[ { "title": "Effect of PTGES3 on the Prognosis and Immune Regulation in Lung Adenocarcinoma.", "journal": "Analytical cellular pathology (Amsterdam)", "date": "2023", "authors": "Jiang Wenyan, Wei Qiong, Xie Haiqin, Wu Dandan, He Haiyan, Lv Xuedong", "reference": { "type": "PubMed", "id": "37416927", "url": "https://pubmed.ncbi.nlm.nih.gov/37416927" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37416927", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The integration of multidisciplinary approaches revealed PTGES3 as a novel drug target for breast cancer treatment.", "journal": "Journal of translational medicine", "date": "2024-01-20", "authors": "Yin Qinan, Ma Haodi, Dong Yirui, Zhang Shunshun, Wang Junxiang, Liang Jing, Mao Longfei, Zeng Li, Xiong Xin, Chen Xingang, Wang Jingjing, Zheng Xuewei", "reference": { "type": "PubMed", "id": "38245717", "url": "https://pubmed.ncbi.nlm.nih.gov/38245717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38245717", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transformation of prostaglandin D2 to 9 alpha, 11 beta-(15S)-trihydroxyprosta-(5Z,13E)-dien-1-oic acid (9 alpha, 11 beta-prostaglandin F2): a unique biologically active prostaglandin produced enzymatically in vivo in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Liston TE, Roberts LJ 2nd", "reference": { "type": "PubMed", "id": "3862115", "url": "https://pubmed.ncbi.nlm.nih.gov/3862115" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3862115", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and properties of lung 15-hydroxyprostaglandin dehydrogenase from pregnant rabbits.", "journal": "Archives of biochemistry and biophysics", "date": "1986", "authors": "Bergholte JM, Okita RT", "reference": { "type": "PubMed", "id": "3954355", "url": "https://pubmed.ncbi.nlm.nih.gov/3954355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3954355", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Detection and isolation of an endoperoxide intermediate in prostaglandin biosynthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1973", "authors": "Hamberg M, Samuelsson B", "reference": { "type": "PubMed", "id": "4514999", "url": "https://pubmed.ncbi.nlm.nih.gov/4514999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4514999", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and structure of two prostaglandin endoperoxides that cause platelet aggregation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1974", "authors": "Hamberg M, Svensson J, Wakabayashi T, Samuelsson B", "reference": { "type": "PubMed", "id": "4521806", "url": "https://pubmed.ncbi.nlm.nih.gov/4521806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4521806", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and properties of intermediates in prostaglandin biosynthesis.", "journal": "Biochimica et biophysica acta", "date": "1973", "authors": "Nugteren DH, Hazelhof E", "reference": { "type": "PubMed", "id": "4776443", "url": "https://pubmed.ncbi.nlm.nih.gov/4776443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4776443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of prostaglandin synthesis as a mechanism of action for aspirin-like drugs.", "journal": "Nature: New biology", "date": "1971", "authors": "Vane JR", "reference": { "type": "PubMed", "id": "5284360", "url": "https://pubmed.ncbi.nlm.nih.gov/5284360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.5284360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Common non-hormone binding component in non-transformed chick oviduct receptors of four steroid hormones.", "journal": "Nature", "date": "1984", "authors": "Joab I, Radanyi C, Renoir M, Buchou T, Catelli MG, Binart N, Mester J, Baulieu EE", "reference": { "type": "PubMed", "id": "6201744", "url": "https://pubmed.ncbi.nlm.nih.gov/6201744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6201744", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of progestagens to receptor proteins in MCF-7 cells.", "journal": "Journal of steroid biochemistry", "date": "1983", "authors": "Bergink EW, van Meel F, Turpijn EW, van der Vies J", "reference": { "type": "PubMed", "id": "6645495", "url": "https://pubmed.ncbi.nlm.nih.gov/6645495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6645495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Relative binding affinities of testosterone, 19-nortestosterone and their 5 alpha-reduced derivatives to the androgen receptor and to other androgen-binding proteins: a suggested role of 5 alpha-reductive steroid metabolism in the dissociation of `myotropic` and `androgenic` activities of 19-nortestosterone.", "journal": "Journal of steroid biochemistry", "date": "1982", "authors": "Toth M, Zakar T", "reference": { "type": "PubMed", "id": "6891012", "url": "https://pubmed.ncbi.nlm.nih.gov/6891012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6891012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and properties of an NADPH-dependent carbonyl reductase from human brain. Relationship to prostaglandin 9-ketoreductase and xenobiotic ketone reductase.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Wermuth B", "reference": { "type": "PubMed", "id": "7005231", "url": "https://pubmed.ncbi.nlm.nih.gov/7005231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7005231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural basis of aspirin activity inferred from the crystal structure of inactivated prostaglandin H2 synthase.", "journal": "Nature structural biology", "date": "1995", "authors": "Loll PJ, Picot D, Garavito RM", "reference": { "type": "PubMed", "id": "7552725", "url": "https://pubmed.ncbi.nlm.nih.gov/7552725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7552725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stimulation of estrogen receptor-mediated transcription and alteration in the phosphorylation state of the rat uterine estrogen receptor by estrogen, cyclic adenosine monophosphate, and insulin-like growth factor-I.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "Aronica SM, Katzenellenbogen BS", "reference": { "type": "PubMed", "id": "7689695", "url": "https://pubmed.ncbi.nlm.nih.gov/7689695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7689695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HER-2 tyrosine kinase pathway targets estrogen receptor and promotes hormone-independent growth in human breast cancer cells.", "journal": "Oncogene", "date": "1995", "authors": "Pietras RJ, Arboleda J, Reese DM, Wongvipat N, Pegram MD, Ramos L, Gorman CM, Parker MG, Sliwkowski MX, Slamon DJ", "reference": { "type": "PubMed", "id": "7784095", "url": "https://pubmed.ncbi.nlm.nih.gov/7784095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7784095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subunit structure of the nonactivated human estrogen receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Segnitz B, Gehring U", "reference": { "type": "PubMed", "id": "7892243", "url": "https://pubmed.ncbi.nlm.nih.gov/7892243" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7892243", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamics of heat shock protein 90-progesterone receptor binding and the disactivation loop model for steroid receptor complexes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "Smith DF", "reference": { "type": "PubMed", "id": "7906860", "url": "https://pubmed.ncbi.nlm.nih.gov/7906860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7906860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the human gene (TBXAS1) encoding thromboxane synthase.", "journal": "European journal of biochemistry", "date": "1994", "authors": "Miyata A, Yokoyama C, Ihara H, Bandoh S, Takeda O, Takahashi E, Tanabe T", "reference": { "type": "PubMed", "id": "7925341", "url": "https://pubmed.ncbi.nlm.nih.gov/7925341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7925341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification, characterization and selective inhibition of human prostaglandin G/H synthase 1 and 2 expressed in the baculovirus system.", "journal": "Biochimica et biophysica acta", "date": "1994", "authors": "Barnett J, Chow J, Ives D, Chiou M, Mackenzie R, Osen E, Nguyen B, Tsing S, Bach C, Freire J, et al.", "reference": { "type": "PubMed", "id": "7947975", "url": "https://pubmed.ncbi.nlm.nih.gov/7947975" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7947975", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dioxin binding activities of polymorphic forms of mouse and human arylhydrocarbon receptors.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ema M, Ohe N, Suzuki M, Mimura J, Sogawa K, Ikawa S, Fujii-Kuriyama Y", "reference": { "type": "PubMed", "id": "7961644", "url": "https://pubmed.ncbi.nlm.nih.gov/7961644" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A9YTQ3-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "AHRR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35869-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "AHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27540-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBZ2-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator 2", "gene_name": "ARNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30561-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "Ahr", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00170-1", "protein_name": "AH receptor-interacting protein", "gene_name": "AIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 381, "end_pos": 381, "sequence_org": "V", "sequence_mut": "A", "comment": "Increases specific ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "P35869", "url": "https://www.uniprot.org/uniprotkb/P35869" }, { "database": "PubMed", "id": "7961644", "url": "https://pubmed.ncbi.nlm.nih.gov/7961644" } ], "uniprot_canonical_ac": "P35869-1" }, { "start_pos": 381, "end_pos": 381, "sequence_org": "V", "sequence_mut": "D", "comment": "Abolishes specific ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "P35869", "url": "https://www.uniprot.org/uniprotkb/P35869" }, { "database": "PubMed", "id": "7961644", "url": "https://pubmed.ncbi.nlm.nih.gov/7961644" } ], "uniprot_canonical_ac": "P35869-1" }, { "start_pos": 381, "end_pos": 381, "sequence_org": "V", "sequence_mut": "G", "comment": "No effect on specific ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "P35869", "url": "https://www.uniprot.org/uniprotkb/P35869" }, { "database": "PubMed", "id": "7961644", "url": "https://pubmed.ncbi.nlm.nih.gov/7961644" } ], "uniprot_canonical_ac": "P35869-1" }, { "start_pos": 381, "end_pos": 381, "sequence_org": "V", "sequence_mut": "L", "comment": "No effect on specific ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "P35869", "url": "https://www.uniprot.org/uniprotkb/P35869" }, { "database": "PubMed", "id": "7961644", "url": "https://pubmed.ncbi.nlm.nih.gov/7961644" } ], "uniprot_canonical_ac": "P35869-1" } ], "record_id": "pubmed.7961644", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insulin-like growth factors activate estrogen receptor to control the growth and differentiation of the human neuroblastoma cell line SK-ER3.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Ma ZQ, Santagati S, Patrone C, Pollio G, Vegeto E, Maggi A", "reference": { "type": "PubMed", "id": "7984152", "url": "https://pubmed.ncbi.nlm.nih.gov/7984152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7984152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cooperative interaction of human HSF1 heat shock transcription factor with promoter DNA.", "journal": "Nucleic acids research", "date": "1994", "authors": "Wang Y, Morgan WD", "reference": { "type": "PubMed", "id": "8065924", "url": "https://pubmed.ncbi.nlm.nih.gov/8065924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN7-1", "protein_name": "Protein deacetylase HDAC6", "gene_name": "HDAC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68104-1", "protein_name": "Elongation factor 1-alpha 1", "gene_name": "EEF1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55072-1", "protein_name": "Transitional endoplasmic reticulum ATPase", "gene_name": "VCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75506-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "HSBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8065924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a novel 23-kilodalton protein of unactive progesterone receptor complexes.", "journal": "Mol. Cell. Biol.", "date": "1994", "authors": "Johnson J L, Beito T G, Krco C J, Toft D O", "reference": { "type": "PubMed", "id": "8114727", "url": "https://pubmed.ncbi.nlm.nih.gov/8114727" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q90955-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Chicken" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8114727", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impaired renal 11 beta-oxidation of 9 alpha-fluorocortisol: an explanation for its mineralocorticoid potency.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Oelkers W, Buchen S, Diederich S, Krain J, Muhme S, Schoneshofer M", "reference": { "type": "PubMed", "id": "8157723", "url": "https://pubmed.ncbi.nlm.nih.gov/8157723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8157723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acetylation of human prostaglandin endoperoxide synthase-2 (cyclooxygenase-2) by aspirin.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Lecomte M, Laneuville O, Ji C, DeWitt DL, Smith WL", "reference": { "type": "PubMed", "id": "8175750", "url": "https://pubmed.ncbi.nlm.nih.gov/8175750" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8175750", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The unliganded estrogen receptor (ER) transduces growth factor signals.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1994", "authors": "Newton CJ, Buric R, Trapp T, Brockmeier S, Pagotto U, Stalla GK", "reference": { "type": "PubMed", "id": "8180109", "url": "https://pubmed.ncbi.nlm.nih.gov/8180109" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8180109", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements.", "journal": "Cell", "date": "1993", "authors": "Schwabe JW, Chapman L, Finch JT, Rhodes D", "reference": { "type": "PubMed", "id": "8221895", "url": "https://pubmed.ncbi.nlm.nih.gov/8221895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8221895", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptide growth factors elicit estrogen receptor-dependent transcriptional activation of an estrogen-responsive element.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "Ignar-Trowbridge DM, Teng CT, Ross KA, Parker MG, Korach KS, McLachlan JA", "reference": { "type": "PubMed", "id": "8232319", "url": "https://pubmed.ncbi.nlm.nih.gov/8232319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8232319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pharmacological and functional characterization of human mineralocorticoid and glucocorticoid receptor ligands.", "journal": "European journal of pharmacology", "date": "1993", "authors": "Rupprecht R, Reul JM, van Steensel B, Spengler D, Soder M, Berning B, Holsboer F, Damm K", "reference": { "type": "PubMed", "id": "8282004", "url": "https://pubmed.ncbi.nlm.nih.gov/8282004" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8282004", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of the ligand-independent activation of the human estrogen receptor by hormone and antihormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Smith CL, Conneely OM, O'Malley BW", "reference": { "type": "PubMed", "id": "8327492", "url": "https://pubmed.ncbi.nlm.nih.gov/8327492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8327492", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of human heat shock genes is accompanied by oligomerization, modification, and rapid translocation of heat shock transcription factor HSF1.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Baler R, Dahl G, Voellmy R", "reference": { "type": "PubMed", "id": "8455624", "url": "https://pubmed.ncbi.nlm.nih.gov/8455624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13554-1", "protein_name": "Calcium/calmodulin-dependent protein kinase type II subunit beta", "gene_name": "CAMK2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQM7-1", "protein_name": "Calcium/calmodulin-dependent protein kinase type II subunit alpha", "gene_name": "CAMK2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02511-1", "protein_name": "Alpha-crystallin B chain", "gene_name": "CRYAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN7-1", "protein_name": "Protein deacetylase HDAC6", "gene_name": "HDAC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2D1-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-5", "gene_name": "ATF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61604-1", "protein_name": "10 kDa heat shock protein, mitochondrial", "gene_name": "HSPE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01523-1", "protein_name": "Defensin alpha 5", "gene_name": "DEFA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36776-1", "protein_name": "Lon protease homolog, mitochondrial", "gene_name": "LONP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVC4-1", "protein_name": "Target of rapamycin complex subunit LST8", "gene_name": "MLST8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68104-1", "protein_name": "Elongation factor 1-alpha 1", "gene_name": "EEF1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55072-1", "protein_name": "Transitional endoplasmic reticulum ATPase", "gene_name": "VCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N122-1", "protein_name": "Regulatory-associated protein of mTOR", "gene_name": "RPTOR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42345-1", "protein_name": "Serine/threonine-protein kinase mTOR", "gene_name": "MTOR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13557-1", "protein_name": "Calcium/calmodulin-dependent protein kinase type II subunit delta", "gene_name": "CAMK2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJY1-1", "protein_name": "Heat shock protein beta-8", "gene_name": "HSPB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43464-1", "protein_name": "Serine protease HTRA2, mitochondrial", "gene_name": "HTRA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10809-1", "protein_name": "60 kDa heat shock protein, mitochondrial", "gene_name": "HSPD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13555-1", "protein_name": "Calcium/calmodulin-dependent protein kinase type II subunit gamma", "gene_name": "CAMK2G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75506-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "HSBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16656-1", "protein_name": "Nuclear respiratory factor 1", "gene_name": "NRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B36-1", "protein_name": "Proline-rich AKT1 substrate 1", "gene_name": "AKT1S1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8455624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The preclinical development of bicalutamide: pharmacodynamics and mechanism of action.", "journal": "Urology", "date": "1996", "authors": "Furr BJ, Tucker H", "reference": { "type": "PubMed", "id": "8560673", "url": "https://pubmed.ncbi.nlm.nih.gov/8560673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8560673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of the unliganded estrogen receptor by EGF involves the MAP kinase pathway and direct phosphorylation.", "journal": "The EMBO journal", "date": "1996", "authors": "Bunone G, Briand PA, Miksicek RJ, Picard D", "reference": { "type": "PubMed", "id": "8641283", "url": "https://pubmed.ncbi.nlm.nih.gov/8641283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8641283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Flexibility of the NSAID binding site in the structure of human cyclooxygenase-2.", "journal": "Nature structural biology", "date": "1996", "authors": "Luong C, Miller A, Barnett J, Chow J, Ramesha C, Browner MF", "reference": { "type": "PubMed", "id": "8901870", "url": "https://pubmed.ncbi.nlm.nih.gov/8901870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8901870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the ligand binding specificity and transcript tissue distribution of estrogen receptors alpha and beta.", "journal": "Endocrinology", "date": "1997", "authors": "Kuiper GG, Carlsson B, Grandien K, Enmark E, Haggblad J, Nilsson S, Gustafsson JA", "reference": { "type": "PubMed", "id": "9048584", "url": "https://pubmed.ncbi.nlm.nih.gov/9048584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9048584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selective interaction of hsp90 with an estrogen receptor ligand-binding domain containing a point mutation.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Aumais JP, Lee HS, Lin R, White JH", "reference": { "type": "PubMed", "id": "9115298", "url": "https://pubmed.ncbi.nlm.nih.gov/9115298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9115298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential allosteric regulation of prostaglandin H synthase 1 and 2 by arachidonic acid.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Swinney DC, Mak AY, Barnett J, Ramesha CS", "reference": { "type": "PubMed", "id": "9139685", "url": "https://pubmed.ncbi.nlm.nih.gov/9139685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9139685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Steroid receptor interactions with heat shock protein and immunophilin chaperones.", "journal": "Endocrine reviews", "date": "1997", "authors": "Pratt WB, Toft DO", "reference": { "type": "PubMed", "id": "9183567", "url": "https://pubmed.ncbi.nlm.nih.gov/9183567" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9183567", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of action of aspirin-like drugs.", "journal": "Seminars in arthritis and rheumatism", "date": "1997", "authors": "Vane JR, Botting RM", "reference": { "type": "PubMed", "id": "9219313", "url": "https://pubmed.ncbi.nlm.nih.gov/9219313" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9219313", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The amino-terminal domain of heat shock protein 90 (hsp90) that binds geldanamycin is an ATP/ADP switch domain that regulates hsp90 conformation.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Grenert JP, Sullivan WP, Fadden P, Haystead TA, Clark J, Mimnaugh E, Krutzsch H, Ochel HJ, Schulte TW, Sausville E, Neckers LM, Toft DO", "reference": { "type": "PubMed", "id": "9295332", "url": "https://pubmed.ncbi.nlm.nih.gov/9295332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9295332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dimerizing the estrogen receptor DNA binding domain enhances binding to estrogen response elements.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kuntz MA, Shapiro DJ", "reference": { "type": "PubMed", "id": "9346945", "url": "https://pubmed.ncbi.nlm.nih.gov/9346945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9346945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hepatitis B virus X-associated protein 2 is a subunit of the unliganded aryl hydrocarbon receptor core complex and exhibits transcriptional enhancer activity.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Meyer BK, Pray-Grant MG, Vanden Heuvel JP, Perdew GH", "reference": { "type": "PubMed", "id": "9447995", "url": "https://pubmed.ncbi.nlm.nih.gov/9447995" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A9YTQ3-1", "protein_name": "Aryl hydrocarbon receptor repressor", "gene_name": "AHRR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35869-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "AHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27540-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator", "gene_name": "ARNT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBZ2-1", "protein_name": "Aryl hydrocarbon receptor nuclear translocator 2", "gene_name": "ARNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00170-1", "protein_name": "AH receptor-interacting protein", "gene_name": "AIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9447995", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "5-Aryl-1,2-dihydrochromeno[3,4-f]quinolines: a novel class of nonsteroidal human progesterone receptor agonists.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Zhi L, Tegley CM, Kallel EA, Marschke KB, Mais DE, Gottardis MM, Jones TK", "reference": { "type": "PubMed", "id": "9464360", "url": "https://pubmed.ncbi.nlm.nih.gov/9464360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9464360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "5-Aryl-1,2-dihydro-5H-chromeno[3,4-f]quinolines as potent, orally active, nonsteroidal progesterone receptor agonists: the effect of D-ring substituents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Edwards JP, West SJ, Marschke KB, Mais DE, Gottardis MM, Jones TK", "reference": { "type": "PubMed", "id": "9464361", "url": "https://pubmed.ncbi.nlm.nih.gov/9464361" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9464361", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclooxygenase-1 and cyclooxygenase-2 selectivity of widely used nonsteroidal anti-inflammatory drugs.", "journal": "The American journal of medicine", "date": "1998", "authors": "Cryer B, Feldman M", "reference": { "type": "PubMed", "id": "9626023", "url": "https://pubmed.ncbi.nlm.nih.gov/9626023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42330-1", "protein_name": "Aldo-keto reductase family 1 member C3", "gene_name": "AKR1C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF2-1", "protein_name": "Prostamide/prostaglandin F synthase", "gene_name": "PRXL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35354-1", "protein_name": "Prostaglandin G/H synthase 2", "gene_name": "PTGS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23219-1", "protein_name": "Prostaglandin G/H synthase 1", "gene_name": "PTGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7Z7-1", "protein_name": "Prostaglandin E synthase 2", "gene_name": "PTGES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60760-1", "protein_name": "Hematopoietic prostaglandin D synthase", "gene_name": "HPGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15428-1", "protein_name": "15-hydroxyprostaglandin dehydrogenase [NAD(+)]", "gene_name": "HPGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8N7-1", "protein_name": "Prostaglandin reductase 2", "gene_name": "PTGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14684-1", "protein_name": "Prostaglandin E synthase", "gene_name": "PTGES", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16152-1", "protein_name": "Carbonyl reductase [NADPH] 1", "gene_name": "CBR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9626023", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Preparation, resolution, and biological evaluation of 5-aryl-1, 2-dihydro-5H-chromeno[3,4-f]quinolines: potent, orally active, nonsteroidal progesterone receptor agonists.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Edwards JP, Zhi L, Pooley CL, Tegley CM, West SJ, Wang MW, Gottardis MM, Pathirana C, Schrader WT, Jones TK", "reference": { "type": "PubMed", "id": "9667968", "url": "https://pubmed.ncbi.nlm.nih.gov/9667968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60884-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "DNAJA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25685-1", "protein_name": "DnaJ homolog subfamily B member 1", "gene_name": "DNAJB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34931-1", "protein_name": "Heat shock 70 kDa protein 1-like", "gene_name": "HSPA1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54652-1", "protein_name": "Heat shock-related 70 kDa protein 2", "gene_name": "HSPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06401-1", "protein_name": "Progesterone receptor", "gene_name": "PGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WW22-1", "protein_name": "DnaJ homolog subfamily A member 4", "gene_name": "DNAJA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08235-1", "protein_name": "Mineralocorticoid receptor", "gene_name": "NR3C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31948-1", "protein_name": "Stress-induced-phosphoprotein 1", "gene_name": "STIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9667968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATP binding and hydrolysis are essential to the function of the Hsp90 molecular chaperone in vivo.", "journal": "The EMBO journal", "date": "1998", "authors": "Panaretou B, Prodromou C, Roe SM, O'Brien R, Ladbury JE, Piper PW, Pearl LH", "reference": { "type": "PubMed", "id": "9707442", "url": "https://pubmed.ncbi.nlm.nih.gov/9707442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9707442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repression of heat shock transcription factor HSF1 activation by HSP90 (HSP90 complex) that forms a stress-sensitive complex with HSF1.", "journal": "Cell", "date": "1998", "authors": "Zou J, Guo Y, Guettouche T, Smith DF, Voellmy R", "reference": { "type": "PubMed", "id": "9727490", "url": "https://pubmed.ncbi.nlm.nih.gov/9727490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN7-1", "protein_name": "Protein deacetylase HDAC6", "gene_name": "HDAC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68104-1", "protein_name": "Elongation factor 1-alpha 1", "gene_name": "EEF1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55072-1", "protein_name": "Transitional endoplasmic reticulum ATPase", "gene_name": "VCP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75506-1", "protein_name": "Heat shock factor-binding protein 1", "gene_name": "HSBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62258-1", "protein_name": "14-3-3 protein epsilon", "gene_name": "YWHAE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9727490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In vivo function of Hsp90 is dependent on ATP binding and ATP hydrolysis.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Obermann WM, Sondermann H, Russo AA, Pavletich NP, Hartl FU", "reference": { "type": "PubMed", "id": "9817749", "url": "https://pubmed.ncbi.nlm.nih.gov/9817749" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92731-1", "protein_name": "Estrogen receptor beta", "gene_name": "ESR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08752-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase D", "gene_name": "PPID", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13451-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP5", "gene_name": "FKBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02829-1", "protein_name": "ATP-dependent molecular chaperone HSP82", "gene_name": "HSP82", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15185", "url": "https://www.uniprot.org/uniprotkb/Q15185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9817749", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.", "journal": "Genomics", "date": "2002", "authors": "Gardiner Katheleen, Slavov Dobromir, Bechtel Lawrence, Davisson Muriel", "reference": { "type": "PubMed", "id": "12036298", "url": "https://pubmed.ncbi.nlm.nih.gov/12036298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57071-7", "protein_name": "PR domain zinc finger protein 15", "gene_name": "PRDM15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58511-1", "protein_name": "Small integral membrane protein 11", "gene_name": "SMIM11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14689-1", "protein_name": "Disco-interacting protein 2 homolog A", "gene_name": "DIP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ7-1", "protein_name": "Putative uncharacterized protein encoded by LINC00308", "gene_name": "LINC00308", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57052-1", "protein_name": "Splicing regulator RBM11", "gene_name": "RBM11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX36-1", "protein_name": "DnaJ homolog subfamily C member 28", "gene_name": "DNAJC28", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12036298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel putative membrane proteins selectively expressed during adipose conversion of 3T3-L1 cells.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Xu A, Choi KL, Wang Y, Permana PA, Xu LY, Bogardus C, Cooper GJ", "reference": { "type": "PubMed", "id": "12054497", "url": "https://pubmed.ncbi.nlm.nih.gov/12054497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D159-1", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "Mrap", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12054497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of the human adrenocorticotropin receptor [melanocortin-2 receptor (MC2R)] by human MC2R accessory protein isoforms alpha and beta in isogenic human embryonic kidney 293 cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Roy S, Rached M, Gallo-Payet N", "reference": { "type": "PubMed", "id": "17456795", "url": "https://pubmed.ncbi.nlm.nih.gov/17456795" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17456795", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical and biological phenotype of a patient with familial glucocorticoid deficiency type 2 caused by a mutation of melanocortin 2 receptor accessory protein.", "journal": "European journal of endocrinology", "date": "2007", "authors": "Rumie H, Metherell LA, Clark AJ, Beauloye V, Maes M", "reference": { "type": "PubMed", "id": "17893271", "url": "https://pubmed.ncbi.nlm.nih.gov/17893271" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17893271", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Melanocortin-2 receptor accessory protein MRAP forms antiparallel homodimers.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Sebag JA, Hinkle PM", "reference": { "type": "PubMed", "id": "18077336", "url": "https://pubmed.ncbi.nlm.nih.gov/18077336" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18077336", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct melanocortin 2 receptor accessory protein domains are required for melanocortin 2 receptor interaction and promotion of receptor trafficking.", "journal": "Endocrinology", "date": "2009", "authors": "Webb TR, Chan L, Cooray SN, Cheetham ME, Chapple JP, Clark AJ", "reference": { "type": "PubMed", "id": "18818285", "url": "https://pubmed.ncbi.nlm.nih.gov/18818285" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18818285", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Determination of alpha-2-MRAP gene polymorphisms in nephrolithiasis patients.", "journal": "International journal of biological macromolecules", "date": "2017", "authors": "Mehde AA, Mehdi WA, Yusof F, Raus RA, Abidin ZAZ, Ghazali H, Rahman AA", "reference": { "type": "PubMed", "id": "28760704", "url": "https://pubmed.ncbi.nlm.nih.gov/28760704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28760704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of Lipolytic Response and Energy Balance by Melanocortin 2 Receptor Accessory Protein (MRAP) in Adipocytes.", "journal": "Diabetes", "date": "2018", "authors": "Zhang X, Saarinen AM, Campbell LE, De Filippis EA, Liu J", "reference": { "type": "PubMed", "id": "29217655", "url": "https://pubmed.ncbi.nlm.nih.gov/29217655" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCY5-4", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "MRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D159-1", "protein_name": "Melanocortin-2 receptor accessory protein", "gene_name": "Mrap", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCY5", "url": "https://www.uniprot.org/uniprotkb/Q8TCY5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29217655", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3).", "journal": "Biochem. Biophys. Res. Commun.", "date": "1999", "authors": "Race JE, Grassl SM, Williams WJ, Holtzman EJ", "reference": { "type": "PubMed", "id": "10049739", "url": "https://pubmed.ncbi.nlm.nih.gov/10049739" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10049739", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The antiviral nucleotide analogs cidofovir and adefovir are novel substrates for human and rat renal organic anion transporter 1.", "journal": "Molecular pharmacology", "date": "1999", "authors": "Cihlar T, Lin DC, Pritchard JB, Fuller MD, Mendel DB, Sweet DH", "reference": { "type": "PubMed", "id": "10462545", "url": "https://pubmed.ncbi.nlm.nih.gov/10462545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35956-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "Slc22a6", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 113, "start_aa": "Asn", "end_pos": 113, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn113", "evidence": [ { "id": "Q4U2R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8#ptm_processing" }, { "id": "10462545", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10462545" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q4U2R8-1" } ], "record_id": "pubmed.10462545", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of multispecific organic anion transporter 4 expressed in the placenta.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cha SH, Sekine T, Kusuhara H, Yu E, Kim JY, Kim DK, Sugiyama Y, Kanai Y, Endou H", "reference": { "type": "PubMed", "id": "10660625", "url": "https://pubmed.ncbi.nlm.nih.gov/10660625" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10660625", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic structure and in vivo expression of the human organic anion transporter 1 (hOAT1) gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Bahn A, Prawitt D, Buttler D, Reid G, Enklaar T, Wolff N A, Ebbinghaus C, Hillemann A, Schulten H J, Gunawan B, F\u00fczesi L, Zabel B, Burckhardt G", "reference": { "type": "PubMed", "id": "10964714", "url": "https://pubmed.ncbi.nlm.nih.gov/10964714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10964714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of a family of organic anion transporters from human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Sun W, Wu RR, van Poelje PD, Erion MD", "reference": { "type": "PubMed", "id": "11327718", "url": "https://pubmed.ncbi.nlm.nih.gov/11327718" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y694-1", "protein_name": "Solute carrier family 22 member 7", "gene_name": "SLC22A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63ZE4-1", "protein_name": "Solute carrier family 22 member 10", "gene_name": "SLC22A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVM8-1", "protein_name": "Organic anion transporter 7", "gene_name": "SLC22A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11327718", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of ochratoxin A transport by human organic anion transporters.", "journal": "Life sciences", "date": "2001-09-21", "authors": "Jung K Y, Takeda M, Kim D K, Tojo A, Narikawa S, Yoo B S, Hosoyamada M, Cha S H, Sekine T, Endou H", "reference": { "type": "PubMed", "id": "11669456", "url": "https://pubmed.ncbi.nlm.nih.gov/11669456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11669456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human organic anion transporters and human organic cation transporters mediate renal transport of prostaglandins.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2002-04", "authors": "Kimura Hiroaki, Takeda Michio, Narikawa Shinichi, Enomoto Atsushi, Ichida Kimiyoshi, Endou Hitoshi", "reference": { "type": "PubMed", "id": "11907186", "url": "https://pubmed.ncbi.nlm.nih.gov/11907186" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15244-1", "protein_name": "Solute carrier family 22 member 2", "gene_name": "SLC22A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y694-1", "protein_name": "Solute carrier family 22 member 7", "gene_name": "SLC22A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15245-1", "protein_name": "Solute carrier family 22 member 1", "gene_name": "SLC22A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11907186", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular identification of a renal urate anion exchanger that regulates blood urate levels.", "journal": "Nature", "date": "2002", "authors": "Enomoto A, Kimura H, Chairoungdua A, Shigeta Y, Jutabha P, Cha SH, Hosoyamada M, Takeda M, Sekine T, Igarashi T, Matsuo H, Kikuchi Y, Oda T, Ichida K, Hosoya T, Shimokata K, Niwa T, Kanai Y, Endou H", "reference": { "type": "PubMed", "id": "12024214", "url": "https://pubmed.ncbi.nlm.nih.gov/12024214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12024214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of cysteine conjugates with human and rabbit organic anion transporter 1.", "journal": "J. Pharmacol. Exp. Ther.", "date": "2003", "authors": "Groves Carlotta E, Mu\u00f1oz Lynn, Bahn Andrew, Burckhardt Gerhard, Wright Stephen H", "reference": { "type": "PubMed", "id": "12538807", "url": "https://pubmed.ncbi.nlm.nih.gov/12538807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12538807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human organic anion transporter 3 (hOAT3) can operate as an exchanger and mediate secretory urate flux.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2003", "authors": "Bakhiya A, Bahn A, Burckhardt G, Wolff N", "reference": { "type": "PubMed", "id": "14586168", "url": "https://pubmed.ncbi.nlm.nih.gov/14586168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14586168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of uremic toxin transport by organic anion transporters in the kidney.", "journal": "Kidney international", "date": "2004-01", "authors": "Deguchi Tsuneo, Kusuhara Hiroyuki, Takadate Akira, Endou Hitoshi, Otagiri Masaki, Sugiyama Yuichi", "reference": { "type": "PubMed", "id": "14675047", "url": "https://pubmed.ncbi.nlm.nih.gov/14675047" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R1U7-1", "protein_name": "Organic anion transporter 3", "gene_name": "Slc22a8", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35956-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "Slc22a6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14675047", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of glycosylation in the organic anion transporter OAT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tanaka K, Xu W, Zhou F, You G", "reference": { "type": "PubMed", "id": "14749323", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VC69-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "Slc22a6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 39, "start_aa": "Asn", "end_pos": 39, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn39", "evidence": [ { "id": "Q4U2R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01101", "uniprot_canonical_ac": "Q4U2R8-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "Q4U2R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q4U2R8-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "Q4U2R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q4U2R8-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "Q4U2R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q4U2R8-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "Q8VC69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8VC69#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q8VC69-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "Q8VC69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8VC69#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q8VC69-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "Q8VC69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8VC69#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q8VC69-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 91, "start_aa": "Asn", "end_pos": 91, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn91", "evidence": [ { "id": "Q8VC69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8VC69#ptm_processing" }, { "id": "14749323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q8VC69-1" } ], "mutagenesis": [ { "start_pos": 39, "end_pos": 39, "sequence_org": "N", "sequence_mut": "Q", "comment": "Complete loss of PAH transport activity.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" }, { "database": "PubMed", "id": "14749323", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "uniprot_canonical_ac": "Q4U2R8-1" }, { "start_pos": 39, "end_pos": 39, "sequence_org": "N", "sequence_mut": "Q", "comment": "Complete loss of PAH transport activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8VC69", "url": "https://www.uniprot.org/uniprotkb/Q8VC69" }, { "database": "PubMed", "id": "14749323", "url": "https://pubmed.ncbi.nlm.nih.gov/14749323" } ], "uniprot_canonical_ac": "Q8VC69-1" } ], "record_id": "pubmed.14749323", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_sites", "count": 8 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_n_linked_sites", "count": 8 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_sites", "count": 8 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_n_linked_sites", "count": 8 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human organic anion transporter 4 is a renal apical organic anion/dicarboxylate exchanger in the proximal tubules.", "journal": "Journal of pharmacological sciences", "date": "2004", "authors": "Ekaratanawong S, Anzai N, Jutabha P, Miyazaki H, Noshiro R, Takeda M, Kanai Y, Sophasan S, Endou H", "reference": { "type": "PubMed", "id": "15037815", "url": "https://pubmed.ncbi.nlm.nih.gov/15037815" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15037815", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Critical amino acid residues in transmembrane domain 1 of the human organic anion transporter hOAT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Hong M, Zhou F, You G", "reference": { "type": "PubMed", "id": "15145940", "url": "https://pubmed.ncbi.nlm.nih.gov/15145940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 30, "end_pos": 30, "sequence_org": "L", "sequence_mut": "A", "comment": "Complete loss of PAH transport activity.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" }, { "database": "PubMed", "id": "15145940", "url": "https://pubmed.ncbi.nlm.nih.gov/15145940" } ], "uniprot_canonical_ac": "Q4U2R8-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of PAH transport activity.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" }, { "database": "PubMed", "id": "15145940", "url": "https://pubmed.ncbi.nlm.nih.gov/15145940" } ], "uniprot_canonical_ac": "Q4U2R8-1" } ], "record_id": "pubmed.15145940", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in human urate transporter 1 gene in presecretory reabsorption defect type of familial renal hypouricemia.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2005", "authors": "Wakida N, Tuyen DG, Adachi M, Miyoshi T, Nonoguchi H, Oka T, Ueda O, Tazawa M, Kurihara S, Yoneta Y, Shimada H, Oda T, Kikuchi Y, Matsuo H, Hosoyamada M, Endou H, Otagiri M, Tomita K, Kitamura K", "reference": { "type": "PubMed", "id": "15634722", "url": "https://pubmed.ncbi.nlm.nih.gov/15634722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15634722", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8).", "journal": "J. Pharmacol. Exp. Ther.", "date": "2005", "authors": "Srimaroeng Chutima, Chatsudthipong Varanuj, Aslamkhan Amy G, Pritchard John B", "reference": { "type": "PubMed", "id": "15644426", "url": "https://pubmed.ncbi.nlm.nih.gov/15644426" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15644426", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transport mechanism and substrate specificity of human organic anion transporter 2 (hOat2 [SLC22A7]).", "journal": "The Journal of pharmacy and pharmacology", "date": "2005", "authors": "Kobayashi Y, Ohshiro N, Sakai R, Ohbayashi M, Kohyama N, Yamamoto T", "reference": { "type": "PubMed", "id": "15901346", "url": "https://pubmed.ncbi.nlm.nih.gov/15901346" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y694-1", "protein_name": "Solute carrier family 22 member 7", "gene_name": "SLC22A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15901346", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional consequences of single nucleotide polymorphisms in the human organic anion transporter hOAT1 (SLC22A6).", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2005", "authors": "Bleasby K, Hall LA, Perry JL, Mohrenweiser HW, Pritchard JB", "reference": { "type": "PubMed", "id": "15914676", "url": "https://pubmed.ncbi.nlm.nih.gov/15914676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15914676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analyses of coding region polymorphisms in apical and basolateral human organic anion transporter (OAT) genes [OAT1 (NKT), OAT2, OAT3, OAT4, URAT (RST)].", "journal": "Kidney international", "date": "2005", "authors": "Xu G, Bhatnagar V, Wen G, Hamilton BA, Eraly SA, Nigam SK", "reference": { "type": "PubMed", "id": "16164626", "url": "https://pubmed.ncbi.nlm.nih.gov/16164626" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16164626", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A three-dimensional model of human organic anion transporter 1: aromatic amino acids required for substrate transport.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Perry JL, Dembla-Rajpal N, Hall LA, Pritchard JB", "reference": { "type": "PubMed", "id": "17038320", "url": "https://pubmed.ncbi.nlm.nih.gov/17038320" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 230, "end_pos": 230, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of membrane protein expression and little uptake of cidofovir.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" }, { "database": "PubMed", "id": "17038320", "url": "https://pubmed.ncbi.nlm.nih.gov/17038320" } ], "uniprot_canonical_ac": "Q4U2R8-1" }, { "start_pos": 431, "end_pos": 431, "sequence_org": "K", "sequence_mut": "A", "comment": "Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" }, { "database": "PubMed", "id": "17038320", "url": "https://pubmed.ncbi.nlm.nih.gov/17038320" } ], "uniprot_canonical_ac": "Q4U2R8-1" }, { "start_pos": 438, "end_pos": 438, "sequence_org": "F", "sequence_mut": "A", "comment": "Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.", "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" }, { "database": "PubMed", "id": "17038320", "url": "https://pubmed.ncbi.nlm.nih.gov/17038320" } ], "uniprot_canonical_ac": "Q4U2R8-1" } ], "record_id": "pubmed.17038320", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human organic anion transporters 1 (hOAT1/SLC22A6) and 3 (hOAT3/SLC22A8) transport edaravone (MCI-186; 3-methyl-1-phenyl-2-pyrazolin-5-one) and its sulfate conjugate.", "journal": "Drug Metab. Dispos.", "date": "2007", "authors": "Mizuno Naomi, Takahashi Tsuyoshi, Iwase Yumiko, Kusuhara Hiroyuki, Niwa Takuro, Sugiyama Yuichi", "reference": { "type": "PubMed", "id": "17502342", "url": "https://pubmed.ncbi.nlm.nih.gov/17502342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17502342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction and transport of kynurenic acid via human organic anion transporters hOAT1 and hOAT3.", "journal": "Pharmacological research", "date": "2012-02", "authors": "Uwai Yuichi, Honjo Hiroaki, Iwamoto Kikuo", "reference": { "type": "PubMed", "id": "22108572", "url": "https://pubmed.ncbi.nlm.nih.gov/22108572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22108572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transport of xanthurenic acid by rat/human organic anion transporters OAT1 and OAT3.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2013", "authors": "Uwai Yuichi, Honjo Emi", "reference": { "type": "PubMed", "id": "23832370", "url": "https://pubmed.ncbi.nlm.nih.gov/23832370" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R1U7-1", "protein_name": "Organic anion transporter 3", "gene_name": "Slc22a8", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35956-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "Slc22a6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23832370", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human organic anion transporter 2 is distinct from organic anion transporters 1 and 3 with respect to transport function.", "journal": "American journal of physiology. Renal physiology", "date": "2015", "authors": "Henjakovic M, Hagos Y, Krick W, Burckhardt G, Burckhardt BC", "reference": { "type": "PubMed", "id": "26377792", "url": "https://pubmed.ncbi.nlm.nih.gov/26377792" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y694-1", "protein_name": "Solute carrier family 22 member 7", "gene_name": "SLC22A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26377792", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Organic anion transporters, OAT1 and OAT3, are crucial biopterin transporters involved in bodily distribution of tetrahydrobiopterin and exclusion of its excess.", "journal": "Molecular and cellular biochemistry", "date": "2017", "authors": "Ohashi A, Mamada K, Harada T, Naito M, Takahashi T, Aizawa S, Hasegawa H", "reference": { "type": "PubMed", "id": "28534121", "url": "https://pubmed.ncbi.nlm.nih.gov/28534121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28534121", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin-specific peptidase 8 regulates the trafficking and stability of the human organic anion transporter 1.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2020", "authors": "Zhang J, Liu C, You G", "reference": { "type": "PubMed", "id": "32818533", "url": "https://pubmed.ncbi.nlm.nih.gov/32818533" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32818533", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of Xenobiotic Transporters Expressed at the Human Blood-Testis Barrier.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2022-06", "authors": "Hau Raymond K, Klein Robert R, Wright Stephen H, Cherrington Nathan J", "reference": { "type": "PubMed", "id": "35307651", "url": "https://pubmed.ncbi.nlm.nih.gov/35307651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H015-1", "protein_name": "Solute carrier family 22 member 4", "gene_name": "SLC22A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43868-1", "protein_name": "Sodium/nucleoside cotransporter 2", "gene_name": "SLC28A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76082-1", "protein_name": "Organic cation/carnitine transporter 2", "gene_name": "SLC22A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15244-1", "protein_name": "Solute carrier family 22 member 2", "gene_name": "SLC22A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPD5-1", "protein_name": "Solute carrier organic anion transporter family member 1B3", "gene_name": "SLCO1B3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92959-1", "protein_name": "Solute carrier organic anion transporter family member 2A1", "gene_name": "SLCO2A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYB5-1", "protein_name": "Solute carrier organic anion transporter family member 1C1", "gene_name": "SLCO1C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BD0-1", "protein_name": "Solute carrier organic anion transporter family member 4A1", "gene_name": "SLCO4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6L6-1", "protein_name": "Solute carrier organic anion transporter family member 1B1", "gene_name": "SLCO1B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T3U5-1", "protein_name": "ATP-binding cassette sub-family C member 10", "gene_name": "ABCC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46721-1", "protein_name": "Solute carrier organic anion transporter family member 1A2", "gene_name": "SLCO1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94956-1", "protein_name": "Solute carrier organic anion transporter family member 2B1", "gene_name": "SLCO2B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIG8-1", "protein_name": "Solute carrier organic anion transporter family member 3A1", "gene_name": "SLCO3A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75751-1", "protein_name": "Solute carrier family 22 member 3", "gene_name": "SLC22A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FL8-1", "protein_name": "Multidrug and toxin extrusion protein 1", "gene_name": "SLC47A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15245-1", "protein_name": "Solute carrier family 22 member 1", "gene_name": "SLC22A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95255-1", "protein_name": "ATP-binding cassette sub-family C member 6", "gene_name": "ABCC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15438-1", "protein_name": "ATP-binding cassette sub-family C member 3", "gene_name": "ABCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35307651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional Characterization of Rare Variants in OAT1/SLC22A6 and OAT3/SLC22A8 Urate Transporters Identified in a Gout and Hyperuricemia Cohort.", "journal": "Cells", "date": "2022", "authors": "Vavra J, Mancikova A, Pavelcova K, Hasikova L, Bohata J, Stiburkova B", "reference": { "type": "PubMed", "id": "35406626", "url": "https://pubmed.ncbi.nlm.nih.gov/35406626" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35406626", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drug transporters OAT1 and OAT3 have specific effects on multiple organs and gut microbiome as revealed by contextualized metabolic network reconstructions.", "journal": "Scientific reports", "date": "2022-10-31", "authors": "Jamshidi Neema, Nigam Sanjay K", "reference": { "type": "PubMed", "id": "36316339", "url": "https://pubmed.ncbi.nlm.nih.gov/36316339" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36316339", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The kidney drug transporter OAT1 regulates gut microbiome-dependent host metabolism.", "journal": "JCI insight", "date": "2023-01-24", "authors": "Granados Jeffry C, Ermakov Vladimir, Maity Koustav, Vera David R, Chang Geoffrey, Nigam Sanjay K", "reference": { "type": "PubMed", "id": "36692015", "url": "https://pubmed.ncbi.nlm.nih.gov/36692015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VC69-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "Slc22a6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36692015", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a human renal p-aminohippurate transporter, hROAT1.", "journal": "Kidney Blood Press. Res.", "date": "1998", "authors": "Reid G, Wolff NA, Dautzenberg FM, Burckhardt G", "reference": { "type": "PubMed", "id": "9762842", "url": "https://pubmed.ncbi.nlm.nih.gov/9762842" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9762842", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and functional expression of a multispecific organic anion transporter from human kidney.", "journal": "The American journal of physiology", "date": "1999", "authors": "Hosoyamada M, Sekine T, Kanai Y, Endou H", "reference": { "type": "PubMed", "id": "9887087", "url": "https://pubmed.ncbi.nlm.nih.gov/9887087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9887087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of the human kidney PAH transporter: narrow substrate specificity and regulation by protein kinase C.", "journal": "The American journal of physiology", "date": "1999", "authors": "Lu R, Chan BS, Schuster VL", "reference": { "type": "PubMed", "id": "9950961", "url": "https://pubmed.ncbi.nlm.nih.gov/9950961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4U2R8-1", "protein_name": "Solute carrier family 22 member 6", "gene_name": "SLC22A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA0-1", "protein_name": "Solute carrier family 22 member 11", "gene_name": "SLC22A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S37-1", "protein_name": "Solute carrier family 22 member 12", "gene_name": "SLC22A12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCC7-1", "protein_name": "Organic anion transporter 3", "gene_name": "SLC22A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4U2R8", "url": "https://www.uniprot.org/uniprotkb/Q4U2R8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9950961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The GATOR2 Component Wdr24 Regulates TORC1 Activity and Lysosome Function.", "journal": "PLoS genetics", "date": "2016", "authors": "Cai W, Wei Y, Jarnik M, Reich J, Lilly MA", "reference": { "type": "PubMed", "id": "27166823", "url": "https://pubmed.ncbi.nlm.nih.gov/27166823" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S15-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "WDR24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9VKK2-1", "protein_name": "GATOR2 complex protein Wdr59", "gene_name": "Wdr59", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W0E3-1", "protein_name": "GATOR complex protein Iml1", "gene_name": "Iml1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VQ89-1", "protein_name": "GATOR2 complex protein Mio", "gene_name": "mio", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VUB4-1", "protein_name": "GATOR complex protein NPRL3", "gene_name": "Nprl3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XZ25-1", "protein_name": "GATOR2 complex protein Wdr24", "gene_name": "Wdr24", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7K2X8-1", "protein_name": "Nucleoporin seh1", "gene_name": "Nup44A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3J4-1", "protein_name": "Protein SEC13 homolog", "gene_name": "Sec13", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VXA0-1", "protein_name": "GATOR complex protein NPRL2", "gene_name": "Nprl2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 817, "end_pos": 867, "sequence_org": "WFSWCQTCRHGGHTEHIMQWFKQNSECPVSSCNCRCFDMDGTKPNTLRDIS", "sequence_mut": "", "comment": "Significant decrease in mTORC1 activity in adult ovaries indicated by reduced phosphorylation of S6K/p70S6K and the accumulation of autolysosomes. Female germline clones are smaller compared to wild-type cells. In contrast, somatic tissues do not display a significant decrease in mTORC1 activity and there is only a negligible decrease in cell size. RNAi-mediated knockdown of Nprl1 or Nprl3 rescues the ovarian defects in mutants, but not the accumulation of lysosomes.", "evidence": [ { "database": "UniProtKB", "id": "Q9VQ89", "url": "https://www.uniprot.org/uniprotkb/Q9VQ89" }, { "database": "PubMed", "id": "25512509", "url": "https://pubmed.ncbi.nlm.nih.gov/25512509" }, { "database": "PubMed", "id": "27166823", "url": "https://pubmed.ncbi.nlm.nih.gov/27166823" } ], "uniprot_canonical_ac": "Q9VQ89-1" } ], "record_id": "pubmed.27166823", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AMPK-dependent phosphorylation of the GATOR2 component WDR24 suppresses glucose-mediated mTORC1 activation.", "journal": "Nature metabolism", "date": "2023-02", "authors": "Dai Xiaoming, Jiang Cong, Jiang Qiwei, Fang Lan, Yu Haihong, Guo Jinhe, Yan Peiqiang, Chi Fangtao, Zhang Tao, Inuzuka Hiroyuki, Asara John M, Wang Ping, Guo Jianping, Wei Wenyi", "reference": { "type": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S15-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "WDR24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13131-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-1", "gene_name": "PRKAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61981-1", "protein_name": "14-3-3 protein gamma", "gene_name": "YWHAG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CFJ9-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "Wdr24", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished phosphorylation by AMPK.", "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" }, { "database": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" } ], "uniprot_canonical_ac": "Q96S15-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "D", "comment": "Mimics phosphorylation, leading to inhibit mTORC1 activation.", "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" }, { "database": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" } ], "uniprot_canonical_ac": "Q96S15-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "A", "comment": "Knockin mice display higher mTORC1 activity under fasting.", "evidence": [ { "database": "UniProtKB", "id": "Q8CFJ9", "url": "https://www.uniprot.org/uniprotkb/Q8CFJ9" }, { "database": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" } ], "uniprot_canonical_ac": "Q8CFJ9-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "D", "comment": "Mimics phosphorylation; knockin mice are lethal due to decreased mTOC1 activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8CFJ9", "url": "https://www.uniprot.org/uniprotkb/Q8CFJ9" }, { "database": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" } ], "uniprot_canonical_ac": "Q8CFJ9-1" } ], "phosphorylation": [ { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" }, { "database": "iPTMnet", "id": "Q96S15", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q96S15" }, { "database": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" } ], "site_lbl": "Ser155", "uniprot_canonical_ac": "Q96S15-1" }, { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "Q8CFJ9", "url": "https://www.uniprot.org/uniprotkb/Q8CFJ9" }, { "database": "iPTMnet", "id": "Q8CFJ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CFJ9" }, { "database": "PubMed", "id": "36732624", "url": "https://pubmed.ncbi.nlm.nih.gov/36732624" } ], "site_lbl": "Ser155", "uniprot_canonical_ac": "Q8CFJ9-1" } ], "record_id": "pubmed.36732624", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CDK5-PRMT1-WDR24 signaling cascade promotes mTORC1 signaling and tumor growth.", "journal": "Cell reports", "date": "2023-04-25", "authors": "Yin Shasha, Liu Liu, Ball Lauren E, Wang Yalong, Bedford Mark T, Duncan Stephen A, Wang Haizhen, Gan Wenjian", "reference": { "type": "PubMed", "id": "36995937", "url": "https://pubmed.ncbi.nlm.nih.gov/36995937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S15-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "WDR24", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36995937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATPase-defective mammalian VPS4 localizes to aberrant endosomes and impairs cholesterol trafficking.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Bishop N, Woodman P", "reference": { "type": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46467-1", "protein_name": "Vacuolar protein sorting-associated protein 4B", "gene_name": "Vps4b", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 173, "end_pos": 173, "sequence_org": "K", "sequence_mut": "Q", "comment": "Defective in ATP-binding. Causes membrane association. Induces vacuolation of endosomal compartments and impairs cholesterol sorting. Inhibits HIV-1 release. Greatly diminishes localization to punctate class E compartments and partially restores HIV-1 release; when associated with D-64. Greatly diminishes localization to punctate class E compartments; when associated with D-173.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "11595185", "url": "https://pubmed.ncbi.nlm.nih.gov/11595185" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 228, "end_pos": 228, "sequence_org": "E", "sequence_mut": "Q", "comment": "Defective in ATP-hydrolysis. Causes membrane association. Induces vacuolation of endosomal compartments and impairs cholesterol and protein sorting. Inhibits HIV-1 release. Increases binding to CHMP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "15075231", "url": "https://pubmed.ncbi.nlm.nih.gov/15075231" }, { "database": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" }, { "database": "PubMed", "id": "11563910", "url": "https://pubmed.ncbi.nlm.nih.gov/11563910" }, { "database": "PubMed", "id": "11559748", "url": "https://pubmed.ncbi.nlm.nih.gov/11559748" }, { "database": "PubMed", "id": "11595185", "url": "https://pubmed.ncbi.nlm.nih.gov/11595185" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 180, "end_pos": 180, "sequence_org": "K", "sequence_mut": "Q", "comment": "Defective in ATP-binding. Causes membrane association. Induces vacuolation of endosomal compartments and impairs cholesterol sorting.", "evidence": [ { "database": "UniProtKB", "id": "P46467", "url": "https://www.uniprot.org/uniprotkb/P46467" }, { "database": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" } ], "uniprot_canonical_ac": "P46467-1" }, { "start_pos": 235, "end_pos": 235, "sequence_org": "E", "sequence_mut": "Q", "comment": "Defective in ATP-hydrolysis. Causes membrane-association. Induces vacuolation of endosomal compartments and impairs cholesterol and protein sorting. Increased perinuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "P46467", "url": "https://www.uniprot.org/uniprotkb/P46467" }, { "database": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" }, { "database": "PubMed", "id": "10679028", "url": "https://pubmed.ncbi.nlm.nih.gov/10679028" }, { "database": "PubMed", "id": "18796009", "url": "https://pubmed.ncbi.nlm.nih.gov/18796009" }, { "database": "PubMed", "id": "12594041", "url": "https://pubmed.ncbi.nlm.nih.gov/12594041" } ], "uniprot_canonical_ac": "P46467-1" } ], "record_id": "pubmed.10637304", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tsg101 and the vacuolar protein sorting pathway are essential for HIV-1 budding.", "journal": "Cell", "date": "2001", "authors": "Garrus JE, von Schwedler UK, Pornillos OW, Morham SG, Zavitz KH, Wang HE, Wettstein DA, Stray KM, Cote M, Rich RL, Myszka DG, Sundquist WI", "reference": { "type": "PubMed", "id": "11595185", "url": "https://pubmed.ncbi.nlm.nih.gov/11595185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99816-1", "protein_name": "Tumor susceptibility gene 101 protein", "gene_name": "TSG101", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 173, "end_pos": 173, "sequence_org": "K", "sequence_mut": "Q", "comment": "Defective in ATP-binding. Causes membrane association. Induces vacuolation of endosomal compartments and impairs cholesterol sorting. Inhibits HIV-1 release. Greatly diminishes localization to punctate class E compartments and partially restores HIV-1 release; when associated with D-64. Greatly diminishes localization to punctate class E compartments; when associated with D-173.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "11595185", "url": "https://pubmed.ncbi.nlm.nih.gov/11595185" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 228, "end_pos": 228, "sequence_org": "E", "sequence_mut": "Q", "comment": "Defective in ATP-hydrolysis. Causes membrane association. Induces vacuolation of endosomal compartments and impairs cholesterol and protein sorting. Inhibits HIV-1 release. Increases binding to CHMP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "15075231", "url": "https://pubmed.ncbi.nlm.nih.gov/15075231" }, { "database": "PubMed", "id": "10637304", "url": "https://pubmed.ncbi.nlm.nih.gov/10637304" }, { "database": "PubMed", "id": "11563910", "url": "https://pubmed.ncbi.nlm.nih.gov/11563910" }, { "database": "PubMed", "id": "11559748", "url": "https://pubmed.ncbi.nlm.nih.gov/11559748" }, { "database": "PubMed", "id": "11595185", "url": "https://pubmed.ncbi.nlm.nih.gov/11595185" } ], "uniprot_canonical_ac": "Q9UN37-1" } ], "record_id": "pubmed.11595185", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and ESCRT-III protein interactions of the MIT domain of human VPS4A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Scott A, Gaspar J, Stuchell-Brereton MD, Alam SL, Skalicky JJ, Sundquist WI", "reference": { "type": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7LBR1-1", "protein_name": "Charged multivesicular body protein 1b", "gene_name": "CHMP1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with CHMP1B; diminishes interaction with IST1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "D", "comment": "Abolishes interaction with CHMP1B; diminishes interaction with IST1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "D", "comment": "Greatly diminishes localization to punctate class E compartments and partially restores HIV-1 release; when associated with Q-173.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "D", "comment": "Modestly reduces interaction with CHMP6.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" }, { "database": "PubMed", "id": "18606141", "url": "https://pubmed.ncbi.nlm.nih.gov/18606141" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" }, { "database": "PubMed", "id": "19129480", "url": "https://pubmed.ncbi.nlm.nih.gov/19129480" }, { "database": "PubMed", "id": "19129479", "url": "https://pubmed.ncbi.nlm.nih.gov/19129479" } ], "uniprot_canonical_ac": "Q9UN37-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "E", "sequence_mut": "D", "comment": "Diminishes interaction with CHMP1B.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" }, { "database": "PubMed", "id": "16174732", "url": "https://pubmed.ncbi.nlm.nih.gov/16174732" } ], "uniprot_canonical_ac": "Q9UN37-1" } ], "record_id": "pubmed.16174732", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.", "journal": "EMBO J.", "date": "2007", "authors": "Morita E, Sandrin V, Chung HY, Morham SG, Gygi SP, Rodesch CK, Sundquist WI", "reference": { "type": "PubMed", "id": "17853893", "url": "https://pubmed.ncbi.nlm.nih.gov/17853893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY43-1", "protein_name": "Charged multivesicular body protein 4a", "gene_name": "CHMP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43633-1", "protein_name": "Charged multivesicular body protein 2a", "gene_name": "CHMP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99816-1", "protein_name": "Tumor susceptibility gene 101 protein", "gene_name": "TSG101", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM4-1", "protein_name": "Programmed cell death 6-interacting protein", "gene_name": "PDCD6IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZZ3-1", "protein_name": "Charged multivesicular body protein 5", "gene_name": "CHMP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9H4-1", "protein_name": "Vacuolar protein sorting-associated protein 37B", "gene_name": "VPS37B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53EZ4-1", "protein_name": "Centrosomal protein of 55 kDa", "gene_name": "CEP55", "tax_name": "Human" }, { "uniprot_canonical_ac": "A5D8V6-1", "protein_name": "Vacuolar protein sorting-associated protein 37C", "gene_name": "VPS37C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EY5-1", "protein_name": "Multivesicular body subunit 12A", "gene_name": "MVB12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK41-1", "protein_name": "Vacuolar protein sorting-associated protein 28 homolog", "gene_name": "VPS28", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 158, "end_pos": 160, "sequence_org": "PPN", "sequence_mut": "AAA", "comment": "Abolishes interaction with CEP55.", "evidence": [ { "database": "UniProtKB", "id": "Q99816", "url": "https://www.uniprot.org/uniprotkb/Q99816" }, { "database": "PubMed", "id": "17853893", "url": "https://pubmed.ncbi.nlm.nih.gov/17853893" } ], "uniprot_canonical_ac": "Q99816-1" }, { "start_pos": 212, "end_pos": 212, "sequence_org": "I", "sequence_mut": "D", "comment": "Does not support cytokinesis; loss of normal midbody formation; loss of CHMP4A-, CHMP4B- and CHMP4C-binding in a yeast two-hybrid assay; impairs rescue of PTAP-type L domain-deficient HIV-1 p6; no effect on localization to the midbody.", "evidence": [ { "database": "UniProtKB", "id": "Q8WUM4", "url": "https://www.uniprot.org/uniprotkb/Q8WUM4" }, { "database": "PubMed", "id": "18641129", "url": "https://pubmed.ncbi.nlm.nih.gov/18641129" }, { "database": "PubMed", "id": "17350572", "url": "https://pubmed.ncbi.nlm.nih.gov/17350572" }, { "database": "PubMed", "id": "17853893", "url": "https://pubmed.ncbi.nlm.nih.gov/17853893" } ], "uniprot_canonical_ac": "Q8WUM4-1" }, { "start_pos": 676, "end_pos": 676, "sequence_org": "F", "sequence_mut": "D", "comment": "Abolishes interaction with HIV-1 p6 and EIAV p9; abolishes rescue of PTAP-type L domain-deficient HIV-1 p6; no effect on cytokinesis, nor on midbody formation.", "evidence": [ { "database": "UniProtKB", "id": "Q8WUM4", "url": "https://www.uniprot.org/uniprotkb/Q8WUM4" }, { "database": "PubMed", "id": "17277784", "url": "https://pubmed.ncbi.nlm.nih.gov/17277784" }, { "database": "PubMed", "id": "18641129", "url": "https://pubmed.ncbi.nlm.nih.gov/18641129" }, { "database": "PubMed", "id": "17350572", "url": "https://pubmed.ncbi.nlm.nih.gov/17350572" }, { "database": "PubMed", "id": "17853893", "url": "https://pubmed.ncbi.nlm.nih.gov/17853893" } ], "uniprot_canonical_ac": "Q8WUM4-1" }, { "start_pos": 800, "end_pos": 802, "sequence_org": "GPP", "sequence_mut": "AAA", "comment": "Abolishes interaction with CEP55; inhibits support of cytokinesis.", "evidence": [ { "database": "UniProtKB", "id": "Q8WUM4", "url": "https://www.uniprot.org/uniprotkb/Q8WUM4" }, { "database": "PubMed", "id": "17853893", "url": "https://pubmed.ncbi.nlm.nih.gov/17853893" } ], "uniprot_canonical_ac": "Q8WUM4-1" } ], "record_id": "pubmed.17853893", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for midbody targeting of spastin by the ESCRT-III protein CHMP1B.", "journal": "Nat. Struct. Mol. Biol.", "date": "2008", "authors": "Yang D, Rismanchi N, Renvoise B, Lippincott-Schwartz J, Blackstone C, Hurley JH", "reference": { "type": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7LBR1-1", "protein_name": "Charged multivesicular body protein 1b", "gene_name": "CHMP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP0-1", "protein_name": "Spastin", "gene_name": "SPAST", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 178, "end_pos": 178, "sequence_org": "T", "sequence_mut": "R", "comment": "Abolishes interaction with SPAST and no effect on interaction with VPS4A; when associated with R-181 and R-184.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 181, "end_pos": 181, "sequence_org": "A", "sequence_mut": "R", "comment": "Abolishes interaction with SPAScT and no effect on interaction with VPS4A; when associated with R-178 and R-184.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreases interaction with SPAST.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "E", "sequence_mut": "R", "comment": "Abolishes interaction with SPAST and no effect on interaction with VPS4A; when associated with R-178 and R-181.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 188, "end_pos": 188, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with SPAST and VPS4A; when associated with A-192.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 192, "end_pos": 192, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with SPAST and VPS4A; when associated with A-188.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 192, "end_pos": 192, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with VPS4B.", "evidence": [ { "database": "UniProtKB", "id": "Q7LBR1", "url": "https://www.uniprot.org/uniprotkb/Q7LBR1" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" }, { "database": "PubMed", "id": "17928862", "url": "https://pubmed.ncbi.nlm.nih.gov/17928862" } ], "uniprot_canonical_ac": "Q7LBR1-1" }, { "start_pos": 120, "end_pos": 120, "sequence_org": "H", "sequence_mut": "D", "comment": "Impairs binding to CHMP1B. Impairs midbody localization; when associated with D-124.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBP0", "url": "https://www.uniprot.org/uniprotkb/Q9UBP0" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q9UBP0-1" }, { "start_pos": 124, "end_pos": 124, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs binding to CHMP1B.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBP0", "url": "https://www.uniprot.org/uniprotkb/Q9UBP0" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q9UBP0-1" }, { "start_pos": 124, "end_pos": 124, "sequence_org": "F", "sequence_mut": "D", "comment": "Impairs binding to CHMP1B. Impairs midbody localization; when associated with D-120.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBP0", "url": "https://www.uniprot.org/uniprotkb/Q9UBP0" }, { "database": "PubMed", "id": "18997780", "url": "https://pubmed.ncbi.nlm.nih.gov/18997780" } ], "uniprot_canonical_ac": "Q9UBP0-1" } ], "record_id": "pubmed.18997780", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human cytomegalovirus exploits ESCRT machinery in the process of virion maturation.", "journal": "Journal of virology", "date": "2009", "authors": "Tandon R, AuCoin DP, Mocarski ES", "reference": { "type": "PubMed", "id": "19640981", "url": "https://pubmed.ncbi.nlm.nih.gov/19640981" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H20-1", "protein_name": "Vacuolar-sorting protein SNF8", "gene_name": "SNF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FZ7-1", "protein_name": "Charged multivesicular body protein 6", "gene_name": "CHMP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUX9-1", "protein_name": "Charged multivesicular body protein 7", "gene_name": "CHMP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY43-1", "protein_name": "Charged multivesicular body protein 4a", "gene_name": "CHMP4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3E7-1", "protein_name": "Charged multivesicular body protein 3", "gene_name": "CHMP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43633-1", "protein_name": "Charged multivesicular body protein 2a", "gene_name": "CHMP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQN3-1", "protein_name": "Charged multivesicular body protein 2b", "gene_name": "CHMP2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99816-1", "protein_name": "Tumor susceptibility gene 101 protein", "gene_name": "TSG101", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49716-1", "protein_name": "CCAAT/enhancer-binding protein delta", "gene_name": "CEBPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRG1-1", "protein_name": "Vacuolar protein-sorting-associated protein 25", "gene_name": "VPS25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CF2-1", "protein_name": "Charged multivesicular body protein 4c", "gene_name": "CHMP4C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HD42-1", "protein_name": "Charged multivesicular body protein 1a", "gene_name": "CHMP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7P6-1", "protein_name": "Multivesicular body subunit 12B", "gene_name": "MVB12B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VN1-1", "protein_name": "Vacuolar protein-sorting-associated protein 36", "gene_name": "VPS36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XT2-1", "protein_name": "Vacuolar protein sorting-associated protein 37D", "gene_name": "VPS37D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0S8-1", "protein_name": "Histone H2A type 1", "gene_name": "H2AC11; H2AC13; H2AC15; H2AC16; H2AC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9H4-1", "protein_name": "Vacuolar protein sorting-associated protein 37B", "gene_name": "VPS37B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A5D8V6-1", "protein_name": "Vacuolar protein sorting-associated protein 37C", "gene_name": "VPS37C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H444-1", "protein_name": "Charged multivesicular body protein 4b", "gene_name": "CHMP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5QNW6-1", "protein_name": "Histone H2B type 2-F", "gene_name": "H2BC18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ09-1", "protein_name": "Ubiquitin-associated protein 1", "gene_name": "UBAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KK5-1", "protein_name": "Histone H2A type 1-H", "gene_name": "H2AC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L7L0-1", "protein_name": "Histone H2A type 3", "gene_name": "H2AC25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUE6-1", "protein_name": "Histone H2A type 2-B", "gene_name": "H2AC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QV6-1", "protein_name": "Histone H2A type 1-A", "gene_name": "H2AC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EY5-1", "protein_name": "Multivesicular body subunit 12A", "gene_name": "MVB12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK41-1", "protein_name": "Vacuolar protein sorting-associated protein 28 homolog", "gene_name": "VPS28", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ2-1", "protein_name": "Vacuolar protein sorting-associated protein 37A", "gene_name": "VPS37A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61978-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein K", "gene_name": "HNRNPK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19640981", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 79 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.", "journal": "J. Virol.", "date": "2011", "authors": "Kuang Z, Seo EJ, Leis J", "reference": { "type": "PubMed", "id": "21543490", "url": "https://pubmed.ncbi.nlm.nih.gov/21543490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UN37-1", "protein_name": "Vacuolar protein sorting-associated protein 4A", "gene_name": "VPS4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FZ7-1", "protein_name": "Charged multivesicular body protein 6", "gene_name": "CHMP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7LBR1-1", "protein_name": "Charged multivesicular body protein 1b", "gene_name": "CHMP1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3E7-1", "protein_name": "Charged multivesicular body protein 3", "gene_name": "CHMP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43633-1", "protein_name": "Charged multivesicular body protein 2a", "gene_name": "CHMP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZZ3-1", "protein_name": "Charged multivesicular body protein 5", "gene_name": "CHMP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H444-1", "protein_name": "Charged multivesicular body protein 4b", "gene_name": "CHMP4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP79-1", "protein_name": "Vacuolar protein sorting-associated protein VTA1 homolog", "gene_name": "VTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UN37", "url": "https://www.uniprot.org/uniprotkb/Q9UN37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21543490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]