[ { "title": "MTERF3 is a negative regulator of mammalian mtDNA transcription.", "journal": "Cell", "date": "2007", "authors": "Park CB, Asin-Cayuela J, Camara Y, Shi Y, Pellegrini M, Gaspari M, Wibom R, Hultenby K, Erdjument-Bromage H, Tempst P, Falkenberg M, Gustafsson CM, Larsson NG", "reference": { "type": "PubMed", "id": "17662942", "url": "https://pubmed.ncbi.nlm.nih.gov/17662942" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96E29-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "MTERF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R3J4-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "Mterf3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96E29", "url": "https://www.uniprot.org/uniprotkb/Q96E29" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17662942", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of mitochondrial transcription termination factor 3 reveals a novel nucleic acid-binding domain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2010", "authors": "Spahr H, Samuelsson T, Hallberg BM, Gustafsson CM", "reference": { "type": "PubMed", "id": "20430012", "url": "https://pubmed.ncbi.nlm.nih.gov/20430012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96E29-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "MTERF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q49AM1-1", "protein_name": "Transcription termination factor 2, mitochondrial", "gene_name": "MTERF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96E29", "url": "https://www.uniprot.org/uniprotkb/Q96E29" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20430012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of MTERFD1 or MTERFD3 impairs the completion of mitochondrial DNA replication.", "journal": "Molecular biology reports", "date": "2011", "authors": "Hyvarinen AK, Pohjoismaki JL, Holt IJ, Jacobs HT", "reference": { "type": "PubMed", "id": "20577816", "url": "https://pubmed.ncbi.nlm.nih.gov/20577816" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96E29-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "MTERF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q49AM1-1", "protein_name": "Transcription termination factor 2, mitochondrial", "gene_name": "MTERF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96E29", "url": "https://www.uniprot.org/uniprotkb/Q96E29" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20577816", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MTERF3 regulates mitochondrial ribosome biogenesis in invertebrates and mammals.", "journal": "PLoS Genet.", "date": "2013", "authors": "Wredenberg Anna, Lagouge Marie, Bratic Ana, Metodiev Metodi D, Sp\u00e5hr Henrik, Mourier Arnaud, Freyer Christoph, Ruzzenente Benedetta, Tain Luke, Gr\u00f6nke Sebastian, Baggio Francesca, Kukat Christian, Kremmer Elisabeth, Wibom Rolf, Polosa Paola Loguercio, Habermann Bianca, Partridge Linda, Park Chan Bae, Larsson Nils-G\u00f6ran", "reference": { "type": "PubMed", "id": "23300484", "url": "https://pubmed.ncbi.nlm.nih.gov/23300484" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96E29-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "MTERF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R3J4-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "Mterf3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VPD5-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "mTerf3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96E29", "url": "https://www.uniprot.org/uniprotkb/Q96E29" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23300484", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MTERFD1 promotes cell growth and irradiation resistance in colorectal cancer by upregulating interleukin-6 and interleukin-11.", "journal": "International journal of biological sciences", "date": "2019", "authors": "Liu X, Cao X, Liu C, Cao Y, Zhao Q, Tan X, Li X, Xu X, Yu E, Wang H", "reference": { "type": "PubMed", "id": "31754344", "url": "https://pubmed.ncbi.nlm.nih.gov/31754344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96E29-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "MTERF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96E29", "url": "https://www.uniprot.org/uniprotkb/Q96E29" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31754344", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppressing MTERF3 inhibits proliferation of human hepatocellular carcinoma via ROS-mediated p38 MAPK activation.", "journal": "Communications biology", "date": "2024-01-05", "authors": "Zheng Zhihai, Zhao Youjuan, Yu Hongjia, Wang Tingting, Li Jinhai, Xu Liang, Ding Chunming, He Lan, Wu Lijun, Dong Zhixiong", "reference": { "type": "PubMed", "id": "38177713", "url": "https://pubmed.ncbi.nlm.nih.gov/38177713" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96E29-1", "protein_name": "Transcription termination factor 3, mitochondrial", "gene_name": "MTERF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96E29", "url": "https://www.uniprot.org/uniprotkb/Q96E29" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38177713", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HGAL is a novel interleukin-4-inducible gene that strongly predicts survival in diffuse large B-cell lymphoma.", "journal": "Blood", "date": "2003", "authors": "Lossos IS, Alizadeh AA, Rajapaksa R, Tibshirani R, Levy R", "reference": { "type": "PubMed", "id": "12509382", "url": "https://pubmed.ncbi.nlm.nih.gov/12509382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12509382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells.", "journal": "Am. J. Pathol.", "date": "2003", "authors": "Pan Z, Shen Y, Du C, Zhou G, Rosenwald A, Staudt LM, Greiner TC, McKeithan TW, Chan WC", "reference": { "type": "PubMed", "id": "12819018", "url": "https://pubmed.ncbi.nlm.nih.gov/12819018" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WD7-1", "protein_name": "Serpin A9", "gene_name": "SERPINA9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12819018", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the human germinal center-associated lymphoma (HGAL) protein, a new marker of germinal center B-cell derivation.", "journal": "Blood", "date": "2005", "authors": "Natkunam Y, Lossos IS, Taidi B, Zhao S, Lu X, Ding F, Hammer AS, Marafioti T, Byrne GE Jr, Levy S, Warnke RA, Levy R", "reference": { "type": "PubMed", "id": "15677569", "url": "https://pubmed.ncbi.nlm.nih.gov/15677569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15677569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HGAL, a lymphoma prognostic biomarker, interacts with the cytoskeleton and mediates the effects of IL-6 on cell migration.", "journal": "Blood", "date": "2007", "authors": "Lu X, Chen J, Malumbres R, Cubedo Gil E, Helfman DM, Lossos IS", "reference": { "type": "PubMed", "id": "17823310", "url": "https://pubmed.ncbi.nlm.nih.gov/17823310" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX2-1", "protein_name": "Myosin-2", "gene_name": "MYH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 128, "end_pos": 128, "sequence_org": "Y", "sequence_mut": "F", "comment": "Does not affect IL6 induced phosphorylation. Does not affect the interaction with SYK.", "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" }, { "database": "PubMed", "id": "17823310", "url": "https://pubmed.ncbi.nlm.nih.gov/17823310" }, { "database": "PubMed", "id": "23299888", "url": "https://pubmed.ncbi.nlm.nih.gov/23299888" } ], "uniprot_canonical_ac": "Q8N6F7-1" }, { "start_pos": 148, "end_pos": 148, "sequence_org": "Y", "sequence_mut": "F", "comment": "Prevents IL6 induced phosphorylation. Does not affect the interaction with SYK.", "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" }, { "database": "PubMed", "id": "17823310", "url": "https://pubmed.ncbi.nlm.nih.gov/17823310" }, { "database": "PubMed", "id": "23299888", "url": "https://pubmed.ncbi.nlm.nih.gov/23299888" } ], "uniprot_canonical_ac": "Q8N6F7-1" } ], "record_id": "pubmed.17823310", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HGAL, a germinal center specific protein, decreases lymphoma cell motility by modulation of the RhoA signaling pathway.", "journal": "Blood", "date": "2010-12-09", "authors": "Jiang Xiaoyu, Lu Xiaoqing, McNamara George, Liu Xiaofei, Cubedo Elena, Sarosiek Kristopher A, S\u00e1nchez-Garc\u00eda Isidro, Helfman David M, Lossos Izidore S", "reference": { "type": "PubMed", "id": "20844236", "url": "https://pubmed.ncbi.nlm.nih.gov/20844236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15085-1", "protein_name": "Rho guanine nucleotide exchange factor 11", "gene_name": "ARHGEF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZN5-1", "protein_name": "Rho guanine nucleotide exchange factor 12", "gene_name": "ARHGEF12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20844236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Germinal centre protein HGAL promotes lymphoid hyperplasia and amyloidosis via BCR-mediated Syk activation.", "journal": "Nature communications", "date": "2013", "authors": "Romero-Camarero I, Jiang X, Natkunam Y, Lu X, Vicente-Duenas C, Gonzalez-Herrero I, Flores T, Garcia JL, McNamara G, Kunder C, Zhao S, Segura V, Fontan L, Martinez-Climent JA, Garcia-Criado FJ, Theis JD, Dogan A, Campos-Sanchez E, Green MR, Alizadeh AA, Cobaleda C, Sanchez-Garcia I, Lossos IS", "reference": { "type": "PubMed", "id": "23299888", "url": "https://pubmed.ncbi.nlm.nih.gov/23299888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6RFH4-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "Gcsam", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 107, "sequence_org": "YY", "sequence_mut": "AA", "comment": "Does not affect the interaction with SYK.", "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" }, { "database": "PubMed", "id": "23299888", "url": "https://pubmed.ncbi.nlm.nih.gov/23299888" } ], "uniprot_canonical_ac": "Q8N6F7-1" }, { "start_pos": 128, "end_pos": 128, "sequence_org": "Y", "sequence_mut": "F", "comment": "Does not affect IL6 induced phosphorylation. Does not affect the interaction with SYK.", "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" }, { "database": "PubMed", "id": "17823310", "url": "https://pubmed.ncbi.nlm.nih.gov/17823310" }, { "database": "PubMed", "id": "23299888", "url": "https://pubmed.ncbi.nlm.nih.gov/23299888" } ], "uniprot_canonical_ac": "Q8N6F7-1" }, { "start_pos": 148, "end_pos": 148, "sequence_org": "Y", "sequence_mut": "F", "comment": "Prevents IL6 induced phosphorylation. Does not affect the interaction with SYK.", "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" }, { "database": "PubMed", "id": "17823310", "url": "https://pubmed.ncbi.nlm.nih.gov/17823310" }, { "database": "PubMed", "id": "23299888", "url": "https://pubmed.ncbi.nlm.nih.gov/23299888" } ], "uniprot_canonical_ac": "Q8N6F7-1" } ], "record_id": "pubmed.23299888", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recent BCR stimulation induces a negative autoregulatory loop via FBXO10 mediated degradation of HGAL.", "journal": "Leukemia", "date": "2020", "authors": "Guo F, Luo Y, Jiang X, Lu X, Roberti D, Lossos C, Kunkalla K, Magistri M, Rui L, Verdun R, Vega F, Moy VT, Lossos IS", "reference": { "type": "PubMed", "id": "31570756", "url": "https://pubmed.ncbi.nlm.nih.gov/31570756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK96-1", "protein_name": "F-box only protein 10", "gene_name": "FBXO10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 91, "end_pos": 91, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of FBXO10-mediated ubiquitination and degradation.", "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" }, { "database": "PubMed", "id": "31570756", "url": "https://pubmed.ncbi.nlm.nih.gov/31570756" } ], "uniprot_canonical_ac": "Q8N6F7-1" } ], "record_id": "pubmed.31570756", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conditional expression of HGAL leads to the development of diffuse large B-cell lymphoma in mice.", "journal": "Blood", "date": "2021", "authors": "Raboso-Gallego J, Casado-Garcia A, Jiang X, Isidro-Hernandez M, Gentles AJ, Zhao S, Natkunam Y, Blanco O, Dominguez V, Pintado B, Alonso-Lopez D, De Las Rivas J, Vicente-Duenas C, Lossos IS, Sanchez-Garcia I", "reference": { "type": "PubMed", "id": "33024996", "url": "https://pubmed.ncbi.nlm.nih.gov/33024996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33024996", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HGAL inhibits lymphoma dissemination by interacting with multiple cytoskeletal proteins.", "journal": "Blood advances", "date": "2021", "authors": "Jiang X, Lu X, Gentles AJ, Zhao D, Wander SA, Zhang Y, Natkunam Y, Slingerland J, Reis IM, Rabinovich B, Abdulreda MH, Moy VT, Lossos IS", "reference": { "type": "PubMed", "id": "34543391", "url": "https://pubmed.ncbi.nlm.nih.gov/34543391" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34543391", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Value of GCET1, HGAL (GCET2), and LMO2 in the Determination of Germinal Center Phenotype in Diffuse Large B-cell Lymphoma", "journal": "Turkish journal of haematology : official journal of Turkish Society of Haematology", "date": "2023-08-31", "authors": "Berker Neslihan, Ye\u011fen G\u00fcl\u00e7in, \u00d6zl\u00fck Yasemin, Do\u011fan \u00d6ner", "reference": { "type": "PubMed", "id": "37519110", "url": "https://pubmed.ncbi.nlm.nih.gov/37519110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N6F7-1", "protein_name": "Germinal center-associated signaling and motility protein", "gene_name": "GCSAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WD7-1", "protein_name": "Serpin A9", "gene_name": "SERPINA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25791-1", "protein_name": "Rhombotin-2", "gene_name": "LMO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N6F7", "url": "https://www.uniprot.org/uniprotkb/Q8N6F7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37519110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of a novel PDZ domain-containing peripheral Golgi protein with the Q-SNARE (Q-soluble N-ethylmaleimide-sensitive fusion protein (NSF) attachment protein receptor) protein syntaxin 6.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Charest A, Lane K, McMahon K, Housman DE", "reference": { "type": "PubMed", "id": "11384996", "url": "https://pubmed.ncbi.nlm.nih.gov/11384996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43752-1", "protein_name": "Syntaxin-6", "gene_name": "STX6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BH60-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "Gopc", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 175, "end_pos": 175, "sequence_org": "L", "sequence_mut": "V", "comment": "No effect on subcellular location; when associated with V-182; V-189 and V-196.", "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" }, { "database": "PubMed", "id": "11384996", "url": "https://pubmed.ncbi.nlm.nih.gov/11384996" } ], "uniprot_canonical_ac": "Q9HD26-1" }, { "start_pos": 182, "end_pos": 182, "sequence_org": "L", "sequence_mut": "V", "comment": "No effect on subcellular location; when associated with V-175; V-189 and V-196.", "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" }, { "database": "PubMed", "id": "11384996", "url": "https://pubmed.ncbi.nlm.nih.gov/11384996" } ], "uniprot_canonical_ac": "Q9HD26-1" }, { "start_pos": 189, "end_pos": 189, "sequence_org": "L", "sequence_mut": "V", "comment": "No effect on subcellular location; when associated with V-175; V-182 and V-196.", "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" }, { "database": "PubMed", "id": "11384996", "url": "https://pubmed.ncbi.nlm.nih.gov/11384996" } ], "uniprot_canonical_ac": "Q9HD26-1" }, { "start_pos": 196, "end_pos": 196, "sequence_org": "L", "sequence_mut": "V", "comment": "No effect on subcellular location; when associated with V-175; V-182 and V-189.", "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" }, { "database": "PubMed", "id": "11384996", "url": "https://pubmed.ncbi.nlm.nih.gov/11384996" } ], "uniprot_canonical_ac": "Q9HD26-1" } ], "record_id": "pubmed.11384996", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Golgi-associated PDZ domain protein modulates cystic fibrosis transmembrane regulator plasma membrane expression.", "journal": "The Journal of biological chemistry", "date": "2002-02-01", "authors": "Cheng Jie, Moyer Bryan D, Milewski Michal, Loffing Johannes, Ikeda Masahiro, Mickle John E, Cutting Garry R, Li Min, Stanton Bruce A, Guggino William B", "reference": { "type": "PubMed", "id": "11707463", "url": "https://pubmed.ncbi.nlm.nih.gov/11707463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34158-1", "protein_name": "Cystic fibrosis transmembrane conductance regulator", "gene_name": "Cftr", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P13569-1", "protein_name": "Cystic fibrosis transmembrane conductance regulator", "gene_name": "CFTR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11707463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6)(q21q21).", "journal": "Genes Chromosomes Cancer", "date": "2003", "authors": "Charest A, Lane K, McMahon K, Park J, Preisinger E, Conroy H, Housman D", "reference": { "type": "PubMed", "id": "12661006", "url": "https://pubmed.ncbi.nlm.nih.gov/12661006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95436-1", "protein_name": "Sodium-dependent phosphate transport protein 2B", "gene_name": "SLC34A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08922-1", "protein_name": "Proto-oncogene tyrosine-protein kinase ROS", "gene_name": "ROS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1980, "end_pos": 1980, "sequence_org": "K", "sequence_mut": "M", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P08922", "url": "https://www.uniprot.org/uniprotkb/P08922" }, { "database": "PubMed", "id": "12661006", "url": "https://pubmed.ncbi.nlm.nih.gov/12661006" } ], "uniprot_canonical_ac": "P08922-1" } ], "record_id": "pubmed.12661006", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of mature cystic fibrosis transmembrane regulator protein by the PDZ domain protein CAL.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Cheng J, Wang H, Guggino WB", "reference": { "type": "PubMed", "id": "14570915", "url": "https://pubmed.ncbi.nlm.nih.gov/14570915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14570915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "He J, Bellini M, Xu J, Castleberry AM, Hall RA", "reference": { "type": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08588-1", "protein_name": "Beta-1 adrenergic receptor", "gene_name": "ADRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62108-1", "protein_name": "Disks large homolog 4", "gene_name": "Dlg4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 474, "end_pos": 474, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 474, "end_pos": 474, "sequence_org": "E", "sequence_mut": "D", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 474, "end_pos": 474, "sequence_org": "E", "sequence_mut": "K", "comment": "Loss of interaction with GOPC; when associated with A-477.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 475, "end_pos": 475, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of interaction with GOPC. Loss of interaction with RAPGEF2. Abolishes agonist-induced Ras activation.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 475, "end_pos": 475, "sequence_org": "S", "sequence_mut": "D", "comment": "Loss of interaction with RAPGEF2.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 475, "end_pos": 475, "sequence_org": "S", "sequence_mut": "T", "comment": "Partial loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 476, "end_pos": 476, "sequence_org": "K", "sequence_mut": "A", "comment": "Partial loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "V", "sequence_mut": "A", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "V", "sequence_mut": "A", "comment": "Loss of interaction with RAPGEF2. Abolishes agonist-induced Ras activation.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "V", "sequence_mut": "F", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "V", "sequence_mut": "I", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "V", "sequence_mut": "L", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" }, { "start_pos": 477, "end_pos": 477, "sequence_org": "V", "sequence_mut": "M", "comment": "Loss of interaction with GOPC.", "evidence": [ { "database": "UniProtKB", "id": "P08588", "url": "https://www.uniprot.org/uniprotkb/P08588" }, { "database": "PubMed", "id": "15358775", "url": "https://pubmed.ncbi.nlm.nih.gov/15358775" }, { "database": "PubMed", "id": "12391161", "url": "https://pubmed.ncbi.nlm.nih.gov/12391161" } ], "uniprot_canonical_ac": "P08588-1" } ], "record_id": "pubmed.15358775", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isoform-specific interaction of golgin-160 with the Golgi-associated protein PIST.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Hicks SW, Machamer CE", "reference": { "type": "PubMed", "id": "15951434", "url": "https://pubmed.ncbi.nlm.nih.gov/15951434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08378-1", "protein_name": "Golgin subfamily A member 3", "gene_name": "GOLGA3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 121, "end_pos": 121, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of interaction with GOPC; when associated with A-128 and A-135.", "evidence": [ { "database": "UniProtKB", "id": "Q08378", "url": "https://www.uniprot.org/uniprotkb/Q08378" }, { "database": "PubMed", "id": "15951434", "url": "https://pubmed.ncbi.nlm.nih.gov/15951434" } ], "uniprot_canonical_ac": "Q08378-1" }, { "start_pos": 128, "end_pos": 128, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of interaction with GOPC; when associated with A-121 and A-135.", "evidence": [ { "database": "UniProtKB", "id": "Q08378", "url": "https://www.uniprot.org/uniprotkb/Q08378" }, { "database": "PubMed", "id": "15951434", "url": "https://pubmed.ncbi.nlm.nih.gov/15951434" } ], "uniprot_canonical_ac": "Q08378-1" }, { "start_pos": 135, "end_pos": 135, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of interaction with GOPC; when associated with A-121 and A-128.", "evidence": [ { "database": "UniProtKB", "id": "Q08378", "url": "https://www.uniprot.org/uniprotkb/Q08378" }, { "database": "PubMed", "id": "15951434", "url": "https://pubmed.ncbi.nlm.nih.gov/15951434" } ], "uniprot_canonical_ac": "Q08378-1" } ], "record_id": "pubmed.15951434", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Solution structure of GOPC PDZ domain and its interaction with the C-terminal motif of neuroligin.", "journal": "Protein Sci.", "date": "2006", "authors": "Li X, Zhang J, Cao Z, Wu J, Shi Y", "reference": { "type": "PubMed", "id": "16882988", "url": "https://pubmed.ncbi.nlm.nih.gov/16882988" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2Q7-3", "protein_name": "Neuroligin-1", "gene_name": "NLGN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16882988", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The relative binding affinities of PDZ partners for CFTR: a biochemical basis for efficient endocytic recycling.", "journal": "Biochemistry", "date": "2008", "authors": "Cushing PR, Fellows A, Villone D, Boisguerin P, Madden DR", "reference": { "type": "PubMed", "id": "18754678", "url": "https://pubmed.ncbi.nlm.nih.gov/18754678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18754678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitination and degradation of CFTR by the E3 ubiquitin ligase MARCH2 through its association with adaptor proteins CAL and STX6.", "journal": "PloS one", "date": "2013", "authors": "Cheng J, Guggino W", "reference": { "type": "PubMed", "id": "23818989", "url": "https://pubmed.ncbi.nlm.nih.gov/23818989" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43752-1", "protein_name": "Syntaxin-6", "gene_name": "STX6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13569-1", "protein_name": "Cystic fibrosis transmembrane conductance regulator", "gene_name": "CFTR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0N8-1", "protein_name": "E3 ubiquitin-protein ligase MARCHF2", "gene_name": "MARCHF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 216, "end_pos": 404, "sequence_org": "GRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNP", "sequence_mut": "", "comment": "Abolishes interaction with MARCHF2.", "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" }, { "database": "PubMed", "id": "23818989", "url": "https://pubmed.ncbi.nlm.nih.gov/23818989" } ], "uniprot_canonical_ac": "Q9HD26-1" }, { "start_pos": 1478, "end_pos": 1480, "sequence_org": "TRL", "sequence_mut": "", "comment": "Reduces interaction with MARCHF2 and abolishes subsequent MARCHF2-mediated degradation. No effect on localization to the Golgi.", "evidence": [ { "database": "UniProtKB", "id": "P13569", "url": "https://www.uniprot.org/uniprotkb/P13569" }, { "database": "PubMed", "id": "23818989", "url": "https://pubmed.ncbi.nlm.nih.gov/23818989" } ], "uniprot_canonical_ac": "P13569-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes ubiquitination of ERGIC3 and CFTR, and degradation of CFTR; when associated with S-67. Reduces ubiquitination of DLG1; when associated with S-67, S-106 and S-109. Reduces inhibition of HIV-1 virus production and VSVG protein expression; when associated with S-67. Abolishes ubiquitination of IKBKG/NEMO; when associated with S-67 and Q-90.", "evidence": [ { "database": "UniProtKB", "id": "Q9P0N8", "url": "https://www.uniprot.org/uniprotkb/Q9P0N8" }, { "database": "PubMed", "id": "23818989", "url": "https://pubmed.ncbi.nlm.nih.gov/23818989" }, { "database": "PubMed", "id": "17980554", "url": "https://pubmed.ncbi.nlm.nih.gov/17980554" }, { "database": "PubMed", "id": "32935379", "url": "https://pubmed.ncbi.nlm.nih.gov/32935379" }, { "database": "PubMed", "id": "31142615", "url": "https://pubmed.ncbi.nlm.nih.gov/31142615" }, { "database": "PubMed", "id": "29573664", "url": "https://pubmed.ncbi.nlm.nih.gov/29573664" } ], "uniprot_canonical_ac": "Q9P0N8-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes ubiquitination of ERGIC3 and CFTR, and degradation of CFTR; when associated with S-64. Reduces ubiquitination of DLG1; when associated with S-64, S-106 and S-109. Reduces inhibition of HIV-1 virus production and VSVG protein expression; when associated with S-64. Abolishes ubiquitination of IKBKG/NEMO; when associated with S-64 and Q-90.", "evidence": [ { "database": "UniProtKB", "id": "Q9P0N8", "url": "https://www.uniprot.org/uniprotkb/Q9P0N8" }, { "database": "PubMed", "id": "23818989", "url": "https://pubmed.ncbi.nlm.nih.gov/23818989" }, { "database": "PubMed", "id": "17980554", "url": "https://pubmed.ncbi.nlm.nih.gov/17980554" }, { "database": "PubMed", "id": "32935379", "url": "https://pubmed.ncbi.nlm.nih.gov/32935379" }, { "database": "PubMed", "id": "31142615", "url": "https://pubmed.ncbi.nlm.nih.gov/31142615" }, { "database": "PubMed", "id": "29573664", "url": "https://pubmed.ncbi.nlm.nih.gov/29573664" } ], "uniprot_canonical_ac": "Q9P0N8-1" } ], "record_id": "pubmed.23818989", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct Molecular Features of NleG Type 3 Secreted Effectors Allow for Different Roles during Citrobacter rodentium Infection in Mice.", "journal": "Infect. Immun.", "date": "2023", "authors": "Popov Georgy, Fiebig-Comyn Aline, Syriste Lukas, Little Dustin J, Skarina Tatiana, Stogios Peter J, Birstonas Sarah, Coombes Brian K, Savchenko Alexei", "reference": { "type": "PubMed", "id": "36511702", "url": "https://pubmed.ncbi.nlm.nih.gov/36511702" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HD26-1", "protein_name": "Golgi-associated PDZ and coiled-coil motif-containing protein", "gene_name": "GOPC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HD26", "url": "https://www.uniprot.org/uniprotkb/Q9HD26" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36511702", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9.", "journal": "FEBS letters", "date": "2007", "authors": "Arai S, Matsushita A, Du K, Yagi K, Okazaki Y, Kurokawa R", "reference": { "type": "PubMed", "id": "18022393", "url": "https://pubmed.ncbi.nlm.nih.gov/18022393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NE63-1", "protein_name": "Homeodomain-interacting protein kinase 4", "gene_name": "HIPK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3V016-1", "protein_name": "Homeodomain-interacting protein kinase 4", "gene_name": "Hipk4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P02340-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "Tp53; Trp53", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NE63", "url": "https://www.uniprot.org/uniprotkb/Q8NE63" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 40, "end_pos": 40, "sequence_org": "K", "sequence_mut": "S", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q3V016", "url": "https://www.uniprot.org/uniprotkb/Q3V016" }, { "database": "PubMed", "id": "18022393", "url": "https://pubmed.ncbi.nlm.nih.gov/18022393" } ], "uniprot_canonical_ac": "Q3V016-1" } ], "phosphorylation": [ { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HIPK4", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "18022393", "url": "https://pubmed.ncbi.nlm.nih.gov/18022393" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20635899", "url": "https://pubmed.ncbi.nlm.nih.gov/20635899" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22914926", "url": "https://pubmed.ncbi.nlm.nih.gov/22914926" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "28878400", "url": "https://pubmed.ncbi.nlm.nih.gov/28878400" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29334793", "url": "https://pubmed.ncbi.nlm.nih.gov/29334793" }, { "database": "PubMed", "id": "30066888", "url": "https://pubmed.ncbi.nlm.nih.gov/30066888" }, { "database": "PubMed", "id": "31466709", "url": "https://pubmed.ncbi.nlm.nih.gov/31466709" }, { "database": "PubMed", "id": "32398747", "url": "https://pubmed.ncbi.nlm.nih.gov/32398747" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" } ], "site_lbl": "Ser9", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HIPK4", "evidence": [ { "database": "UniProtKB", "id": "P02340", "url": "https://www.uniprot.org/uniprotkb/P02340" }, { "database": "iPTMnet", "id": "P02340", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02340" }, { "database": "PubMed", "id": "18022393", "url": "https://pubmed.ncbi.nlm.nih.gov/18022393" } ], "site_lbl": "Ser12", "uniprot_canonical_ac": "P02340-1" }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HIPK4", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "18022393", "url": "https://pubmed.ncbi.nlm.nih.gov/18022393" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20635899", "url": "https://pubmed.ncbi.nlm.nih.gov/20635899" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22914926", "url": "https://pubmed.ncbi.nlm.nih.gov/22914926" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "28878400", "url": "https://pubmed.ncbi.nlm.nih.gov/28878400" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29334793", "url": "https://pubmed.ncbi.nlm.nih.gov/29334793" }, { "database": "PubMed", "id": "30066888", "url": "https://pubmed.ncbi.nlm.nih.gov/30066888" }, { "database": "PubMed", "id": "31466709", "url": "https://pubmed.ncbi.nlm.nih.gov/31466709" }, { "database": "PubMed", "id": "32398747", "url": "https://pubmed.ncbi.nlm.nih.gov/32398747" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" } ], "site_lbl": "Ser9", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.18022393", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK).", "journal": "Cell communication and signaling : CCS", "date": "2015", "authors": "van der Laden J, Soppa U, Becker W", "reference": { "type": "PubMed", "id": "25630557", "url": "https://pubmed.ncbi.nlm.nih.gov/25630557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NE63-1", "protein_name": "Homeodomain-interacting protein kinase 4", "gene_name": "HIPK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X6-1", "protein_name": "Homeodomain-interacting protein kinase 2", "gene_name": "HIPK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NE63", "url": "https://www.uniprot.org/uniprotkb/Q8NE63" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 361, "end_pos": 361, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q9H2X6", "url": "https://www.uniprot.org/uniprotkb/Q9H2X6" }, { "database": "iPTMnet", "id": "Q9H2X6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H2X6" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "23565059", "url": "https://pubmed.ncbi.nlm.nih.gov/23565059" }, { "database": "PubMed", "id": "25630557", "url": "https://pubmed.ncbi.nlm.nih.gov/25630557" }, { "database": "PubMed", "id": "29277937", "url": "https://pubmed.ncbi.nlm.nih.gov/29277937" } ], "site_lbl": "Tyr361", "uniprot_canonical_ac": "Q9H2X6-1" } ], "record_id": "pubmed.25630557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An RNAi Screen Reveals an Essential Role for HIPK4 in Human Skin Epithelial Differentiation from iPSCs.", "journal": "Stem cell reports", "date": "2017", "authors": "Larribere L, Galach M, Novak D, Arevalo K, Volz HC, Stark HJ, Boukamp P, Boutros M, Utikal J", "reference": { "type": "PubMed", "id": "28966120", "url": "https://pubmed.ncbi.nlm.nih.gov/28966120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NE63-1", "protein_name": "Homeodomain-interacting protein kinase 4", "gene_name": "HIPK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NE63", "url": "https://www.uniprot.org/uniprotkb/Q8NE63" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28966120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homeodomain-interacting protein kinase HIPK4 regulates phosphorylation of manchette protein RIMBP3 during spermiogenesis.", "journal": "The Journal of biological chemistry", "date": "2022-09", "authors": "Liu Xiaofei, Zang Chunyan, Wu Yifei, Meng Ru, Chen Yu, Jiang Tao, Wang Cheng, Yang Xiaoyu, Guo Yueshuai, Situ Chenghao, Hu Zhibin, Zhang Jun, Guo Xuejiang", "reference": { "type": "PubMed", "id": "35931115", "url": "https://pubmed.ncbi.nlm.nih.gov/35931115" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NE63-1", "protein_name": "Homeodomain-interacting protein kinase 4", "gene_name": "HIPK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UFD9-1", "protein_name": "RIMS-binding protein 3A", "gene_name": "RIMBP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NE63", "url": "https://www.uniprot.org/uniprotkb/Q8NE63" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35931115", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MS-KIF18A, new kinesin; structure and cellular expression.", "journal": "Gene", "date": "2005", "authors": "Luboshits G, Benayahu D", "reference": { "type": "PubMed", "id": "15878648", "url": "https://pubmed.ncbi.nlm.nih.gov/15878648" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15878648", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MS-KIF18A, a kinesin, is associated with estrogen receptor.", "journal": "J. Cell. Biochem.", "date": "2007", "authors": "Luboshits G, Benayahu D", "reference": { "type": "PubMed", "id": "17006958", "url": "https://pubmed.ncbi.nlm.nih.gov/17006958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17006958", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The kinesin-8 motor Kif18A suppresses kinetochore movements to control mitotic chromosome alignment.", "journal": "Developmental cell", "date": "2008-02", "authors": "Stumpff Jason, von Dassow George, Wagenbach Michael, Asbury Charles, Wordeman Linda", "reference": { "type": "PubMed", "id": "18267093", "url": "https://pubmed.ncbi.nlm.nih.gov/18267093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18267093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinesin-8 molecular motors: putting the brakes on chromosome oscillations.", "journal": "Trends in cell biology", "date": "2008-07", "authors": "Gardner Melissa K, Odde David J, Bloom Kerry", "reference": { "type": "PubMed", "id": "18513970", "url": "https://pubmed.ncbi.nlm.nih.gov/18513970" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18513970", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New insights on cellular distribution, microtubule interactions and post-translational modifications of MS-KIF18A.", "journal": "Journal of cellular physiology", "date": "2008", "authors": "Zusev M, Benayahu D", "reference": { "type": "PubMed", "id": "18680169", "url": "https://pubmed.ncbi.nlm.nih.gov/18680169" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18680169", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Defects in chromosome congression and mitotic progression in KIF18A-deficient cells are partly mediated through impaired functions of CENP-E.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009-08-15", "authors": "Huang Ying, Yao Yixin, Xu Han-Zhang, Wang Zhu-Gang, Lu Luo, Dai Wei", "reference": { "type": "PubMed", "id": "19625775", "url": "https://pubmed.ncbi.nlm.nih.gov/19625775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60566-1", "protein_name": "Mitotic checkpoint serine/threonine-protein kinase BUB1 beta", "gene_name": "BUB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19625775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The regulation of MS-KIF18A expression and cross talk with estrogen receptor.", "journal": "PLoS ONE", "date": "2009", "authors": "Zusev Margalit, Benayahu Dafna", "reference": { "type": "PubMed", "id": "19636373", "url": "https://pubmed.ncbi.nlm.nih.gov/19636373" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19636373", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Length-dependent poleward flux of sister kinetochore fibers promotes chromosome alignment.", "journal": "Cell reports", "date": "2022", "authors": "Risteski P, Bozan D, Jagric M, Bosilj A, Pavin N, Tolic IM", "reference": { "type": "PubMed", "id": "35926461", "url": "https://pubmed.ncbi.nlm.nih.gov/35926461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14980-1", "protein_name": "Nuclear mitotic apparatus protein 1", "gene_name": "NUMA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35926461", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KIF18A inactivates hepatic stellate cells and alleviates liver fibrosis through the TTC3/Akt/mTOR pathway.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2024-02-19", "authors": "Zhang Hao, Xia Tong, Xia Zhijia, Zhou Huaxin, Li Zhipeng, Wang Wei, Zhai Xiangyu, Jin Bin", "reference": { "type": "PubMed", "id": "38372748", "url": "https://pubmed.ncbi.nlm.nih.gov/38372748" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38372748", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinesin Family Member-18A (KIF18A) Promotes Cell Proliferation and Metastasis in Hepatocellular Carcinoma.", "journal": "Digestive diseases and sciences", "date": "2024-04", "authors": "Ren Jihua, Yao Xinyan, Yang Minli, Cheng Shengtao, Wu Daiqing, Xu Kexin, Li Ranran, Zhang Han, Zhang Dapeng", "reference": { "type": "PubMed", "id": "38446308", "url": "https://pubmed.ncbi.nlm.nih.gov/38446308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38446308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Next-Generation Metabolic Glycosylation Reporters Enable Detection of Protein O-GlcNAcylation in Living Cells without S-Glyco Modification.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2024-05-13", "authors": "Kufleitner Markus, Haiber Lisa Maria, Li Shuang, Surendran Harsha, Mayer Thomas U, Zumbusch Andreas, Wittmann Valentin", "reference": { "type": "PubMed", "id": "38501674", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 136, "start_aa": "Thr", "end_pos": 136, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr136", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "Q8NI77", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8NI77" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q8NI77-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 883, "start_aa": "Ser", "end_pos": 883, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser883", "evidence": [ { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "Q8NI77", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q8NI77" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "Q8NI77", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q8NI77" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q8NI77-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 317, "start_aa": "Thr", "end_pos": 317, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr317", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" }, { "id": "2844", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2844" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 550, "start_aa": "Ser", "end_pos": 550, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser550", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" }, { "id": "2844", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2844" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 627, "start_aa": "Thr", "end_pos": 627, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr627", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 647, "start_aa": "Thr", "end_pos": 647, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr647", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 648, "start_aa": "Thr", "end_pos": 648, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr648", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" }, { "id": "37541260", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" }, { "id": "2844", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2844" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 649, "start_aa": "Thr", "end_pos": 649, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr649", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "25944660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25944660" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 651, "start_aa": "Ser", "end_pos": 651, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser651", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 654, "start_aa": "Ser", "end_pos": 654, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser654", "evidence": [ { "id": "20863279", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20863279" }, { "id": "Q12778", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q12778" }, { "id": "S550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S550" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "T627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T627" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "30002415", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30002415" }, { "id": "28713921", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28713921" }, { "id": "26789264", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26789264" }, { "id": "41102146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146" }, { "id": "S654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/S654" }, { "id": "31492838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "27655845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27655845" }, { "id": "18420577", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18420577" }, { "id": "T648", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/T648" }, { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "41102146T317", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41102146T317" }, { "id": "Q12778", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q12778" }, { "id": "2844", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2844" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q12778-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 149, "start_aa": "Ser", "end_pos": 149, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser149", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P04637", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04637" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "30086259", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30086259" }, { "id": "27402830", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27402830" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "25619971", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25619971" }, { "id": "20668475", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20668475" }, { "id": "22365600", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22365600" }, { "id": "30462203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30462203" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "16964247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16964247" }, { "id": "28878262", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28878262" }, { "id": "P04637", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04637" }, { "id": "34417460", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34417460" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "P04637-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 149, "start_aa": "Ser", "end_pos": 149, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser149", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P04637", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04637" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "30086259", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30086259" }, { "id": "27402830", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27402830" }, { "id": "38501674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38501674" }, { "id": "25619971", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25619971" }, { "id": "20668475", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20668475" }, { "id": "22365600", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22365600" }, { "id": "30462203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30462203" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "16964247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16964247" }, { "id": "28878262", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28878262" }, { "id": "P04637", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04637" }, { "id": "34417460", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34417460" } ], "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.38501674", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 11 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 11 }, { "field": "exact_o_linked_sites", "count": 11 }, { "field": "exact_o_linked_glycan_sites", "count": 11 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 11 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 11 }, { "field": "exact_o_linked_sites", "count": 11 }, { "field": "exact_o_linked_glycan_sites", "count": 11 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KIF18A promotes cervical squamous cell carcinoma progression by activating the PI3K/AKT pathway through upregulation of CENPE.", "journal": "Cancer biomarkers : section A of Disease markers", "date": "2024", "authors": "Sun Fengyi, Zhao Tiantian", "reference": { "type": "PubMed", "id": "39331093", "url": "https://pubmed.ncbi.nlm.nih.gov/39331093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NI77", "url": "https://www.uniprot.org/uniprotkb/Q8NI77" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39331093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GRAIL: an E3 ubiquitin ligase that inhibits cytokine gene transcription is expressed in anergic CD4+ T cells.", "journal": "Immunity", "date": "2003", "authors": "Anandasabapathy N, Ford GS, Bloom D, Holness C, Paragas V, Seroogy C, Skrenta H, Hollenhorst M, Fathman CG, Soares L", "reference": { "type": "PubMed", "id": "12705856", "url": "https://pubmed.ncbi.nlm.nih.gov/12705856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D304-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "Rnf128", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12705856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GRAIL is up-regulated in CD4+ CD25+ T regulatory cells and is sufficient for conversion of T cells to a regulatory phenotype.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "MacKenzie DA, Schartner J, Lin J, Timmel A, Jennens-Clough M, Fathman CG, Seroogy CM", "reference": { "type": "PubMed", "id": "17259178", "url": "https://pubmed.ncbi.nlm.nih.gov/17259178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17259178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Up-regulation of gene related to anergy in lymphocytes is associated with Notch-mediated human T cell suppression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Kostianovsky AM, Maier LM, Baecher-Allan C, Anderson AC, Anderson DE", "reference": { "type": "PubMed", "id": "17475842", "url": "https://pubmed.ncbi.nlm.nih.gov/17475842" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17475842", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The single subunit transmembrane E3 ligase gene related to anergy in lymphocytes (GRAIL) captures and then ubiquitinates transmembrane proteins across the cell membrane.", "journal": "The Journal of biological chemistry", "date": "2008-10-17", "authors": "Lineberry Neil, Su Leon, Soares Luis, Fathman C Garrison", "reference": { "type": "PubMed", "id": "18713730", "url": "https://pubmed.ncbi.nlm.nih.gov/18713730" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48509-1", "protein_name": "CD151 antigen", "gene_name": "CD151", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 17, "end_pos": 17, "sequence_org": "K", "sequence_mut": "R", "comment": "Complete loss of RNF128-mediated ubiquitination; when associated with R-7 and R-8.", "evidence": [ { "database": "UniProtKB", "id": "P48509", "url": "https://www.uniprot.org/uniprotkb/P48509" }, { "database": "PubMed", "id": "18713730", "url": "https://pubmed.ncbi.nlm.nih.gov/18713730" } ], "uniprot_canonical_ac": "P48509-1" }, { "start_pos": 7, "end_pos": 7, "sequence_org": "K", "sequence_mut": "R", "comment": "Complete loss of RNF128-mediated ubiquitination; when associated with R-8 and R-17.", "evidence": [ { "database": "UniProtKB", "id": "P48509", "url": "https://www.uniprot.org/uniprotkb/P48509" }, { "database": "PubMed", "id": "18713730", "url": "https://pubmed.ncbi.nlm.nih.gov/18713730" } ], "uniprot_canonical_ac": "P48509-1" }, { "start_pos": 8, "end_pos": 8, "sequence_org": "K", "sequence_mut": "R", "comment": "Complete loss of RNF128-mediated ubiquitination; when associated with R-7 and R-17.", "evidence": [ { "database": "UniProtKB", "id": "P48509", "url": "https://www.uniprot.org/uniprotkb/P48509" }, { "database": "PubMed", "id": "18713730", "url": "https://pubmed.ncbi.nlm.nih.gov/18713730" } ], "uniprot_canonical_ac": "P48509-1" } ], "record_id": "pubmed.18713730", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The transmembrane E3 ligase GRAIL ubiquitinates and degrades CD83 on CD4 T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Su LL, Iwai H, Lin JT, Fathman CG", "reference": { "type": "PubMed", "id": "19542455", "url": "https://pubmed.ncbi.nlm.nih.gov/19542455" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19542455", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GRAIL (gene related to anergy in lymphocytes) regulates cytoskeletal reorganization through ubiquitination and degradation of Arp2/3 subunit 5 and coronin 1A.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Ichikawa D, Mizuno M, Yamamura T, Miyake S", "reference": { "type": "PubMed", "id": "22016387", "url": "https://pubmed.ncbi.nlm.nih.gov/22016387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15511-1", "protein_name": "Actin-related protein 2/3 complex subunit 5", "gene_name": "ARPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31146-1", "protein_name": "Coronin-1A", "gene_name": "CORO1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CPW4-1", "protein_name": "Actin-related protein 2/3 complex subunit 5", "gene_name": "Arpc5", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22016387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "UBCH5 Family Members Differentially Impact Stabilization of Mutant p53 via RNF128 Iso1 During Barrett's Progression to Esophageal Adenocarcinoma.", "journal": "Cellular and molecular gastroenterology and hepatology", "date": "2022", "authors": "Ray P, Nancarrow DJ, Ferrer-Torres D, Wang Z, San Martinho M, Hinton T, Wu JH, Wu A, Turgeon DK, Hammer MA, Dame MK, Lawrence TS, O'Brien PJ, Spence JR, Beer DG, Ray D", "reference": { "type": "PubMed", "id": "34416429", "url": "https://pubmed.ncbi.nlm.nih.gov/34416429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34416429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RING finger protein 128 (RNF128) regulates malignant biological behaviors of colorectal cancer cells via PI3K/AKT signaling pathway.", "journal": "Cell biology international", "date": "2022", "authors": "Zhuang Y, Liu PF, Zhan Y, Kong DL, Tian F, Zhao P", "reference": { "type": "PubMed", "id": "35723244", "url": "https://pubmed.ncbi.nlm.nih.gov/35723244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35723244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNF128 expression in lung adenocarcinoma is a favorable prognostic factor associated with decreased tumor-associated macrophages.", "journal": "Thoracic cancer", "date": "2023-06", "authors": "Fujimoto Syuusuke, Kyuichi Kadota, Kaede Yamada, Chihiro Yoshida, Emi Ibuki, Ryo Ishikawa, Reiji Haba, Toshiki Yajima, Yokomise Hiroyasu", "reference": { "type": "PubMed", "id": "37186218", "url": "https://pubmed.ncbi.nlm.nih.gov/37186218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37186218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNF128 regulates neutrophil infiltration and myeloperoxidase functions to prevent acute lung injury.", "journal": "Cell death & disease", "date": "2023-06-21", "authors": "Liu Pei-Yao, Chen Chih-Yuan, Lin Yu-Lung, Lin Chien-Ming, Tsai Wen-Chiuan, Tsai Yu-Ling, Lin Gu-Jiun, Chen Yu-Guang, Wang Shih-Yun, Sun Rui-Nong, Huang Yu-Chuan, Chang Hung, Chen Ying-Chuan", "reference": { "type": "PubMed", "id": "37344492", "url": "https://pubmed.ncbi.nlm.nih.gov/37344492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D304-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "Rnf128", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37344492", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of tumor-derived extracellular vesicles in prostatic cancer progression through the circFMN2/KLF2/RNF128 axis.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2023-10", "authors": "Huang Shuang, Zhao Jianming, Yu Hongkai, Chen Guangfu", "reference": { "type": "PubMed", "id": "37452271", "url": "https://pubmed.ncbi.nlm.nih.gov/37452271" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ56-1", "protein_name": "Formin-2", "gene_name": "FMN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37452271", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E3 ubiquitin ligase RNF128 negatively regulates the IL-3/STAT5 signaling pathway by facilitating K27-linked polyubiquitination of IL-3R\u03b1.", "journal": "Cell communication and signaling : CCS", "date": "2024-05-03", "authors": "Yu Jingge, Li Jianguo, Shen Ao, Liu Zhiping, He Tian-Sheng", "reference": { "type": "PubMed", "id": "38702781", "url": "https://pubmed.ncbi.nlm.nih.gov/38702781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26951-1", "protein_name": "Interleukin-3 receptor subunit alpha", "gene_name": "IL3RA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38702781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GRAIL1 Stabilizes Misfolded Mutant p53 through a Ubiquitin Ligase-Independent, Chaperone Regulatory Function.", "journal": "Molecular cancer research : MCR", "date": "2024-11-01", "authors": "Ray Paramita, Jaiswal Sangeeta, Ferrer-Torres Daysha, Wang Zhuwen, Nancarrow Derek, Curtin Meghan, Martinho May San, Lacy Shannon M, Kasturirangan Srimathi, Thomas Dafydd, Spence Jason R, Truttmann Matthias C, Lagisetty Kiran H, Lawrence Theodore S, Wang Thomas D, Beer David G, Ray Dipankar", "reference": { "type": "PubMed", "id": "39018356", "url": "https://pubmed.ncbi.nlm.nih.gov/39018356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TEB7-1", "protein_name": "E3 ubiquitin-protein ligase RNF128", "gene_name": "RNF128", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TEB7", "url": "https://www.uniprot.org/uniprotkb/Q8TEB7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39018356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sorting nexin 12 interacts with BACE1 and regulates BACE1-mediated APP processing.", "journal": "Molecular neurodegeneration", "date": "2012", "authors": "Zhao Y, Wang Y, Yang J, Wang X, Zhao Y, Zhang X, Zhang YW", "reference": { "type": "PubMed", "id": "22709416", "url": "https://pubmed.ncbi.nlm.nih.gov/22709416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UMY4-2", "protein_name": "Sorting nexin-12", "gene_name": "SNX12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UMY4", "url": "https://www.uniprot.org/uniprotkb/Q9UMY4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22709416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SNX12 role in endosome membrane transport.", "journal": "PloS one", "date": "2012", "authors": "Pons V, Ustunel C, Rolland C, Torti E, Parton RG, Gruenberg J", "reference": { "type": "PubMed", "id": "22719997", "url": "https://pubmed.ncbi.nlm.nih.gov/22719997" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UMY4-2", "protein_name": "Sorting nexin-12", "gene_name": "SNX12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UMY4", "url": "https://www.uniprot.org/uniprotkb/Q9UMY4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22719997", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Essential and selective role of SNX12 in transport of endocytic and retrograde cargo.", "journal": "Journal of cell science", "date": "2017", "authors": "Priya A, Sugatha J, Parveen S, Lacas-Gervais S, Raj P, Gilleron J, Datta S", "reference": { "type": "PubMed", "id": "28705836", "url": "https://pubmed.ncbi.nlm.nih.gov/28705836" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UMY4-2", "protein_name": "Sorting nexin-12", "gene_name": "SNX12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UMY4", "url": "https://www.uniprot.org/uniprotkb/Q9UMY4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28705836", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAPB - a novel SNARE-associated protein for early-onset epileptic encephalopathy.", "journal": "Clinical genetics", "date": "2016-02", "authors": "Conroy J, Allen N M, Gorman K M, Shahwan A, Ennis S, Lynch S A, King M D", "reference": { "type": "PubMed", "id": "26235277", "url": "https://pubmed.ncbi.nlm.nih.gov/26235277" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H115", "url": "https://www.uniprot.org/uniprotkb/Q9H115" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26235277", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diagnostic Yield and Novel Candidate Genes by Exome Sequencing in 152 Consanguineous Families With Neurodevelopmental Disorders.", "journal": "JAMA psychiatry", "date": "2017", "authors": "Reuter MS, Tawamie H, Buchert R, Hosny Gebril O, Froukh T, Thiel C, Uebe S, Ekici AB, Krumbiegel M, Zweier C, Hoyer J, Eberlein K, Bauer J, Scheller U, Strom TM, Hoffjan S, Abdelraouf ER, Meguid NA, Abboud A, Al Khateeb MA, Fakher M, Hamdan S, Ismael A, Muhammad S, Abdallah E, Sticht H, Wieczorek D, Reis A, Abou Jamra R", "reference": { "type": "PubMed", "id": "28097321", "url": "https://pubmed.ncbi.nlm.nih.gov/28097321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ89-1", "protein_name": "Ferry endosomal RAB5 effector complex subunit 3", "gene_name": "FERRY3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29692-1", "protein_name": "Elongation factor 1-delta", "gene_name": "EEF1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14831-1", "protein_name": "Metabotropic glutamate receptor 7", "gene_name": "GRM7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15021-1", "protein_name": "Condensin complex subunit 1", "gene_name": "NCAPD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XK2-1", "protein_name": "F-box only protein 11", "gene_name": "FBXO11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H115", "url": "https://www.uniprot.org/uniprotkb/Q9H115" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28097321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel NAPB splicing mutation identified by Trio-based exome sequencing is associated with early-onset epileptic encephalopathy.", "journal": "European journal of medical genetics", "date": "2021", "authors": "Zhao X, Wang Y, Cai A, Mei S, Liu N, Kong X", "reference": { "type": "PubMed", "id": "33189936", "url": "https://pubmed.ncbi.nlm.nih.gov/33189936" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H115", "url": "https://www.uniprot.org/uniprotkb/Q9H115" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33189936", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAPB and developmental and epileptic encephalopathy: description of the electro-clinical profile associated to a novel pathogenic variant.", "journal": "Epilepsia", "date": "2023-04-04", "authors": "Mignon-Ravix C\u00e9cile, Riccardi Florence, Daquin G\u00e9raldine, Cacciagli Pierre, Lamoureux-Toth Sylvie, Villard Laurent, Villeneuve Nathalie, Molinari Florence", "reference": { "type": "PubMed", "id": "37014259", "url": "https://pubmed.ncbi.nlm.nih.gov/37014259" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H115", "url": "https://www.uniprot.org/uniprotkb/Q9H115" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37014259", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peroxisomes : novel findings and future directions.", "journal": "Histochemistry and cell biology", "date": "2023-05", "authors": "Pedrosa Ana G, Reglinski Katharina, Lismont Celien, Kors Suzan, Costello Joseph, Rodrigues Tony A, Marques Mariana, Linka Nicole, Argyriou Catherine, Weinhofer Isabelle, Kocherlakota Sai, Riccio Victoria, Ferreira Vanessa, Di Cara Francesca, Ferreira Ana Rita, Francisco T\u00e2nia, Azevedo Jorge E, Ribeiro Daniela", "reference": { "type": "PubMed", "id": "37160800", "url": "https://pubmed.ncbi.nlm.nih.gov/37160800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5I0X4-1", "protein_name": "Peroxisomal biogenesis factor 39", "gene_name": "PEX39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5I0X4", "url": "https://www.uniprot.org/uniprotkb/Q5I0X4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37160800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PEX39 facilitates the peroxisomal import of PTS2-containing proteins.", "journal": "Nature cell biology", "date": "2025-08", "authors": "Chen Walter W, Rodrigues Tony A, Wendscheck Daniel, Pedrosa Ana G, Yang Chendong, Francisco T\u00e2nia, M\u00f6cklinghoff Till, Zografakis Alexandros, Nunes-Silva Bernardo, Avraham Reut E, Silva Ana R, Ferreira Maria J, Das Hirak, Koster Janet, Neuwirth Simone, Bender Julian, Oeljeklaus Silke, Sondhi Varun, Gatsogiannis Christos, Schuldiner Maya, Zalckvar Einat, Hofmann Kay, Waterham Hans R, DeBerardinis Ralph J, Azevedo Jorge E, Warscheid Bettina", "reference": { "type": "PubMed", "id": "40739340", "url": "https://pubmed.ncbi.nlm.nih.gov/40739340" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5I0X4-1", "protein_name": "Peroxisomal biogenesis factor 39", "gene_name": "PEX39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80667-1", "protein_name": "Peroxisomal membrane protein PEX13", "gene_name": "PEX13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47087-1", "protein_name": "Peroxisomal biogenesis factor 39", "gene_name": "PEX39", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92968-1", "protein_name": "Peroxisomal membrane protein PEX13", "gene_name": "PEX13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00628-1", "protein_name": "Peroxisomal targeting signal 2 receptor", "gene_name": "PEX7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P39108-1", "protein_name": "Peroxisomal targeting signal 2 receptor", "gene_name": "PEX7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5I0X4", "url": "https://www.uniprot.org/uniprotkb/Q5I0X4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 59, "end_pos": 62, "sequence_org": "KPWE", "sequence_mut": "AAAA", "comment": "Abolishes interaction with PEX7.", "evidence": [ { "database": "UniProtKB", "id": "Q5I0X4", "url": "https://www.uniprot.org/uniprotkb/Q5I0X4" }, { "database": "PubMed", "id": "40739340", "url": "https://pubmed.ncbi.nlm.nih.gov/40739340" } ], "uniprot_canonical_ac": "Q5I0X4-1" }, { "start_pos": 10, "end_pos": 13, "sequence_org": "KPWE", "sequence_mut": "AAAA", "comment": "Leads to PEX7 being stalled at the peroxisomal membrane. Decreases growth on oleic acid carbon source.", "evidence": [ { "database": "UniProtKB", "id": "P80667", "url": "https://www.uniprot.org/uniprotkb/P80667" }, { "database": "PubMed", "id": "40739340", "url": "https://pubmed.ncbi.nlm.nih.gov/40739340" } ], "uniprot_canonical_ac": "P80667-1" }, { "start_pos": 48, "end_pos": 51, "sequence_org": "RPWE", "sequence_mut": "AAAA", "comment": "Decreases PEX7 protein level. Decreases import of proteins containing an N-terminal PTS2-type targeting signal into the peroxisome matrix. Decreases growth on oleic acid carbon source.", "evidence": [ { "database": "UniProtKB", "id": "P47087", "url": "https://www.uniprot.org/uniprotkb/P47087" }, { "database": "PubMed", "id": "40739340", "url": "https://pubmed.ncbi.nlm.nih.gov/40739340" } ], "uniprot_canonical_ac": "P47087-1" }, { "start_pos": 10, "end_pos": 13, "sequence_org": "KPWE", "sequence_mut": "AAAA", "comment": "Abolishes interaction with PEX7.", "evidence": [ { "database": "UniProtKB", "id": "Q92968", "url": "https://www.uniprot.org/uniprotkb/Q92968" }, { "database": "PubMed", "id": "40739340", "url": "https://pubmed.ncbi.nlm.nih.gov/40739340" } ], "uniprot_canonical_ac": "Q92968-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes interaction with PEX39. Abolishes interaction with PEX13.", "evidence": [ { "database": "UniProtKB", "id": "O00628", "url": "https://www.uniprot.org/uniprotkb/O00628" }, { "database": "PubMed", "id": "40739340", "url": "https://pubmed.ncbi.nlm.nih.gov/40739340" } ], "uniprot_canonical_ac": "O00628-1" } ], "record_id": "pubmed.40739340", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane recruitment of DOCK180 by binding to PtdIns(3,4,5)P3.", "journal": "Biochem. J.", "date": "2001", "authors": "Kobayashi S, Shirai T, Kiyokawa E, Mochizuki N, Matsuda M, Fukui Y", "reference": { "type": "PubMed", "id": "11171081", "url": "https://pubmed.ncbi.nlm.nih.gov/11171081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11171081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and kinetic analysis of the interaction between Nck-2 and DOCK180.", "journal": "FEBS Lett.", "date": "2001", "authors": "Tu Y, Kucik DF, Wu C", "reference": { "type": "PubMed", "id": "11240126", "url": "https://pubmed.ncbi.nlm.nih.gov/11240126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 148, "end_pos": 148, "sequence_org": "W", "sequence_mut": "K", "comment": "Abolishes interaction with DOCK1.", "evidence": [ { "database": "UniProtKB", "id": "O43639", "url": "https://www.uniprot.org/uniprotkb/O43639" }, { "database": "PubMed", "id": "11240126", "url": "https://pubmed.ncbi.nlm.nih.gov/11240126" } ], "uniprot_canonical_ac": "O43639-1" }, { "start_pos": 234, "end_pos": 234, "sequence_org": "W", "sequence_mut": "K", "comment": "Abolishes interaction with DOCK1 and IRS1.", "evidence": [ { "database": "UniProtKB", "id": "O43639", "url": "https://www.uniprot.org/uniprotkb/O43639" }, { "database": "PubMed", "id": "11240126", "url": "https://pubmed.ncbi.nlm.nih.gov/11240126" }, { "database": "PubMed", "id": "11171109", "url": "https://pubmed.ncbi.nlm.nih.gov/11171109" } ], "uniprot_canonical_ac": "O43639-1" } ], "record_id": "pubmed.11240126", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The netrin-1 receptor DCC promotes filopodia formation and cell spreading by activating Cdc42 and Rac1.", "journal": "Molecular and cellular neurosciences", "date": "2002", "authors": "Shekarabi M, Kennedy TE", "reference": { "type": "PubMed", "id": "11817894", "url": "https://pubmed.ncbi.nlm.nih.gov/11817894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11817894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The adaptor protein Nck-1 couples the netrin-1 receptor DCC (deleted in colorectal cancer) to the activation of the small GTPase Rac1 through an atypical mechanism.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Meriane M, Triki I, Shekarabi M, Kennedy TE, Larose L, Lamarche-Vane N", "reference": { "type": "PubMed", "id": "12149262", "url": "https://pubmed.ncbi.nlm.nih.gov/12149262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12149262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Netrin requires focal adhesion kinase and Src family kinases for axon outgrowth and attraction.", "journal": "Nature neuroscience", "date": "2004", "authors": "Liu G, Beggs H, Jurgensen C, Park HT, Tang H, Gorski J, Jones KR, Reichardt LF, Wu J, Rao Y", "reference": { "type": "PubMed", "id": "15494732", "url": "https://pubmed.ncbi.nlm.nih.gov/15494732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00944-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15494732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of FAK and Src are receptor-proximal events required for netrin signaling.", "journal": "Nature neuroscience", "date": "2004", "authors": "Li W, Lee J, Vikis HG, Lee SH, Liu G, Aurandt J, Shen TL, Fearon ER, Guan JL, Han M, Rao Y, Hong K, Guan KL", "reference": { "type": "PubMed", "id": "15494734", "url": "https://pubmed.ncbi.nlm.nih.gov/15494734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34152-3", "protein_name": "Focal adhesion kinase 1", "gene_name": "Ptk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00944-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P70211-1", "protein_name": "Netrin receptor DCC", "gene_name": "Dcc", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15494734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of DCC by Fyn mediates Netrin-1 signaling in growth cone guidance.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Meriane M, Tcherkezian J, Webber CA, Danek EI, Triki I, McFarlane S, Bloch-Gallego E, Lamarche-Vane N", "reference": { "type": "PubMed", "id": "15557120", "url": "https://pubmed.ncbi.nlm.nih.gov/15557120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1420, "end_pos": 1420, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43146", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43146" }, { "database": "PubMed", "id": "15557120", "url": "https://pubmed.ncbi.nlm.nih.gov/15557120" } ], "site_lbl": "Tyr1420", "uniprot_canonical_ac": "P43146-1" } ], "record_id": "pubmed.15557120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deleted in colorectal cancer binding netrin-1 mediates cell substrate adhesion and recruits Cdc42, Rac1, Pak1, and N-WASP into an intracellular signaling complex that promotes growth cone expansion.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Shekarabi M, Moore SW, Tritsch NX, Morris SJ, Bouchard JF, Kennedy TE", "reference": { "type": "PubMed", "id": "15788770", "url": "https://pubmed.ncbi.nlm.nih.gov/15788770" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15788770", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Netrin family of guidance factors: emphasis on Netrin-1 signalling.", "journal": "Brain research. Brain research reviews", "date": "2005", "authors": "Barallobre MJ, Pascual M, Del Rio JA, Soriano E", "reference": { "type": "PubMed", "id": "15960985", "url": "https://pubmed.ncbi.nlm.nih.gov/15960985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15960985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Netrin signal transduction and the guanine nucleotide exchange factor DOCK180 in attractive signaling.", "journal": "Nature neuroscience", "date": "2008", "authors": "Li X, Gao X, Liu G, Xiong W, Wu J, Rao Y", "reference": { "type": "PubMed", "id": "18066058", "url": "https://pubmed.ncbi.nlm.nih.gov/18066058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18066058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Trio mediates netrin-1-induced Rac1 activation in axon outgrowth and guidance.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Briancon-Marjollet A, Ghogha A, Nawabi H, Triki I, Auziol C, Fromont S, Piche C, Enslen H, Chebli K, Cloutier JF, Castellani V, Debant A, Lamarche-Vane N", "reference": { "type": "PubMed", "id": "18212043", "url": "https://pubmed.ncbi.nlm.nih.gov/18212043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18212043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation of netrin receptors in netrin-1 signaling.", "journal": "Neuro-Signals", "date": "2008", "authors": "Ren XR, Hong Y, Feng Z, Yang HM, Mei L, Xiong WC", "reference": { "type": "PubMed", "id": "18253061", "url": "https://pubmed.ncbi.nlm.nih.gov/18253061" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18253061", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DOCK5 and DOCK1 regulate Caco-2 intestinal epithelial cell spreading and migration on collagen IV.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Sanders MA, Ampasala D, Basson MD", "reference": { "type": "PubMed", "id": "19004829", "url": "https://pubmed.ncbi.nlm.nih.gov/19004829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7D0-1", "protein_name": "Dedicator of cytokinesis protein 5", "gene_name": "DOCK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46109-1", "protein_name": "Crk-like protein", "gene_name": "CRKL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46108-1", "protein_name": "Adapter molecule crk", "gene_name": "CRK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 160, "end_pos": 160, "sequence_org": "W", "sequence_mut": "L", "comment": "Abolishes interaction with DOCK5.", "evidence": [ { "database": "UniProtKB", "id": "P46109", "url": "https://www.uniprot.org/uniprotkb/P46109" }, { "database": "PubMed", "id": "19004829", "url": "https://pubmed.ncbi.nlm.nih.gov/19004829" } ], "uniprot_canonical_ac": "P46109-1" }, { "start_pos": 169, "end_pos": 169, "sequence_org": "W", "sequence_mut": "L", "comment": "Abolishes interaction with DOCK5. Abolishes RAP1 activation.", "evidence": [ { "database": "UniProtKB", "id": "P46108", "url": "https://www.uniprot.org/uniprotkb/P46108" }, { "database": "PubMed", "id": "19004829", "url": "https://pubmed.ncbi.nlm.nih.gov/19004829" }, { "database": "PubMed", "id": "12432078", "url": "https://pubmed.ncbi.nlm.nih.gov/12432078" } ], "uniprot_canonical_ac": "P46108-1" } ], "record_id": "pubmed.19004829", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of Rac1 by Src-dependent phosphorylation of Dock180(Y1811) mediates PDGFRalpha-stimulated glioma tumorigenesis in mice and humans.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Feng H, Hu B, Liu KW, Li Y, Lu X, Cheng T, Yiin JJ, Lu S, Keezer S, Fenton T, Furnari FB, Hamilton RL, Vuori K, Sarkaria JN, Nagane M, Nishikawa R, Cavenee WK, Cheng SY", "reference": { "type": "PubMed", "id": "22080864", "url": "https://pubmed.ncbi.nlm.nih.gov/22080864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BUR4-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "Dock1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1811, "end_pos": 1811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14185", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14185" }, { "database": "PubMed", "id": "22080864", "url": "https://pubmed.ncbi.nlm.nih.gov/22080864" } ], "site_lbl": "Tyr1811", "uniprot_canonical_ac": "Q14185-1" }, { "start_pos": 1811, "end_pos": 1811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8BUR4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8BUR4" }, { "database": "PubMed", "id": "22080864", "url": "https://pubmed.ncbi.nlm.nih.gov/22080864" } ], "site_lbl": "Tyr1811", "uniprot_canonical_ac": "Q8BUR4-1" } ], "record_id": "pubmed.22080864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of dedicator of cytokinesis 1 (Dock180) at tyrosine residue Y722 by Src family kinases mediates EGFRvIII-driven glioblastoma tumorigenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Feng H, Hu B, Jarzynka MJ, Li Y, Keezer S, Johns TG, Tang CK, Hamilton RL, Vuori K, Nishikawa R, Sarkaria JN, Fenton T, Cheng T, Furnari FB, Cavenee WK, Cheng SY", "reference": { "type": "PubMed", "id": "22323579", "url": "https://pubmed.ncbi.nlm.nih.gov/22323579" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07858-1", "protein_name": "Cathepsin B", "gene_name": "CTSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR80-1", "protein_name": "Rho guanine nucleotide exchange factor 4", "gene_name": "ARHGEF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13009-1", "protein_name": "Rho guanine nucleotide exchange factor TIAM1", "gene_name": "TIAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92556-1", "protein_name": "Engulfment and cell motility protein 1", "gene_name": "ELMO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07711-1", "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25774-1", "protein_name": "Cathepsin S", "gene_name": "CTSS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14923-1", "protein_name": "Junction plakoglobin", "gene_name": "JUP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60716-1", "protein_name": "Catenin delta-1", "gene_name": "CTNND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94887-1", "protein_name": "FERM, ARHGEF and pleckstrin domain-containing protein 2", "gene_name": "FARP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55287-1", "protein_name": "Cadherin-11", "gene_name": "CDH11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75N03-1", "protein_name": "E3 ubiquitin-protein ligase Hakai", "gene_name": "CBLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 722, "end_pos": 722, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14185", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14185" }, { "database": "PubMed", "id": "22323579", "url": "https://pubmed.ncbi.nlm.nih.gov/22323579" } ], "site_lbl": "Tyr722", "uniprot_canonical_ac": "Q14185-1" } ], "record_id": "pubmed.22323579", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EGFRvIII stimulates glioma growth and invasion through PKA-dependent serine phosphorylation of Dock180.", "journal": "Oncogene", "date": "2014-05-08", "authors": "Feng H, Hu B, Vuori K, Sarkaria J N, Furnari F B, Cavenee W K, Cheng S-Y", "reference": { "type": "PubMed", "id": "23728337", "url": "https://pubmed.ncbi.nlm.nih.gov/23728337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1250, "end_pos": 1250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14185", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14185" }, { "database": "PubMed", "id": "23728337", "url": "https://pubmed.ncbi.nlm.nih.gov/23728337" } ], "site_lbl": "Ser1250", "uniprot_canonical_ac": "Q14185-1" } ], "record_id": "pubmed.23728337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of netrin-1 in complex with DCC reveals the bifunctionality of netrin-1 as a guidance cue.", "journal": "Neuron", "date": "2014-08-20", "authors": "Finci Lorenzo I, Kr\u00fcger Nina, Sun Xiaqin, Zhang Jie, Chegkazi Magda, Wu Yu, Schenk Gundolf, Mertens Haydyn D T, Svergun Dmitri I, Zhang Yan, Wang Jia-Huai, Meijers Rob", "reference": { "type": "PubMed", "id": "25123307", "url": "https://pubmed.ncbi.nlm.nih.gov/25123307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXZ4-1", "protein_name": "Netrin receptor UNC5D", "gene_name": "UNC5D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95185-1", "protein_name": "Netrin receptor UNC5C", "gene_name": "UNC5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZN44-1", "protein_name": "Netrin receptor UNC5A", "gene_name": "UNC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZJ1-1", "protein_name": "Netrin receptor UNC5B", "gene_name": "UNC5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25123307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autocrine VEGF and IL-8 Promote Migration via Src/Vav2/Rac1/PAK1 Signaling in Human Umbilical Vein Endothelial Cells.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2017", "authors": "Ju L, Zhou Z, Jiang B, Lou Y, Guo X", "reference": { "type": "PubMed", "id": "28278510", "url": "https://pubmed.ncbi.nlm.nih.gov/28278510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07858-1", "protein_name": "Cathepsin B", "gene_name": "CTSB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR80-1", "protein_name": "Rho guanine nucleotide exchange factor 4", "gene_name": "ARHGEF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13009-1", "protein_name": "Rho guanine nucleotide exchange factor TIAM1", "gene_name": "TIAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92556-1", "protein_name": "Engulfment and cell motility protein 1", "gene_name": "ELMO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07711-1", "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25774-1", "protein_name": "Cathepsin S", "gene_name": "CTSS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14923-1", "protein_name": "Junction plakoglobin", "gene_name": "JUP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60716-1", "protein_name": "Catenin delta-1", "gene_name": "CTNND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94887-1", "protein_name": "FERM, ARHGEF and pleckstrin domain-containing protein 2", "gene_name": "FARP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55287-1", "protein_name": "Cadherin-11", "gene_name": "CDH11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12830-1", "protein_name": "Cadherin-1", "gene_name": "CDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75N03-1", "protein_name": "E3 ubiquitin-protein ligase Hakai", "gene_name": "CBLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28278510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DOCK1 insufficiency disrupts trophoblast function and pregnancy outcomes via DUSP4-ERK pathway.", "journal": "Life science alliance", "date": "2024-02", "authors": "Xu Yichi, Liu Xiaorui, Zeng Weihong, Zhu Yueyue, Dong Junpeng, Wu Fan, Chen Cailian, Sharma Surendra, Lin Yi", "reference": { "type": "PubMed", "id": "37967942", "url": "https://pubmed.ncbi.nlm.nih.gov/37967942" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37967942", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ESRP1 controls biogenesis and function of a large abundant multiexon circRNA.", "journal": "Nucleic acids research", "date": "2024-02-09", "authors": "Liu Dawei, Dredge B Kate, Bert Andrew G, Pillman Katherine A, Toubia John, Guo Wenting, Dyakov Boris J A, Migault Melodie M, Conn Vanessa M, Conn Simon J, Gregory Philip A, Gingras Anne-Claude, Patel Dinshaw, Wu Baixing, Goodall Gregory J", "reference": { "type": "PubMed", "id": "38015468", "url": "https://pubmed.ncbi.nlm.nih.gov/38015468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXG1-1", "protein_name": "Epithelial splicing regulatory protein 1", "gene_name": "ESRP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38015468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic change investigation in DOCK1 gene in an Iranian family with sign and symptoms of temporomandibular joint disorder (TMD).", "journal": "Clinical oral investigations", "date": "2024-07-18", "authors": "Najafi Shamsoulmolouk, Hashemi-Gorji Farzad, Roudgari Hassan, Goudarzi Mina, Jafarzadegan Amir Mohammad, Sheykhbahaei Nafiseh", "reference": { "type": "PubMed", "id": "39020145", "url": "https://pubmed.ncbi.nlm.nih.gov/39020145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39020145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DOCK180, a major CRK-binding protein, alters cell morphology upon translocation to the cell membrane.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Hasegawa H, Kiyokawa E, Tanaka S, Nagashima K, Gotoh N, Shibuya M, Kurata T, Matsuda M", "reference": { "type": "PubMed", "id": "8657152", "url": "https://pubmed.ncbi.nlm.nih.gov/8657152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46108-1", "protein_name": "Adapter molecule crk", "gene_name": "CRK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8657152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between the amino-terminal SH3 domain of CRK and its natural target proteins.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Matsuda M, Ota S, Tanimura R, Nakamura H, Matuoka K, Takenawa T, Nagashima K, Kurata T", "reference": { "type": "PubMed", "id": "8662907", "url": "https://pubmed.ncbi.nlm.nih.gov/8662907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13905-1", "protein_name": "Rap guanine nucleotide exchange factor 1", "gene_name": "RAPGEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42566-1", "protein_name": "Epidermal growth factor receptor substrate 15", "gene_name": "EPS15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46108-1", "protein_name": "Adapter molecule crk", "gene_name": "CRK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "D", "sequence_mut": "K", "comment": "Abolishes interaction with DOCK1.", "evidence": [ { "database": "UniProtKB", "id": "P46108", "url": "https://www.uniprot.org/uniprotkb/P46108" }, { "database": "PubMed", "id": "8662907", "url": "https://pubmed.ncbi.nlm.nih.gov/8662907" } ], "uniprot_canonical_ac": "P46108-1" } ], "record_id": "pubmed.8662907", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deleted in Colorectal Cancer (DCC) encodes a netrin receptor.", "journal": "Cell", "date": "1996-10-18", "authors": "Keino-Masu K, Masu M, Hinck L, Leonardo E D, Chan S S, Culotti J G, Tessier-Lavigne M", "reference": { "type": "PubMed", "id": "8861902", "url": "https://pubmed.ncbi.nlm.nih.gov/8861902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63155-1", "protein_name": "Netrin receptor DCC", "gene_name": "Dcc", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q924Z9-1", "protein_name": "Netrin-1", "gene_name": "Ntn1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P97603-1", "protein_name": "Neogenin", "gene_name": "Neo1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8861902", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of Rac1 by a Crk SH3-binding protein, DOCK180.", "journal": "Genes Dev.", "date": "1998", "authors": "Kiyokawa E, Hashimoto Y, Kobayashi S, Sugimura H, Kurata T, Matsuda M", "reference": { "type": "PubMed", "id": "9808620", "url": "https://pubmed.ncbi.nlm.nih.gov/9808620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9808620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Netrin-1: interaction with deleted in colorectal cancer (DCC) and alterations in brain tumors and neuroblastomas.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "1999", "authors": "Meyerhardt JA, Caca K, Eckstrand BC, Hu G, Lengauer C, Banavali S, Look AT, Fearon ER", "reference": { "type": "PubMed", "id": "9950216", "url": "https://pubmed.ncbi.nlm.nih.gov/9950216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14185-1", "protein_name": "Dedicator of cytokinesis protein 1", "gene_name": "DOCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05397-1", "protein_name": "Focal adhesion kinase 1", "gene_name": "PTK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75962-1", "protein_name": "Triple functional domain protein", "gene_name": "TRIO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43146-1", "protein_name": "Netrin receptor DCC", "gene_name": "DCC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14639-1", "protein_name": "Actin-binding LIM protein 1", "gene_name": "ABLIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94929-1", "protein_name": "Actin-binding LIM protein 3", "gene_name": "ABLIM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6H8Q1-1", "protein_name": "Actin-binding LIM protein 2", "gene_name": "ABLIM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95631-1", "protein_name": "Netrin-1", "gene_name": "NTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14185", "url": "https://www.uniprot.org/uniprotkb/Q14185" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9950216", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myeloid zinc finger 1 protein is a key transcription stimulating factor of PYROXD2 promoter.", "journal": "Oncology reports", "date": "2017", "authors": "Liu H, Jiang X, Wang T, Yu F, Wang X, Chen J, Xie X, Fan H", "reference": { "type": "PubMed", "id": "29048625", "url": "https://pubmed.ncbi.nlm.nih.gov/29048625" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N2H3-1", "protein_name": "Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2", "gene_name": "PYROXD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N2H3", "url": "https://www.uniprot.org/uniprotkb/Q8N2H3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29048625", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pyridine nucleotide-disulphide oxidoreductase domain 2 (PYROXD2): Role in mitochondrial function.", "journal": "Mitochondrion", "date": "2019", "authors": "Wang T, Xie X, Liu H, Chen F, Du J, Wang X, Jiang X, Yu F, Fan H", "reference": { "type": "PubMed", "id": "31170524", "url": "https://pubmed.ncbi.nlm.nih.gov/31170524" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N2H3-1", "protein_name": "Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2", "gene_name": "PYROXD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N2H3", "url": "https://www.uniprot.org/uniprotkb/Q8N2H3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31170524", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The autosomal recessive juvenile Parkinson disease gene product, parkin, interacts with and ubiquitinates synaptotagmin XI.", "journal": "Human molecular genetics", "date": "2003", "authors": "Huynh DP, Scoles DR, Nguyen D, Pulst SM", "reference": { "type": "PubMed", "id": "12925569", "url": "https://pubmed.ncbi.nlm.nih.gov/12925569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JK66-1", "protein_name": "E3 ubiquitin-protein ligase parkin", "gene_name": "Prkn", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O60260-1", "protein_name": "E3 ubiquitin-protein ligase parkin", "gene_name": "PRKN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12925569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Screening for mutations in synaptotagmin XI in Parkinson's disease.", "journal": "Journal of neural transmission. Supplementum", "date": "2004", "authors": "Glass AS, Huynh DP, Franck T, Woitalla D, Muller T, Pulst SM, Berg D, Kruger R, Riess O", "reference": { "type": "PubMed", "id": "15354386", "url": "https://pubmed.ncbi.nlm.nih.gov/15354386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15354386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synaptotagmin XI as a candidate gene for susceptibility to schizophrenia.", "journal": "American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics", "date": "2007", "authors": "Inoue S, Imamura A, Okazaki Y, Yokota H, Arai M, Hayashi N, Furukawa A, Itokawa M, Oishi M", "reference": { "type": "PubMed", "id": "17192956", "url": "https://pubmed.ncbi.nlm.nih.gov/17192956" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17192956", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Parkinson's disease-associated genes ATP13A2 and SYT11 regulate autophagy via a common pathway.", "journal": "Nature communications", "date": "2016", "authors": "Bento CF, Ashkenazi A, Jimenez-Sanchez M, Rubinsztein DC", "reference": { "type": "PubMed", "id": "27278822", "url": "https://pubmed.ncbi.nlm.nih.gov/27278822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19484-1", "protein_name": "Transcription factor EB", "gene_name": "TFEB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CTG6-1", "protein_name": "Polyamine-transporting ATPase 13A2", "gene_name": "Atp13a2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9R210-1", "protein_name": "Transcription factor EB", "gene_name": "Tfeb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75592-1", "protein_name": "E3 ubiquitin-protein ligase MYCBP2", "gene_name": "MYCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49815-1", "protein_name": "Tuberin", "gene_name": "TSC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ11-1", "protein_name": "Polyamine-transporting ATPase 13A2", "gene_name": "ATP13A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R0N3-1", "protein_name": "Synaptotagmin-11", "gene_name": "Syt11", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 142, "end_pos": 142, "sequence_org": "S", "sequence_mut": "A", "comment": "Impaired phosphorylation by MTOR, leading to constitutive nuclear localization and transcription factor activity. Impaired nuclear export in response to nutrient availability.", "evidence": [ { "database": "UniProtKB", "id": "P19484", "url": "https://www.uniprot.org/uniprotkb/P19484" }, { "database": "PubMed", "id": "21617040", "url": "https://pubmed.ncbi.nlm.nih.gov/21617040" }, { "database": "PubMed", "id": "30120233", "url": "https://pubmed.ncbi.nlm.nih.gov/30120233" }, { "database": "PubMed", "id": "22343943", "url": "https://pubmed.ncbi.nlm.nih.gov/22343943" }, { "database": "PubMed", "id": "27278822", "url": "https://pubmed.ncbi.nlm.nih.gov/27278822" } ], "uniprot_canonical_ac": "P19484-1" } ], "phosphorylation": [ { "start_pos": 142, "end_pos": 142, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MTOR", "evidence": [ { "database": "UniProtKB", "id": "P19484", "url": "https://www.uniprot.org/uniprotkb/P19484" }, { "database": "iPTMnet", "id": "P19484", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19484" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "22343943", "url": "https://pubmed.ncbi.nlm.nih.gov/22343943" }, { "database": "PubMed", "id": "21804531", "url": "https://pubmed.ncbi.nlm.nih.gov/21804531" }, { "database": "PubMed", "id": "26240184", "url": "https://pubmed.ncbi.nlm.nih.gov/26240184" }, { "database": "PubMed", "id": "27278822", "url": "https://pubmed.ncbi.nlm.nih.gov/27278822" }, { "database": "PubMed", "id": "29992949", "url": "https://pubmed.ncbi.nlm.nih.gov/29992949" }, { "database": "PubMed", "id": "30120233", "url": "https://pubmed.ncbi.nlm.nih.gov/30120233" }, { "database": "PubMed", "id": "30979895", "url": "https://pubmed.ncbi.nlm.nih.gov/30979895" }, { "database": "PubMed", "id": "31112550", "url": "https://pubmed.ncbi.nlm.nih.gov/31112550" }, { "database": "PubMed", "id": "31404503", "url": "https://pubmed.ncbi.nlm.nih.gov/31404503" }, { "database": "PubMed", "id": "31413743", "url": "https://pubmed.ncbi.nlm.nih.gov/31413743" }, { "database": "PubMed", "id": "31519738", "url": "https://pubmed.ncbi.nlm.nih.gov/31519738" }, { "database": "PubMed", "id": "31717697", "url": "https://pubmed.ncbi.nlm.nih.gov/31717697" }, { "database": "PubMed", "id": "31750630", "url": "https://pubmed.ncbi.nlm.nih.gov/31750630" }, { "database": "PubMed", "id": "32622269", "url": "https://pubmed.ncbi.nlm.nih.gov/32622269" }, { "database": "PubMed", "id": "32662822", "url": "https://pubmed.ncbi.nlm.nih.gov/32662822" }, { "database": "PubMed", "id": "33163944", "url": "https://pubmed.ncbi.nlm.nih.gov/33163944" }, { "database": "PubMed", "id": "21617040", "url": "https://pubmed.ncbi.nlm.nih.gov/21617040" } ], "site_lbl": "Ser142", "uniprot_canonical_ac": "P19484-1" } ], "record_id": "pubmed.27278822", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The highly expressed calcium-insensitive synaptotagmin-11 and synaptotagmin-13 modulate insulin secretion.", "journal": "Acta physiologica (Oxford, England)", "date": "2022", "authors": "Ofori JK, Karagiannopoulos A, Barghouth M, Nagao M, Andersson ME, Salunkhe VA, Zhang E, Wendt A, Eliasson L", "reference": { "type": "PubMed", "id": "35753051", "url": "https://pubmed.ncbi.nlm.nih.gov/35753051" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L8C5-1", "protein_name": "Synaptotagmin-13", "gene_name": "SYT13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35753051", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synaptotagmin 11 scaffolds MKK7-JNK signaling process to promote stem-like molecular subtype gastric cancer oncogenesis.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2022", "authors": "Kim BK, Kim DM, Park H, Kim SK, Hwang MA, Lee J, Kang MJ, Byun JE, Im JY, Kang M, Park KC, Yeom YI, Kim SY, Jung H, Kweon DH, Cheong JH, Won M", "reference": { "type": "PubMed", "id": "35768842", "url": "https://pubmed.ncbi.nlm.nih.gov/35768842" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35768842", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impad1 and Syt11 work in an epistatic pathway that regulates EMT-mediated vesicular trafficking to drive lung cancer invasion and metastasis.", "journal": "Cell reports", "date": "2022", "authors": "Bajaj R, Rodriguez BL, Russell WK, Warner AN, Diao L, Wang J, Raso MG, Lu W, Khan K, Solis LS, Batra H, Tang X, Fradette JF, Kundu ST, Gibbons DL", "reference": { "type": "PubMed", "id": "36170810", "url": "https://pubmed.ncbi.nlm.nih.gov/36170810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36170810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Palmitoylation of the Parkinson's disease-associated protein synaptotagmin-11 links its turnover to \u03b1-synuclein homeostasis.", "journal": "Science signaling", "date": "2023-02-14", "authors": "Ho Gary P H, Wilkie Erin C, White Andrew J, Selkoe Dennis J", "reference": { "type": "PubMed", "id": "36787382", "url": "https://pubmed.ncbi.nlm.nih.gov/36787382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT88-1", "protein_name": "Synaptotagmin-11", "gene_name": "SYT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R0N3-1", "protein_name": "Synaptotagmin-11", "gene_name": "Syt11", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT88", "url": "https://www.uniprot.org/uniprotkb/Q9BT88" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36787382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]