238", "url": "https://pubmed.ncbi.nlm.nih.gov/9197238" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" } ], "record_id": "pubmed.10506210", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Silencing of TGF-beta signalling by the pseudoreceptor BAMBI.", "journal": "Nature", "date": "1999", "authors": "Onichtchouk D, Chen YG, Dosch R, Gawantka V, Delius H, Massague J, Niehrs C", "reference": { "type": "PubMed", "id": "10519551", "url": "https://pubmed.ncbi.nlm.nih.gov/10519551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10519551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STRAP and Smad7 synergize in the inhibition of transforming growth factor beta signaling.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Datta PK, Moses HL", "reference": { "type": "PubMed", "id": "10757800", "url": "https://pubmed.ncbi.nlm.nih.gov/10757800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10757800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Smad7 binds to Smurf2 to form an E3 ubiquitin ligase that targets the TGF beta receptor for degradation.", "journal": "Molecular cell", "date": "2000", "authors": "Kavsak P, Rasmussen RK, Causing CG, Bonni S, Zhu H, Thomsen GH, Wrana JL", "reference": { "type": "PubMed", "id": "11163210", "url": "https://pubmed.ncbi.nlm.nih.gov/11163210" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 207, "end_pos": 211, "sequence_org": "PPPPY", "sequence_mut": "", "comment": "Diminishes interaction with SMURF2.", "evidence": [ { "database": "UniProtKB", "id": "O15105", "url": "https://www.uniprot.org/uniprotkb/O15105" }, { "database": "PubMed", "id": "11163210", "url": "https://pubmed.ncbi.nlm.nih.gov/11163210" } ], "uniprot_canonical_ac": "O15105-1" }, { "start_pos": 211, "end_pos": 211, "sequence_org": "Y", "sequence_mut": "A", "comment": "Diminishes interaction with SMURF2 and reduces inhibition of TGF-beta signaling.", "evidence": [ { "database": "UniProtKB", "id": "O15105", "url": "https://www.uniprot.org/uniprotkb/O15105" }, { "database": "PubMed", "id": "11163210", "url": "https://pubmed.ncbi.nlm.nih.gov/11163210" } ], "uniprot_canonical_ac": "O15105-1" }, { "start_pos": 251, "end_pos": 284, "sequence_org": "PDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRV", "sequence_mut": "", "comment": "Abolishes interaction with SMAD2 and SMAD7.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "11163210", "url": "https://pubmed.ncbi.nlm.nih.gov/11163210" }, { "database": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 297, "end_pos": 330, "sequence_org": "GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRL", "sequence_mut": "", "comment": "Abolishes interaction with SMAD7.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "11163210", "url": "https://pubmed.ncbi.nlm.nih.gov/11163210" } ], "uniprot_canonical_ac": "Q9HAU4-1" } ], "record_id": "pubmed.11163210", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Growth arrest and DNA damage-inducible protein GADD34 assembles a novel signaling complex containing protein phosphatase 1 and inhibitor 1.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Connor JH, Weiser DC, Li S, Hallenbeck JM, Shenolikar S", "reference": { "type": "PubMed", "id": "11564868", "url": "https://pubmed.ncbi.nlm.nih.gov/11564868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13522-1", "protein_name": "Protein phosphatase 1 regulatory subunit 1A", "gene_name": "PPP1R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "Q13522", "url": "https://www.uniprot.org/uniprotkb/Q13522" }, { "database": "iPTMnet", "id": "Q13522", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13522" }, { "database": "PubMed", "id": "8611507", "url": "https://pubmed.ncbi.nlm.nih.gov/8611507" }, { "database": "PubMed", "id": "11278334", "url": "https://pubmed.ncbi.nlm.nih.gov/11278334" }, { "database": "PubMed", "id": "16772299", "url": "https://pubmed.ncbi.nlm.nih.gov/16772299" }, { "database": "PubMed", "id": "17046826", "url": "https://pubmed.ncbi.nlm.nih.gov/17046826" }, { "database": "PubMed", "id": "17200417", "url": "https://pubmed.ncbi.nlm.nih.gov/17200417" }, { "database": "PubMed", "id": "17400554", "url": "https://pubmed.ncbi.nlm.nih.gov/17400554" }, { "database": "PubMed", "id": "17416610", "url": "https://pubmed.ncbi.nlm.nih.gov/17416610" }, { "database": "PubMed", "id": "19887526", "url": "https://pubmed.ncbi.nlm.nih.gov/19887526" }, { "database": "PubMed", "id": "20512582", "url": "https://pubmed.ncbi.nlm.nih.gov/20512582" }, { "database": "PubMed", "id": "24244723", "url": "https://pubmed.ncbi.nlm.nih.gov/24244723" }, { "database": "PubMed", "id": "29311589", "url": "https://pubmed.ncbi.nlm.nih.gov/29311589" }, { "database": "PubMed", "id": "11564868", "url": "https://pubmed.ncbi.nlm.nih.gov/11564868" } ], "site_lbl": "Thr35", "uniprot_canonical_ac": "Q13522-1" } ], "record_id": "pubmed.11564868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein phosphatase 1 -- targeted in many directions.", "journal": "J. Cell Sci.", "date": "2002", "authors": "Cohen Patricia T W", "reference": { "type": "PubMed", "id": "11839776", "url": "https://pubmed.ncbi.nlm.nih.gov/11839776" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11839776", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ionizing radiation activates nuclear protein phosphatase-1 by ATM-dependent dephosphorylation.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Guo CY, Brautigan DL, Larner JM", "reference": { "type": "PubMed", "id": "12202491", "url": "https://pubmed.ncbi.nlm.nih.gov/12202491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "22367880", "url": "https://pubmed.ncbi.nlm.nih.gov/22367880" }, { "database": "PubMed", "id": "12202491", "url": "https://pubmed.ncbi.nlm.nih.gov/12202491" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" }, { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "12202491", "url": "https://pubmed.ncbi.nlm.nih.gov/12202491" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" }, { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "Q00535-1", "kinase_gene_name": "CDK5", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "17202132", "url": "https://pubmed.ncbi.nlm.nih.gov/17202132" }, { "database": "PubMed", "id": "12202491", "url": "https://pubmed.ncbi.nlm.nih.gov/12202491" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" } ], "record_id": "pubmed.12202491", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of the concave surface of the Sds22 superhelix to the alpha 4/alpha 5/alpha 6-triangle of protein phosphatase-1.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Ceulemans H, Vulsteke V, De Maeyer M, Tatchell K, Stalmans W, Bollen M", "reference": { "type": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HZV9-1", "protein_name": "Protein phosphatase 1 regulatory subunit 7", "gene_name": "AABR07068351.1; Ppp1r7", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15435-1", "protein_name": "Protein phosphatase 1 regulatory subunit 7", "gene_name": "PPP1R7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 148, "end_pos": 148, "sequence_org": "D", "sequence_mut": "V", "comment": "Completely abolishes the interaction with protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "F", "sequence_mut": "A", "comment": "Severely impaired the binding of protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 192, "end_pos": 192, "sequence_org": "E", "sequence_mut": "A", "comment": "Completely abolishes the interaction with protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 214, "end_pos": 214, "sequence_org": "F", "sequence_mut": "A", "comment": "Completely abolishes the interaction with protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 280, "end_pos": 280, "sequence_org": "D", "sequence_mut": "A", "comment": "Severely impairs the binding of protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "E", "sequence_mut": "A", "comment": "Completely abolishes the interaction with protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 302, "end_pos": 302, "sequence_org": "W", "sequence_mut": "A", "comment": "Completely abolishes the interaction with protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "Y", "sequence_mut": "A", "comment": "Completely abolishes the interaction with protein phosphatase 1.", "evidence": [ { "database": "UniProtKB", "id": "Q15435", "url": "https://www.uniprot.org/uniprotkb/Q15435" }, { "database": "PubMed", "id": "12226088", "url": "https://pubmed.ncbi.nlm.nih.gov/12226088" } ], "uniprot_canonical_ac": "Q15435-1" } ], "record_id": "pubmed.12226088", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel transmembrane Ser/Thr kinase complexes with protein phosphatase-1 and inhibitor-2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang H, Brautigan DL", "reference": { "type": "PubMed", "id": "12393858", "url": "https://pubmed.ncbi.nlm.nih.gov/12393858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWU2-1", "protein_name": "Serine/threonine-protein kinase LMTK2", "gene_name": "LMTK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "Q8IWU2-1", "kinase_gene_name": "LMTK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "12393858", "url": "https://pubmed.ncbi.nlm.nih.gov/12393858" }, { "database": "PubMed", "id": "21996745", "url": "https://pubmed.ncbi.nlm.nih.gov/21996745" }, { "database": "PubMed", "id": "22220831", "url": "https://pubmed.ncbi.nlm.nih.gov/22220831" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" } ], "record_id": "pubmed.12393858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The heat shock protein 90 inhibitor geldanamycin and the ErbB inhibitor ZD1839 promote rapid PP1 phosphatase-dependent inactivation of AKT in ErbB2 overexpressing breast cancer cells.", "journal": "Cancer research", "date": "2003", "authors": "Xu W, Yuan X, Jung YJ, Yang Y, Basso A, Rosen N, Chung EJ, Trepel J, Neckers L", "reference": { "type": "PubMed", "id": "14633703", "url": "https://pubmed.ncbi.nlm.nih.gov/14633703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "14633703", "url": "https://pubmed.ncbi.nlm.nih.gov/14633703" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" } ], "record_id": "pubmed.14633703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHIP mediates degradation of Smad proteins and potentially regulates Smad-induced transcription.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Li L, Xin H, Xu X, Huang M, Zhang X, Chen Y, Zhang S, Fu XY, Chang Z", "reference": { "type": "PubMed", "id": "14701756", "url": "https://pubmed.ncbi.nlm.nih.gov/14701756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14701756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GADD34-PP1c recruited by Smad7 dephosphorylates TGFbeta type I receptor.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Shi W, Sun C, He B, Xiong W, Shi X, Yao D, Cao X", "reference": { "type": "PubMed", "id": "14718519", "url": "https://pubmed.ncbi.nlm.nih.gov/14718519" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14718519", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NEDD4-2 (neural precursor cell expressed, developmentally down-regulated 4-2) negatively regulates TGF-beta (transforming growth factor-beta) signalling by inducing ubiquitin-mediated degradation of Smad2 and TGF-beta type I receptor.", "journal": "The Biochemical journal", "date": "2005", "authors": "Kuratomi G, Komuro A, Goto K, Shinozaki M, Miyazawa K, Miyazono K, Imamura T", "reference": { "type": "PubMed", "id": "15496141", "url": "https://pubmed.ncbi.nlm.nih.gov/15496141" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35253-1", "protein_name": "SMAD family member 7", "gene_name": "Smad7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BUN5-1", "protein_name": "SMAD family member 3", "gene_name": "Smad3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35182-1", "protein_name": "SMAD family member 6", "gene_name": "Smad6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q62432-1", "protein_name": "SMAD family member 2", "gene_name": "Smad2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TGFBR1", "evidence": [ { "database": "UniProtKB", "id": "Q62432", "url": "https://www.uniprot.org/uniprotkb/Q62432" }, { "database": "PRO", "id": "Q62432", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q62432" }, { "database": "iPTMnet", "id": "Q62432", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62432" }, { "database": "PubMed", "id": "15496141", "url": "https://pubmed.ncbi.nlm.nih.gov/15496141" }, { "database": "PubMed", "id": "8980228", "url": "https://pubmed.ncbi.nlm.nih.gov/8980228" }, { "database": "PubMed", "id": "9346966", "url": "https://pubmed.ncbi.nlm.nih.gov/9346966" }, { "database": "PubMed", "id": "21731500", "url": "https://pubmed.ncbi.nlm.nih.gov/21731500" }, { "database": "PubMed", "id": "21949412", "url": "https://pubmed.ncbi.nlm.nih.gov/21949412" }, { "database": "PubMed", "id": "23527246", "url": "https://pubmed.ncbi.nlm.nih.gov/23527246" }, { "database": "PubMed", "id": "27441395", "url": "https://pubmed.ncbi.nlm.nih.gov/27441395" }, { "database": "PubMed", "id": "28870245", "url": "https://pubmed.ncbi.nlm.nih.gov/28870245" }, { "database": "PubMed", "id": "29203869", "url": "https://pubmed.ncbi.nlm.nih.gov/29203869" }, { "database": "PubMed", "id": "29620144", "url": "https://pubmed.ncbi.nlm.nih.gov/29620144" }, { "database": "PubMed", "id": "32535965", "url": "https://pubmed.ncbi.nlm.nih.gov/32535965" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q62432-1" }, { "start_pos": 467, "end_pos": 467, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TGFBR1", "evidence": [ { "database": "UniProtKB", "id": "Q62432", "url": "https://www.uniprot.org/uniprotkb/Q62432" }, { "database": "PRO", "id": "Q62432", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q62432" }, { "database": "iPTMnet", "id": "Q62432", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62432" }, { "database": "PubMed", "id": "15496141", "url": "https://pubmed.ncbi.nlm.nih.gov/15496141" }, { "database": "PubMed", "id": "8980228", "url": "https://pubmed.ncbi.nlm.nih.gov/8980228" }, { "database": "PubMed", "id": "9346966", "url": "https://pubmed.ncbi.nlm.nih.gov/9346966" }, { "database": "PubMed", "id": "21731500", "url": "https://pubmed.ncbi.nlm.nih.gov/21731500" }, { "database": "PubMed", "id": "21949412", "url": "https://pubmed.ncbi.nlm.nih.gov/21949412" }, { "database": "PubMed", "id": "23527246", "url": "https://pubmed.ncbi.nlm.nih.gov/23527246" }, { "database": "PubMed", "id": "27441395", "url": "https://pubmed.ncbi.nlm.nih.gov/27441395" }, { "database": "PubMed", "id": "28870245", "url": "https://pubmed.ncbi.nlm.nih.gov/28870245" }, { "database": "PubMed", "id": "29203869", "url": "https://pubmed.ncbi.nlm.nih.gov/29203869" }, { "database": "PubMed", "id": "29620144", "url": "https://pubmed.ncbi.nlm.nih.gov/29620144" } ], "site_lbl": "Ser467", "uniprot_canonical_ac": "Q62432-1" } ], "record_id": "pubmed.15496141", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A selective inhibitor of eIF2alpha dephosphorylation protects cells from ER stress.", "journal": "Science", "date": "2005", "authors": "Boyce Michael, Bryant Kevin F, Jousse C\u00e9line, Long Kai, Harding Heather P, Scheuner Donalyn, Kaufman Randal J, Ma Dawei, Coen Donald M, Ron David, Yuan Junying", "reference": { "type": "PubMed", "id": "15705855", "url": "https://pubmed.ncbi.nlm.nih.gov/15705855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SWA1-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15B", "gene_name": "PPP1R15B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15705855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHIP controls the sensitivity of transforming growth factor-beta signaling by modulating the basal level of Smad3 through ubiquitin-mediated degradation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Xin H, Xu X, Li L, Ning H, Rong Y, Shang Y, Wang Y, Fu XY, Chang Z", "reference": { "type": "PubMed", "id": "15781469", "url": "https://pubmed.ncbi.nlm.nih.gov/15781469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15781469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The deubiquitinating enzyme UCH37 interacts with Smads and regulates TGF-beta signalling.", "journal": "Oncogene", "date": "2005", "authors": "Wicks SJ, Haros K, Maillard M, Song L, Cohen RE, Dijke PT, Chantry A", "reference": { "type": "PubMed", "id": "16027725", "url": "https://pubmed.ncbi.nlm.nih.gov/16027725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16027725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of Smurf2 ubiquitin ligase activity by anchoring the E2 to the HECT domain.", "journal": "Molecular cell", "date": "2005", "authors": "Ogunjimi AA, Briant DJ, Pece-Barbara N, Le Roy C, Di Guglielmo GM, Kavsak P, Rasmussen RK, Seet BT, Sicheri F, Wrana JL", "reference": { "type": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 535, "end_pos": 535, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 535, "end_pos": 535, "sequence_org": "W", "sequence_mut": "D", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 547, "end_pos": 547, "sequence_org": "H", "sequence_mut": "A", "comment": "Partial loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 547, "end_pos": 547, "sequence_org": "H", "sequence_mut": "F", "comment": "Activates autocatalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 547, "end_pos": 547, "sequence_org": "H", "sequence_mut": "I", "comment": "Activates autocatalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 581, "end_pos": 581, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "16061177", "url": "https://pubmed.ncbi.nlm.nih.gov/16061177" } ], "uniprot_canonical_ac": "Q9HAU4-1" } ], "record_id": "pubmed.16061177", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein phosphatase-1 targeting subunit TIMAP regulates LAMR1 phosphorylation.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Kim Kwanghee, Li Laiji, Kozlowski Kathy, Suh Hyeon-Sook, Cao Wangsen, Ballermann Barbara J", "reference": { "type": "PubMed", "id": "16263087", "url": "https://pubmed.ncbi.nlm.nih.gov/16263087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96T49-1", "protein_name": "Protein phosphatase 1 regulatory inhibitor subunit 16B", "gene_name": "PPP1R16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08865-1", "protein_name": "Small ribosomal subunit protein uS2", "gene_name": "RPSA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16263087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of Fer induces PP1 activation and cell-cycle arrest in malignant cells.", "journal": "Oncogene", "date": "2006", "authors": "Pasder O, Shpungin S, Salem Y, Makovsky A, Vilchick S, Michaeli S, Malovani H, Nir U", "reference": { "type": "PubMed", "id": "16732323", "url": "https://pubmed.ncbi.nlm.nih.gov/16732323" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P70451-1", "protein_name": "Tyrosine-protein kinase Fer", "gene_name": "Fer", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16732323", "url": "https://pubmed.ncbi.nlm.nih.gov/16732323" }, { "database": "PubMed", "id": "18088087", "url": "https://pubmed.ncbi.nlm.nih.gov/18088087" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "9122166", "url": "https://pubmed.ncbi.nlm.nih.gov/9122166" }, { "database": "PubMed", "id": "10506210", "url": "https://pubmed.ncbi.nlm.nih.gov/10506210" }, { "database": "PubMed", "id": "21331744", "url": "https://pubmed.ncbi.nlm.nih.gov/21331744" }, { "database": "PubMed", "id": "25556058", "url": "https://pubmed.ncbi.nlm.nih.gov/25556058" }, { "database": "PubMed", "id": "26891914", "url": "https://pubmed.ncbi.nlm.nih.gov/26891914" }, { "database": "PubMed", "id": "9197238", "url": "https://pubmed.ncbi.nlm.nih.gov/9197238" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" } ], "mutagenesis": [ { "start_pos": 606, "end_pos": 606, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes interaction with PPP1CA.", "evidence": [ { "database": "UniProtKB", "id": "P70451", "url": "https://www.uniprot.org/uniprotkb/P70451" }, { "database": "PubMed", "id": "16732323", "url": "https://pubmed.ncbi.nlm.nih.gov/16732323" } ], "uniprot_canonical_ac": "P70451-1" } ], "record_id": "pubmed.16732323", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of protein phosphatase 1 by cyclin-dependent protein kinase 5 during nerve growth factor-induced PC12 cell differentiation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Li T, Chalifour LE, Paudel HK", "reference": { "type": "PubMed", "id": "17202132", "url": "https://pubmed.ncbi.nlm.nih.gov/17202132" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02399-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Bovine" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "Q00535-1", "kinase_gene_name": "CDK5", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P62136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62136" }, { "database": "PubMed", "id": "17202132", "url": "https://pubmed.ncbi.nlm.nih.gov/17202132" }, { "database": "PubMed", "id": "12202491", "url": "https://pubmed.ncbi.nlm.nih.gov/12202491" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P62136-1" } ], "record_id": "pubmed.17202132", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nuclear PP1 interacting protein ZAP3 (ZAP) is a putative nucleoside kinase that complexes with SAM68, CIA, NF110/45, and HNRNP-G.", "journal": "Biochim. Biophys. Acta", "date": "2007", "authors": "Ulke-Lemee A, Trinkle-Mulcahy L, Chaulk S, Bernstein NK, Morrice N, Glover M, Lamond AI, Moorhead GB", "reference": { "type": "PubMed", "id": "17890166", "url": "https://pubmed.ncbi.nlm.nih.gov/17890166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62138-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "Ppp1ca", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49750-4", "protein_name": "YLP motif-containing protein 1", "gene_name": "YLPM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12905-1", "protein_name": "Interleukin enhancer-binding factor 2", "gene_name": "ILF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCD5-1", "protein_name": "Nuclear receptor coactivator 5", "gene_name": "NCOA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12906-1", "protein_name": "Interleukin enhancer-binding factor 3", "gene_name": "ILF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07666-1", "protein_name": "KH domain-containing, RNA-binding, signal transduction-associated protein 1", "gene_name": "KHDRBS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CB49-1", "protein_name": "YLP motif-containing protein 1", "gene_name": "Ylpm1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P38159-1", "protein_name": "RNA-binding motif protein, X chromosome", "gene_name": "RBMX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17890166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NOM1 targets protein phosphatase I to the nucleolus.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Gunawardena SR, Ruis BL, Meyer JA, Kapoor M, Conklin KF", "reference": { "type": "PubMed", "id": "17965019", "url": "https://pubmed.ncbi.nlm.nih.gov/17965019" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5C9Z4-1", "protein_name": "Nucleolar MIF4G domain-containing protein 1", "gene_name": "NOM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 308, "end_pos": 308, "sequence_org": "V", "sequence_mut": "A", "comment": "Loss of interaction with PPP1CA and loss of ability to relocalize PPP1CA to the nucleolus; when associated with A-310.", "evidence": [ { "database": "UniProtKB", "id": "Q5C9Z4", "url": "https://www.uniprot.org/uniprotkb/Q5C9Z4" }, { "database": "PubMed", "id": "17965019", "url": "https://pubmed.ncbi.nlm.nih.gov/17965019" } ], "uniprot_canonical_ac": "Q5C9Z4-1" }, { "start_pos": 310, "end_pos": 310, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of interaction with PPP1CA and loss of ability to relocalize PPP1CA to the nucleolus; when associated with A-308.", "evidence": [ { "database": "UniProtKB", "id": "Q5C9Z4", "url": "https://www.uniprot.org/uniprotkb/Q5C9Z4" }, { "database": "PubMed", "id": "17965019", "url": "https://pubmed.ncbi.nlm.nih.gov/17965019" } ], "uniprot_canonical_ac": "Q5C9Z4-1" } ], "record_id": "pubmed.17965019", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of protein phosphatase-1 bound to nodularin-R and tautomycin: a novel scaffold for structure-based drug design of serine/threonine phosphatase inhibitors.", "journal": "J. Mol. Biol.", "date": "2009", "authors": "Kelker Matthew S, Page Rebecca, Peti Wolfgang", "reference": { "type": "PubMed", "id": "18992256", "url": "https://pubmed.ncbi.nlm.nih.gov/18992256" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18992256", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Docking motif-guided mapping of the interactome of protein phosphatase-1.", "journal": "Chem. Biol.", "date": "2009", "authors": "Hendrickx Annick, Beullens Monique, Ceulemans Hugo, Den Abt Tom, Van Eynde Aleyde, Nicolaescu Emilia, Lesage Bart, Bollen Mathieu", "reference": { "type": "PubMed", "id": "19389623", "url": "https://pubmed.ncbi.nlm.nih.gov/19389623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C7U0-1", "protein_name": "Protein ELFN1", "gene_name": "ELFN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75864-1", "protein_name": "Protein phosphatase 1 regulatory subunit 37", "gene_name": "PPP1R37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LQ0-1", "protein_name": "Protein phosphatase 1 regulatory subunit 36", "gene_name": "PPP1R36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAP8-1", "protein_name": "Protein phosphatase 1 regulatory subunit 35", "gene_name": "PPP1R35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMI0-1", "protein_name": "Protein phosphatase 1 regulatory subunit 21", "gene_name": "PPP1R21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5V6-1", "protein_name": "Stabilizer of axonemal microtubules 4", "gene_name": "SAXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T8A7-1", "protein_name": "Protein phosphatase 1 regulatory subunit 26", "gene_name": "PPP1R26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WC6-1", "protein_name": "Protein phosphatase 1 regulatory subunit 27", "gene_name": "PPP1R27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEC5-1", "protein_name": "E3 ubiquitin-protein ligase SH3RF2", "gene_name": "SH3RF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5R3F8-1", "protein_name": "Protein phosphatase 1 regulatory subunit 29", "gene_name": "ELFN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19389623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dab2 stabilizes Axin and attenuates Wnt/beta-catenin signaling by preventing protein phosphatase 1 (PP1)-Axin interactions.", "journal": "Oncogene", "date": "2009", "authors": "Jiang Y, Luo W, Howe P H", "reference": { "type": "PubMed", "id": "19581931", "url": "https://pubmed.ncbi.nlm.nih.gov/19581931" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "F1QJE5-1", "protein_name": "Protein phosphatase 1G", "gene_name": "ppm1g", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "P98078-1", "protein_name": "Disabled homolog 2", "gene_name": "Dab2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35625-1", "protein_name": "Axin-1", "gene_name": "Axin1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19581931", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human BAMBI cooperates with Smad7 to inhibit transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Yan X, Lin Z, Chen F, Zhao X, Chen H, Ning Y, Chen YG", "reference": { "type": "PubMed", "id": "19758997", "url": "https://pubmed.ncbi.nlm.nih.gov/19758997" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19758997", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MTMR4 attenuates transforming growth factor beta (TGFbeta) signaling by dephosphorylating R-Smads in endosomes.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Yu J, Pan L, Qin X, Chen H, Xu Y, Chen Y, Tang H", "reference": { "type": "PubMed", "id": "20061380", "url": "https://pubmed.ncbi.nlm.nih.gov/20061380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20061380", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling.", "journal": "Molecular cell", "date": "2010", "authors": "Watanabe Y, Itoh S, Goto T, Ohnishi E, Inamitsu M, Itoh F, Satoh K, Wiercinska E, Yang W, Shi L, Tanaka A, Nakano N, Mommaas AM, Shibuya H, Ten Dijke P, Kato M", "reference": { "type": "PubMed", "id": "20129061", "url": "https://pubmed.ncbi.nlm.nih.gov/20129061" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D7R2-1", "protein_name": "Protein TMEPAI", "gene_name": "Pmepa1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 368, "end_pos": 368, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of interaction with PMEPA1.", "evidence": [ { "database": "UniProtKB", "id": "Q15796", "url": "https://www.uniprot.org/uniprotkb/Q15796" }, { "database": "PubMed", "id": "20129061", "url": "https://pubmed.ncbi.nlm.nih.gov/20129061" } ], "uniprot_canonical_ac": "Q15796-1" } ], "record_id": "pubmed.20129061", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.", "journal": "Nat. Struct. Mol. Biol.", "date": "2010", "authors": "Ragusa Michael J, Dancheck Barbara, Critton David A, Nairn Angus C, Page Rebecca, Peti Wolfgang", "reference": { "type": "PubMed", "id": "20305656", "url": "https://pubmed.ncbi.nlm.nih.gov/20305656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35867-1", "protein_name": "Neurabin-1", "gene_name": "Ppp1r9a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35274-1", "protein_name": "Neurabin-2", "gene_name": "Ppp1r9b", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62136", "url": "https://www.uniprot.org/uniprotkb/P62136" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20305656", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]