[ { "title": "SWI/SNF nucleosome remodellers and cancer.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Wilson BG, Roberts CW", "reference": { "type": "PubMed", "id": "21654818", "url": "https://pubmed.ncbi.nlm.nih.gov/21654818" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92993-1", "protein_name": "Histone acetyltransferase KAT5", "gene_name": "KAT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMN6-1", "protein_name": "Histone-lysine N-methyltransferase 2B", "gene_name": "KMT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04726-1", "protein_name": "Transducin-like enhancer protein 3", "gene_name": "TLE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36402-5", "protein_name": "Transcription factor 7", "gene_name": "TCF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQB0-1", "protein_name": "Transcription factor 7-like 2", "gene_name": "TCF7L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ0-1", "protein_name": "Pygopus homolog 2", "gene_name": "PYGO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00512-1", "protein_name": "B-cell CLL/lymphoma 9 protein", "gene_name": "BCL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UU0-1", "protein_name": "B-cell CLL/lymphoma 9-like protein", "gene_name": "BCL9L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Y4-1", "protein_name": "Pygopus homolog 1", "gene_name": "PYGO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4A5-1", "protein_name": "Transformation/transcription domain-associated protein", "gene_name": "TRRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04724-1", "protein_name": "Transducin-like enhancer protein 1", "gene_name": "TLE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS4-1", "protein_name": "Transcription factor 7-like 1", "gene_name": "TCF7L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04725-1", "protein_name": "Transducin-like enhancer protein 2", "gene_name": "TLE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04727-1", "protein_name": "Transducin-like enhancer protein 4", "gene_name": "TLE4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21654818", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SHP2 tyrosine phosphatase converts parafibromin/Cdc73 from a tumor suppressor to an oncogenic driver.", "journal": "Molecular cell", "date": "2011", "authors": "Takahashi A, Tsutsumi R, Kikuchi I, Obuse C, Saito Y, Seidi A, Karisch R, Fernandez M, Cho T, Ohnishi N, Rozenblatt-Rosen O, Meyerson M, Neel BG, Hatakeyama M", "reference": { "type": "PubMed", "id": "21726809", "url": "https://pubmed.ncbi.nlm.nih.gov/21726809" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92993-1", "protein_name": "Histone acetyltransferase KAT5", "gene_name": "KAT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMN6-1", "protein_name": "Histone-lysine N-methyltransferase 2B", "gene_name": "KMT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04726-1", "protein_name": "Transducin-like enhancer protein 3", "gene_name": "TLE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36402-5", "protein_name": "Transcription factor 7", "gene_name": "TCF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQB0-1", "protein_name": "Transcription factor 7-like 2", "gene_name": "TCF7L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ0-1", "protein_name": "Pygopus homolog 2", "gene_name": "PYGO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00512-1", "protein_name": "B-cell CLL/lymphoma 9 protein", "gene_name": "BCL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UU0-1", "protein_name": "B-cell CLL/lymphoma 9-like protein", "gene_name": "BCL9L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Y4-1", "protein_name": "Pygopus homolog 1", "gene_name": "PYGO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4A5-1", "protein_name": "Transformation/transcription domain-associated protein", "gene_name": "TRRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04724-1", "protein_name": "Transducin-like enhancer protein 1", "gene_name": "TLE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS4-1", "protein_name": "Transcription factor 7-like 1", "gene_name": "TCF7L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04725-1", "protein_name": "Transducin-like enhancer protein 2", "gene_name": "TLE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04727-1", "protein_name": "Transducin-like enhancer protein 4", "gene_name": "TLE4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21726809", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of novel phosphorylation sites of CREB-binding protein using mass spectrometry and mammalian two-hybrid assays.", "journal": "Proteomics", "date": "2011", "authors": "Xia Z, Guo M, Ma H", "reference": { "type": "PubMed", "id": "21751375", "url": "https://pubmed.ncbi.nlm.nih.gov/21751375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92793", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92793" }, { "database": "PubMed", "id": "21751375", "url": "https://pubmed.ncbi.nlm.nih.gov/21751375" } ], "site_lbl": "Ser92", "uniprot_canonical_ac": "Q92793-1" } ], "record_id": "pubmed.21751375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of gemfibrozil analogues that activate PPARalpha and enhance the expression of gene CPT1A involved in fatty acids catabolism.", "journal": "European journal of medicinal chemistry", "date": "2011", "authors": "De Filippis B, Giancristofaro A, Ammazzalorso A, D'Angelo A, Fantacuzzi M, Giampietro L, Maccallini C, Petruzzelli M, Amoroso R", "reference": { "type": "PubMed", "id": "21889235", "url": "https://pubmed.ncbi.nlm.nih.gov/21889235" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21889235", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHD6 chromatin remodeler is a negative modulator of influenza virus replication that relocates to inactive chromatin upon infection.", "journal": "Cellular microbiology", "date": "2011", "authors": "Alfonso R, Lutz T, Rodriguez A, Chavez JP, Rodriguez P, Gutierrez S, Nieto A", "reference": { "type": "PubMed", "id": "21899694", "url": "https://pubmed.ncbi.nlm.nih.gov/21899694" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Z6-1", "protein_name": "Protein FAM124B", "gene_name": "FAM124B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCK8-1", "protein_name": "ATP-dependent chromatin remodeler CHD8", "gene_name": "CHD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU2-1", "protein_name": "Dickkopf-related protein 2", "gene_name": "DKK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F2-1", "protein_name": "Protein naked cuticle homolog 2", "gene_name": "NKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49711-1", "protein_name": "Transcriptional repressor CTCF", "gene_name": "CTCF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T1-1", "protein_name": "Axin-2", "gene_name": "AXIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D1-1", "protein_name": "ATP-dependent chromatin remodeler CHD7", "gene_name": "CHD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01344-1", "protein_name": "Insulin-like growth factor 2", "gene_name": "IGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21899694", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 45 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pygo2 regulates histone gene expression and H3 K56 acetylation in human mammary epithelial cells.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Gu B, Watanabe K, Dai X", "reference": { "type": "PubMed", "id": "22186018", "url": "https://pubmed.ncbi.nlm.nih.gov/22186018" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92993-1", "protein_name": "Histone acetyltransferase KAT5", "gene_name": "KAT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMN6-1", "protein_name": "Histone-lysine N-methyltransferase 2B", "gene_name": "KMT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04726-1", "protein_name": "Transducin-like enhancer protein 3", "gene_name": "TLE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36402-5", "protein_name": "Transcription factor 7", "gene_name": "TCF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQB0-1", "protein_name": "Transcription factor 7-like 2", "gene_name": "TCF7L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ0-1", "protein_name": "Pygopus homolog 2", "gene_name": "PYGO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00512-1", "protein_name": "B-cell CLL/lymphoma 9 protein", "gene_name": "BCL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UU0-1", "protein_name": "B-cell CLL/lymphoma 9-like protein", "gene_name": "BCL9L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Y4-1", "protein_name": "Pygopus homolog 1", "gene_name": "PYGO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4A5-1", "protein_name": "Transformation/transcription domain-associated protein", "gene_name": "TRRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04724-1", "protein_name": "Transducin-like enhancer protein 1", "gene_name": "TLE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS4-1", "protein_name": "Transcription factor 7-like 1", "gene_name": "TCF7L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04725-1", "protein_name": "Transducin-like enhancer protein 2", "gene_name": "TLE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04727-1", "protein_name": "Transducin-like enhancer protein 4", "gene_name": "TLE4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22186018", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Probing transcription-specific outputs of beta-catenin in vivo.", "journal": "Genes & development", "date": "2011", "authors": "Valenta T, Gay M, Steiner S, Draganova K, Zemke M, Hoffmans R, Cinelli P, Aguet M, Sommer L, Basler K", "reference": { "type": "PubMed", "id": "22190459", "url": "https://pubmed.ncbi.nlm.nih.gov/22190459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92993-1", "protein_name": "Histone acetyltransferase KAT5", "gene_name": "KAT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMN6-1", "protein_name": "Histone-lysine N-methyltransferase 2B", "gene_name": "KMT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04726-1", "protein_name": "Transducin-like enhancer protein 3", "gene_name": "TLE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36402-5", "protein_name": "Transcription factor 7", "gene_name": "TCF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQB0-1", "protein_name": "Transcription factor 7-like 2", "gene_name": "TCF7L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ0-1", "protein_name": "Pygopus homolog 2", "gene_name": "PYGO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00512-1", "protein_name": "B-cell CLL/lymphoma 9 protein", "gene_name": "BCL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UU0-1", "protein_name": "B-cell CLL/lymphoma 9-like protein", "gene_name": "BCL9L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Y4-1", "protein_name": "Pygopus homolog 1", "gene_name": "PYGO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4A5-1", "protein_name": "Transformation/transcription domain-associated protein", "gene_name": "TRRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04724-1", "protein_name": "Transducin-like enhancer protein 1", "gene_name": "TLE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS4-1", "protein_name": "Transcription factor 7-like 1", "gene_name": "TCF7L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04725-1", "protein_name": "Transducin-like enhancer protein 2", "gene_name": "TLE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04727-1", "protein_name": "Transducin-like enhancer protein 4", "gene_name": "TLE4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22190459", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DUX4 activates germline genes, retroelements, and immune mediators: implications for facioscapulohumeral dystrophy.", "journal": "Developmental cell", "date": "2012-01-17", "authors": "Geng Linda N, Yao Zizhen, Snider Lauren, Fong Abraham P, Cech Jennifer N, Young Janet M, van der Maarel Silvere M, Ruzzo Walter L, Gentleman Robert C, Tawil Rabi, Tapscott Stephen J", "reference": { "type": "PubMed", "id": "22209328", "url": "https://pubmed.ncbi.nlm.nih.gov/22209328" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22209328", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Apak competes with p53 for direct binding to intron 1 of p53AIP1 to regulate apoptosis.", "journal": "EMBO reports", "date": "2012", "authors": "Yuan L, Tian C, Wang H, Song S, Li D, Xing G, Yin Y, He F, Zhang L", "reference": { "type": "PubMed", "id": "22334068", "url": "https://pubmed.ncbi.nlm.nih.gov/22334068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ8-1", "protein_name": "Ferroptosis suppressor protein 1", "gene_name": "AIFM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ4-1", "protein_name": "Apoptosis-stimulating of p53 protein 1", "gene_name": "PPP1R13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAQ5-1", "protein_name": "Zinc finger protein 420", "gene_name": "ZNF420", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N28-1", "protein_name": "PRELI domain containing protein 3A", "gene_name": "PRELID3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15350-1", "protein_name": "Tumor protein p73", "gene_name": "TP73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55957-1", "protein_name": "BH3-interacting domain death agonist", "gene_name": "BID", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3D4-1", "protein_name": "Tumor protein 63", "gene_name": "TP63", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43715-1", "protein_name": "TP53-regulated inhibitor of apoptosis 1", "gene_name": "TRIAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13794-1", "protein_name": "Phorbol-12-myristate-13-acetate-induced protein 1", "gene_name": "PMAIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60238-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like", "gene_name": "BNIP3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y255-1", "protein_name": "PRELI domain-containing protein 1, mitochondrial", "gene_name": "PRELID1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q658P3-1", "protein_name": "Metalloreductase STEAP3", "gene_name": "STEAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A56-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "TP53INP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN2-1", "protein_name": "p53-regulated apoptosis-inducing protein 1", "gene_name": "TP53AIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13625-1", "protein_name": "Apoptosis-stimulating of p53 protein 2", "gene_name": "TP53BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22334068", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anti-inflammatory and PPAR transactivational effects of secondary metabolites from the roots of Asarum sieboldii.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2012", "authors": "Quang TH, Ngan NT, Minh CV, Kiem PV, Tai BH, Thao NP, Song SB, Kim YH", "reference": { "type": "PubMed", "id": "22381047", "url": "https://pubmed.ncbi.nlm.nih.gov/22381047" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22381047", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Respiratory syncytial virus NS1 protein colocalizes with mitochondrial antiviral signaling protein MAVS following infection.", "journal": "PloS one", "date": "2012", "authors": "Boyapalle Sandhya, Wong Terianne, Garay Julio, Teng Michael, San Juan-Vergara Homero, Mohapatra Subhra, Mohapatra Shyam", "reference": { "type": "PubMed", "id": "22383950", "url": "https://pubmed.ncbi.nlm.nih.gov/22383950" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93034-1", "protein_name": "Cullin-5", "gene_name": "CUL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62877-1", "protein_name": "E3 ubiquitin-protein ligase RBX1", "gene_name": "RBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22383950", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Defining NOTCH3 target genes in ovarian cancer.", "journal": "Cancer research", "date": "2012", "authors": "Chen X, Thiaville MM, Chen L, Stoeck A, Xuan J, Gao M, Shih IeM, Wang TL", "reference": { "type": "PubMed", "id": "22396495", "url": "https://pubmed.ncbi.nlm.nih.gov/22396495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM47-1", "protein_name": "Neurogenic locus notch homolog protein 3", "gene_name": "NOTCH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4D7-1", "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IX03-1", "protein_name": "Protein KIBRA", "gene_name": "WWC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15398-2", "protein_name": "Disks large-associated protein 5", "gene_name": "DLGAP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15540-1", "protein_name": "Fatty acid-binding protein, brain", "gene_name": "FABP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40424-1", "protein_name": "Pre-B-cell leukemia transcription factor 1", "gene_name": "PBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ87-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif-like protein", "gene_name": "HEYL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ISU1-1", "protein_name": "Pre T-cell antigen receptor alpha", "gene_name": "PTCRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22396495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene expression of the tumour suppressor LKB1 is mediated by Sp1, NF-Y and FOXO transcription factors.", "journal": "PloS one", "date": "2012", "authors": "Lutzner N, De-Castro Arce J, Rosl F", "reference": { "type": "PubMed", "id": "22412893", "url": "https://pubmed.ncbi.nlm.nih.gov/22412893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23511-1", "protein_name": "Nuclear transcription factor Y subunit alpha", "gene_name": "NFYA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35638-1", "protein_name": "DNA damage-inducible transcript 3 protein", "gene_name": "DDIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99967-1", "protein_name": "Cbp/p300-interacting transactivator 2", "gene_name": "CITED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43521-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "BCL2L11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25208-1", "protein_name": "Nuclear transcription factor Y subunit beta", "gene_name": "NFYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41182-1", "protein_name": "B-cell lymphoma 6 protein", "gene_name": "BCL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13952-1", "protein_name": "Nuclear transcription factor Y subunit gamma", "gene_name": "NFYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM7-1", "protein_name": "Serine/threonine-protein kinase PINK1, mitochondrial", "gene_name": "PINK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22412893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Carbon monoxide promotes respiratory hemoproteins iron reduction using peroxides as electron donors.", "journal": "PloS one", "date": "2012", "authors": "Sher EA, Shaklai M, Shaklai N", "reference": { "type": "PubMed", "id": "22427940", "url": "https://pubmed.ncbi.nlm.nih.gov/22427940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P99999-1", "protein_name": "Cytochrome c", "gene_name": "CYCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13073-1", "protein_name": "Cytochrome c oxidase subunit 4 isoform 1, mitochondrial", "gene_name": "COX4I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15954-1", "protein_name": "Cytochrome c oxidase subunit 7C, mitochondrial", "gene_name": "COX7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4L0-1", "protein_name": "Cytochrome c oxidase subunit 8C, mitochondrial", "gene_name": "COX8C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09669-1", "protein_name": "Cytochrome c oxidase subunit 6C", "gene_name": "COX6C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGK3-1", "protein_name": "Signal-transducing adaptor protein 2", "gene_name": "STAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MV81-1", "protein_name": "HIG1 domain family member 1C", "gene_name": "HIGD1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00483-1", "protein_name": "Cytochrome c oxidase subunit FA4", "gene_name": "COXFA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53004-1", "protein_name": "Biliverdin reductase A", "gene_name": "BLVRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14406-1", "protein_name": "Cytochrome c oxidase subunit 7A2, mitochondrial", "gene_name": "COX7A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24310-1", "protein_name": "Cytochrome c oxidase subunit 7A1, mitochondrial", "gene_name": "COX7A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24311-1", "protein_name": "Cytochrome c oxidase subunit 7B, mitochondrial", "gene_name": "COX7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6YFQ2-1", "protein_name": "Cytochrome c oxidase subunit 6B2", "gene_name": "COX6B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3M7-1", "protein_name": "Thioredoxin-interacting protein", "gene_name": "TXNIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00395-1", "protein_name": "Cytochrome c oxidase subunit 1", "gene_name": "MT-CO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00414-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "MT-CO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KJ9-1", "protein_name": "Cytochrome c oxidase subunit 4 isoform 2, mitochondrial", "gene_name": "COX4I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14548-1", "protein_name": "Cytochrome c oxidase subunit 7A2-like, mitochondrial", "gene_name": "COX7A2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02221-1", "protein_name": "Cytochrome c oxidase subunit 6A2, mitochondrial", "gene_name": "COX6A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00403-1", "protein_name": "Cytochrome c oxidase subunit 2", "gene_name": "MT-CO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10176-1", "protein_name": "Cytochrome c oxidase subunit 8A, mitochondrial", "gene_name": "COX8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12074-1", "protein_name": "Cytochrome c oxidase subunit 6A1, mitochondrial", "gene_name": "COX6A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14854-1", "protein_name": "Cytochrome c oxidase subunit 6B1", "gene_name": "COX6B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10606-1", "protein_name": "Cytochrome c oxidase subunit 5B, mitochondrial", "gene_name": "COX5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30043-1", "protein_name": "Flavin reductase (NADPH)", "gene_name": "BLVRB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30519-1", "protein_name": "Heme oxygenase 2", "gene_name": "HMOX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22427940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Histone recognition and large-scale structural analysis of the human bromodomain family.", "journal": "Cell", "date": "2012", "authors": "Filippakopoulos P, Picaud S, Mangos M, Keates T, Lambert JP, Barsyte-Lovejoy D, Felletar I, Volkmer R, Muller S, Pawson T, Gingras AC, Arrowsmith CH, Knapp S", "reference": { "type": "PubMed", "id": "22464331", "url": "https://pubmed.ncbi.nlm.nih.gov/22464331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42229-1", "protein_name": "Signal transducer and activator of transcription 5A", "gene_name": "STAT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51531-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2", "gene_name": "SMARCA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12824-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1", "gene_name": "SMARCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86U86-1", "protein_name": "Protein polybromo-1", "gene_name": "PBRM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWQ0-1", "protein_name": "PH-interacting protein", "gene_name": "PHIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51692-1", "protein_name": "Signal transducer and activator of transcription 5B", "gene_name": "STAT5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13232-1", "protein_name": "Interleukin-7", "gene_name": "IL7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16871-1", "protein_name": "Interleukin-7 receptor subunit alpha", "gene_name": "IL7R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31785-1", "protein_name": "Cytokine receptor common subunit gamma", "gene_name": "IL2RG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSE2-1", "protein_name": "Cytokine-inducible SH2-containing protein", "gene_name": "CISH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92925-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2", "gene_name": "SMARCD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZM4-1", "protein_name": "BRD4-interacting chromatin-remodeling complex-associated protein", "gene_name": "BICRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6AI39-1", "protein_name": "BRD4-interacting chromatin-remodeling complex-associated protein-like", "gene_name": "BICRAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14508-1", "protein_name": "Suppressor of cytokine signaling 2", "gene_name": "SOCS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68CP9-1", "protein_name": "AT-rich interactive domain-containing protein 2", "gene_name": "ARID2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR48-1", "protein_name": "Histone-lysine N-methyltransferase ASH1L", "gene_name": "ASH1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15532-1", "protein_name": "Protein SSXT", "gene_name": "SS18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PL18-1", "protein_name": "ATPase family AAA domain-containing protein 2", "gene_name": "ATAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUZ0-1", "protein_name": "B-cell CLL/lymphoma 7 protein family member C", "gene_name": "BCL7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15059-1", "protein_name": "Bromodomain-containing protein 3", "gene_name": "BRD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75177-1", "protein_name": "Calcium-responsive transactivator", "gene_name": "SS18L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52333-1", "protein_name": "Tyrosine-protein kinase JAK3", "gene_name": "JAK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GM5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1", "gene_name": "SMARCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC73-1", "protein_name": "Cytokine receptor-like factor 2", "gene_name": "CRLF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4H2-1", "protein_name": "Insulin receptor substrate 2", "gene_name": "IRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969G3-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1", "gene_name": "SMARCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969D9-1", "protein_name": "Thymic stromal lymphopoietin", "gene_name": "TSLP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14210-1", "protein_name": "Hepatocyte growth factor", "gene_name": "HGF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE9-1", "protein_name": "B-cell CLL/lymphoma 7 protein family member B", "gene_name": "BCL7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92922-1", "protein_name": "SWI/SNF complex subunit SMARCC1", "gene_name": "SMARCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI0-1", "protein_name": "ATPase family AAA domain-containing protein 2B", "gene_name": "ATAD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSI6-1", "protein_name": "Bromodomain and WD repeat-containing protein 1", "gene_name": "BRWD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12830-1", "protein_name": "Nucleosome-remodeling factor subunit BPTF", "gene_name": "BPTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60885-1", "protein_name": "Bromodomain-containing protein 4", "gene_name": "BRD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95696-1", "protein_name": "Bromodomain-containing protein 1", "gene_name": "BRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4VC05-1", "protein_name": "B-cell CLL/lymphoma 7 protein family member A", "gene_name": "BCL7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPI1-1", "protein_name": "Bromodomain-containing protein 7", "gene_name": "BRD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35568-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "IRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H8M2-5", "protein_name": "Bromodomain-containing protein 9", "gene_name": "BRD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15918-1", "protein_name": "V(D)J recombination-activating protein 1", "gene_name": "RAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUB8-1", "protein_name": "PHD finger protein 10", "gene_name": "PHF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55895-1", "protein_name": "V(D)J recombination-activating protein 2", "gene_name": "RAG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21675-2", "protein_name": "Transcription initiation factor TFIID subunit 1", "gene_name": "TAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZX4-1", "protein_name": "Transcription initiation factor TFIID subunit 1-like", "gene_name": "TAF1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q58F21-1", "protein_name": "Bromodomain testis-specific protein", "gene_name": "BRDT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIF8-1", "protein_name": "Bromodomain adjacent to zinc finger domain protein 2B", "gene_name": "BAZ2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXF3-1", "protein_name": "Chromatin remodeling regulator CECR2", "gene_name": "CECR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAQ2-1", "protein_name": "SWI/SNF complex subunit SMARCC2", "gene_name": "SMARCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96019-1", "protein_name": "Actin-like protein 6A", "gene_name": "ACTL6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60709-1", "protein_name": "Actin, cytoplasmic 1", "gene_name": "ACTB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 140, "end_pos": 140, "sequence_org": "N", "sequence_mut": "A", "comment": "Abolishes binding to acetylated histones.", "evidence": [ { "database": "UniProtKB", "id": "O60885", "url": "https://www.uniprot.org/uniprotkb/O60885" }, { "database": "PubMed", "id": "22464331", "url": "https://pubmed.ncbi.nlm.nih.gov/22464331" }, { "database": "PubMed", "id": "23728299", "url": "https://pubmed.ncbi.nlm.nih.gov/23728299" } ], "uniprot_canonical_ac": "O60885-1" }, { "start_pos": 433, "end_pos": 433, "sequence_org": "N", "sequence_mut": "A", "comment": "Abolishes binding to acetylated histones.", "evidence": [ { "database": "UniProtKB", "id": "O60885", "url": "https://www.uniprot.org/uniprotkb/O60885" }, { "database": "PubMed", "id": "22464331", "url": "https://pubmed.ncbi.nlm.nih.gov/22464331" } ], "uniprot_canonical_ac": "O60885-1" } ], "record_id": "pubmed.22464331", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 64 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel NRF2-regulated genes by ChIP-Seq: influence on retinoid X receptor alpha.", "journal": "Nucleic acids research", "date": "2012-08", "authors": "Chorley Brian N, Campbell Michelle R, Wang Xuting, Karaca Mehmet, Sambandan Deepa, Bangura Fatu, Xue Peng, Pi Jingbo, Kleeberger Steven R, Bell Douglas A", "reference": { "type": "PubMed", "id": "22581777", "url": "https://pubmed.ncbi.nlm.nih.gov/22581777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22581777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The many faces and functions of beta-catenin.", "journal": "The EMBO journal", "date": "2012", "authors": "Valenta T, Hausmann G, Basler K", "reference": { "type": "PubMed", "id": "22617422", "url": "https://pubmed.ncbi.nlm.nih.gov/22617422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92993-1", "protein_name": "Histone acetyltransferase KAT5", "gene_name": "KAT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51532-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4", "gene_name": "SMARCA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMN6-1", "protein_name": "Histone-lysine N-methyltransferase 2B", "gene_name": "KMT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04726-1", "protein_name": "Transducin-like enhancer protein 3", "gene_name": "TLE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36402-5", "protein_name": "Transcription factor 7", "gene_name": "TCF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14746-1", "protein_name": "Telomerase reverse transcriptase", "gene_name": "TERT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJU2-1", "protein_name": "Lymphoid enhancer-binding factor 1", "gene_name": "LEF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQB0-1", "protein_name": "Transcription factor 7-like 2", "gene_name": "TCF7L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16695-1", "protein_name": "Histone H3.1t", "gene_name": "H3-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ0-1", "protein_name": "Pygopus homolog 2", "gene_name": "PYGO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00512-1", "protein_name": "B-cell CLL/lymphoma 9 protein", "gene_name": "BCL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UU0-1", "protein_name": "B-cell CLL/lymphoma 9-like protein", "gene_name": "BCL9L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Y4-1", "protein_name": "Pygopus homolog 1", "gene_name": "PYGO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4A5-1", "protein_name": "Transformation/transcription domain-associated protein", "gene_name": "TRRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04724-1", "protein_name": "Transducin-like enhancer protein 1", "gene_name": "TLE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS4-1", "protein_name": "Transcription factor 7-like 1", "gene_name": "TCF7L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00255-2", "protein_name": "Menin", "gene_name": "MEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04725-1", "protein_name": "Transducin-like enhancer protein 2", "gene_name": "TLE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04727-1", "protein_name": "Transducin-like enhancer protein 4", "gene_name": "TLE4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22617422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cystine/glutamate antiporter system x(c)(-) in health and disease: from molecular mechanisms to novel therapeutic opportunities.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "Lewerenz J, Hewett SJ, Huang Y, Lambros M, Gout PW, Kalivas PW, Massie A, Smolders I, Methner A, Pergande M, Smith SB, Ganapathy V, Maher P", "reference": { "type": "PubMed", "id": "22667998", "url": "https://pubmed.ncbi.nlm.nih.gov/22667998" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22667998", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "iASPPsv antagonizes apoptosis induced by chemotherapeutic agents in MCF-7 cells and mouse thymocytes.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Wang L, Xing H, Tian Z, Peng L, Li Y, Tang K, Rao Q, Wang M, Wang J", "reference": { "type": "PubMed", "id": "22766503", "url": "https://pubmed.ncbi.nlm.nih.gov/22766503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ8-1", "protein_name": "Ferroptosis suppressor protein 1", "gene_name": "AIFM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ4-1", "protein_name": "Apoptosis-stimulating of p53 protein 1", "gene_name": "PPP1R13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAQ5-1", "protein_name": "Zinc finger protein 420", "gene_name": "ZNF420", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N28-1", "protein_name": "PRELI domain containing protein 3A", "gene_name": "PRELID3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15350-1", "protein_name": "Tumor protein p73", "gene_name": "TP73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55957-1", "protein_name": "BH3-interacting domain death agonist", "gene_name": "BID", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3D4-1", "protein_name": "Tumor protein 63", "gene_name": "TP63", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43715-1", "protein_name": "TP53-regulated inhibitor of apoptosis 1", "gene_name": "TRIAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13794-1", "protein_name": "Phorbol-12-myristate-13-acetate-induced protein 1", "gene_name": "PMAIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60238-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like", "gene_name": "BNIP3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y255-1", "protein_name": "PRELI domain-containing protein 1, mitochondrial", "gene_name": "PRELID1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q658P3-1", "protein_name": "Metalloreductase STEAP3", "gene_name": "STEAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A56-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "TP53INP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN2-1", "protein_name": "p53-regulated apoptosis-inducing protein 1", "gene_name": "TP53AIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13625-1", "protein_name": "Apoptosis-stimulating of p53 protein 2", "gene_name": "TP53BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22766503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glutathione synthesis.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Lu SC", "reference": { "type": "PubMed", "id": "22995213", "url": "https://pubmed.ncbi.nlm.nih.gov/22995213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22995213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Superoxide dismutase 3 is induced by antioxidants, inhibits oxidative DNA damage and is associated with inhibition of estrogen-induced breast cancer.", "journal": "Carcinogenesis", "date": "2012-12", "authors": "Singh Bhupendra, Bhat Hari K", "reference": { "type": "PubMed", "id": "23027624", "url": "https://pubmed.ncbi.nlm.nih.gov/23027624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23027624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hepatitis C virus induces epithelial-mesenchymal transition in primary human hepatocytes.", "journal": "Journal of virology", "date": "2012", "authors": "Bose SK, Meyer K, Di Bisceglie AM, Ray RB, Ray R", "reference": { "type": "PubMed", "id": "23035229", "url": "https://pubmed.ncbi.nlm.nih.gov/23035229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32MZ4-1", "protein_name": "Leucine-rich repeat flightless-interacting protein 1", "gene_name": "LRRFIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 552, "end_pos": 552, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P35222", "url": "https://www.uniprot.org/uniprotkb/P35222" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P35222", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35222" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "20361929", "url": "https://pubmed.ncbi.nlm.nih.gov/20361929" }, { "database": "PRO", "id": "P35222", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P35222" }, { "database": "PubMed", "id": "16476742", "url": "https://pubmed.ncbi.nlm.nih.gov/16476742" }, { "database": "PubMed", "id": "17287208", "url": "https://pubmed.ncbi.nlm.nih.gov/17287208" }, { "database": "PubMed", "id": "18353896", "url": "https://pubmed.ncbi.nlm.nih.gov/18353896" }, { "database": "PubMed", "id": "19879273", "url": "https://pubmed.ncbi.nlm.nih.gov/19879273" }, { "database": "PubMed", "id": "21325624", "url": "https://pubmed.ncbi.nlm.nih.gov/21325624" }, { "database": "PubMed", "id": "22520842", "url": "https://pubmed.ncbi.nlm.nih.gov/22520842" }, { "database": "PubMed", "id": "22692453", "url": "https://pubmed.ncbi.nlm.nih.gov/22692453" }, { "database": "PubMed", "id": "22912335", "url": "https://pubmed.ncbi.nlm.nih.gov/22912335" }, { "database": "PubMed", "id": "23035229", "url": "https://pubmed.ncbi.nlm.nih.gov/23035229" }, { "database": "PubMed", "id": "23168683", "url": "https://pubmed.ncbi.nlm.nih.gov/23168683" }, { "database": "PubMed", "id": "23618343", "url": "https://pubmed.ncbi.nlm.nih.gov/23618343" }, { "database": "PubMed", "id": "23785285", "url": "https://pubmed.ncbi.nlm.nih.gov/23785285" }, { "database": "PubMed", "id": "24365171", "url": "https://pubmed.ncbi.nlm.nih.gov/24365171" }, { "database": "PubMed", "id": "24832083", "url": "https://pubmed.ncbi.nlm.nih.gov/24832083" }, { "database": "PubMed", "id": "24930890", "url": "https://pubmed.ncbi.nlm.nih.gov/24930890" }, { "database": "PubMed", "id": "25143352", "url": "https://pubmed.ncbi.nlm.nih.gov/25143352" }, { "database": "PubMed", "id": "25360740", "url": "https://pubmed.ncbi.nlm.nih.gov/25360740" }, { "database": "PubMed", "id": "25500543", "url": "https://pubmed.ncbi.nlm.nih.gov/25500543" }, { "database": "PubMed", "id": "25514828", "url": "https://pubmed.ncbi.nlm.nih.gov/25514828" }, { "database": "PubMed", "id": "25544767", "url": "https://pubmed.ncbi.nlm.nih.gov/25544767" }, { "database": "PubMed", "id": "25552486", "url": "https://pubmed.ncbi.nlm.nih.gov/25552486" }, { "database": "PubMed", "id": "25647637", "url": "https://pubmed.ncbi.nlm.nih.gov/25647637" }, { "database": "PubMed", "id": "25683913", "url": "https://pubmed.ncbi.nlm.nih.gov/25683913" }, { "database": "PubMed", "id": "26565021", "url": "https://pubmed.ncbi.nlm.nih.gov/26565021" }, { "database": "PubMed", "id": "26700621", "url": "https://pubmed.ncbi.nlm.nih.gov/26700621" }, { "database": "PubMed", "id": "26747727", "url": "https://pubmed.ncbi.nlm.nih.gov/26747727" }, { "database": "PubMed", "id": "26908451", "url": "https://pubmed.ncbi.nlm.nih.gov/26908451" }, { "database": "PubMed", "id": "27384483", "url": "https://pubmed.ncbi.nlm.nih.gov/27384483" }, { "database": "PubMed", "id": "27698922", "url": "https://pubmed.ncbi.nlm.nih.gov/27698922" }, { "database": "PubMed", "id": "27824126", "url": "https://pubmed.ncbi.nlm.nih.gov/27824126" }, { "database": "PubMed", "id": "28184024", "url": "https://pubmed.ncbi.nlm.nih.gov/28184024" }, { "database": "PubMed", "id": "28345588", "url": "https://pubmed.ncbi.nlm.nih.gov/28345588" }, { "database": "PubMed", "id": "28525379", "url": "https://pubmed.ncbi.nlm.nih.gov/28525379" }, { "database": "PubMed", "id": "28529629", "url": "https://pubmed.ncbi.nlm.nih.gov/28529629" }, { "database": "PubMed", "id": "28656063", "url": "https://pubmed.ncbi.nlm.nih.gov/28656063" }, { "database": "PubMed", "id": "28671671", "url": "https://pubmed.ncbi.nlm.nih.gov/28671671" }, { "database": "PubMed", "id": "29050202", "url": "https://pubmed.ncbi.nlm.nih.gov/29050202" }, { "database": "PubMed", "id": "29330435", "url": "https://pubmed.ncbi.nlm.nih.gov/29330435" }, { "database": "PubMed", "id": "29415992", "url": "https://pubmed.ncbi.nlm.nih.gov/29415992" }, { "database": "PubMed", "id": "29426364", "url": "https://pubmed.ncbi.nlm.nih.gov/29426364" }, { "database": "PubMed", "id": "30031230", "url": "https://pubmed.ncbi.nlm.nih.gov/30031230" }, { "database": "PubMed", "id": "30165890", "url": "https://pubmed.ncbi.nlm.nih.gov/30165890" }, { "database": "PubMed", "id": "30258898", "url": "https://pubmed.ncbi.nlm.nih.gov/30258898" }, { "database": "PubMed", "id": "30662060", "url": "https://pubmed.ncbi.nlm.nih.gov/30662060" }, { "database": "PubMed", "id": "30841855", "url": "https://pubmed.ncbi.nlm.nih.gov/30841855" }, { "database": "PubMed", "id": "30854043", "url": "https://pubmed.ncbi.nlm.nih.gov/30854043" }, { "database": "PubMed", "id": "30918250", "url": "https://pubmed.ncbi.nlm.nih.gov/30918250" }, { "database": "PubMed", "id": "32033025", "url": "https://pubmed.ncbi.nlm.nih.gov/32033025" }, { "database": "PubMed", "id": "32117718", "url": "https://pubmed.ncbi.nlm.nih.gov/32117718" }, { "database": "PubMed", "id": "32344885", "url": "https://pubmed.ncbi.nlm.nih.gov/32344885" }, { "database": "PubMed", "id": "32824435", "url": "https://pubmed.ncbi.nlm.nih.gov/32824435" }, { "database": "PubMed", "id": "33321112", "url": "https://pubmed.ncbi.nlm.nih.gov/33321112" }, { "database": "PubMed", "id": "33641663", "url": "https://pubmed.ncbi.nlm.nih.gov/33641663" }, { "database": "PubMed", "id": "33923707", "url": "https://pubmed.ncbi.nlm.nih.gov/33923707" } ], "site_lbl": "Ser552", "uniprot_canonical_ac": "P35222-1" } ], "record_id": "pubmed.23035229", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The high Nrf2 expression in human acute myeloid leukemia is driven by NF-\u03baB and underlies its chemo-resistance.", "journal": "Blood", "date": "2012-12-20", "authors": "Rushworth Stuart A, Zaitseva Lyubov, Murray Megan Y, Shah Niraj M, Bowles Kristian M, MacEwan David J", "reference": { "type": "PubMed", "id": "23077289", "url": "https://pubmed.ncbi.nlm.nih.gov/23077289" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23077289", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the dimeric coiled-coil domain of the cytosolic nucleic acid sensor LRRFIP1.", "journal": "Journal of structural biology", "date": "2013", "authors": "Nguyen JB, Modis Y", "reference": { "type": "PubMed", "id": "23099021", "url": "https://pubmed.ncbi.nlm.nih.gov/23099021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32MZ4-1", "protein_name": "Leucine-rich repeat flightless-interacting protein 1", "gene_name": "LRRFIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23099021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of FAM124B as a novel component of a CHD7 and CHD8 containing complex.", "journal": "PloS one", "date": "2012", "authors": "Batsukh T, Schulz Y, Wolf S, Rabe TI, Oellerich T, Urlaub H, Schaefer IM, Pauli S", "reference": { "type": "PubMed", "id": "23285124", "url": "https://pubmed.ncbi.nlm.nih.gov/23285124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Z6-1", "protein_name": "Protein FAM124B", "gene_name": "FAM124B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCK8-1", "protein_name": "ATP-dependent chromatin remodeler CHD8", "gene_name": "CHD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU2-1", "protein_name": "Dickkopf-related protein 2", "gene_name": "DKK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F2-1", "protein_name": "Protein naked cuticle homolog 2", "gene_name": "NKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49711-1", "protein_name": "Transcriptional repressor CTCF", "gene_name": "CTCF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T1-1", "protein_name": "Axin-2", "gene_name": "AXIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BLQ0-1", "protein_name": "Protein FAM124B", "gene_name": "Fam124b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D1-1", "protein_name": "ATP-dependent chromatin remodeler CHD7", "gene_name": "CHD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01344-1", "protein_name": "Insulin-like growth factor 2", "gene_name": "IGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23285124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHD6, a cellular repressor of influenza virus replication, is degraded in human alveolar epithelial cells and mice lungs during infection.", "journal": "Journal of virology", "date": "2013", "authors": "Alfonso R, Rodriguez A, Rodriguez P, Lutz T, Nieto A", "reference": { "type": "PubMed", "id": "23408615", "url": "https://pubmed.ncbi.nlm.nih.gov/23408615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Z6-1", "protein_name": "Protein FAM124B", "gene_name": "FAM124B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCK8-1", "protein_name": "ATP-dependent chromatin remodeler CHD8", "gene_name": "CHD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU2-1", "protein_name": "Dickkopf-related protein 2", "gene_name": "DKK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F2-1", "protein_name": "Protein naked cuticle homolog 2", "gene_name": "NKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49711-1", "protein_name": "Transcriptional repressor CTCF", "gene_name": "CTCF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T1-1", "protein_name": "Axin-2", "gene_name": "AXIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D1-1", "protein_name": "ATP-dependent chromatin remodeler CHD7", "gene_name": "CHD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01344-1", "protein_name": "Insulin-like growth factor 2", "gene_name": "IGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23408615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 45 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt kinase targets the association of CBP with histone H3 to regulate the acetylation of lysine K18.", "journal": "FEBS letters", "date": "2013", "authors": "Liu Y, Xing ZB, Zhang JH, Fang Y", "reference": { "type": "PubMed", "id": "23434580", "url": "https://pubmed.ncbi.nlm.nih.gov/23434580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1871, "end_pos": 1871, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92793", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92793" }, { "database": "PubMed", "id": "23434580", "url": "https://pubmed.ncbi.nlm.nih.gov/23434580" } ], "site_lbl": "Thr1871", "uniprot_canonical_ac": "Q92793-1" } ], "record_id": "pubmed.23434580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure and mechanism of activation of TANK-binding kinase 1.", "journal": "Cell reports", "date": "2013", "authors": "Larabi A, Devos JM, Ng SL, Nanao MH, Round A, Maniatis T, Panne D", "reference": { "type": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 135, "end_pos": 135, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" }, { "database": "PubMed", "id": "23453972", "url": "https://pubmed.ncbi.nlm.nih.gov/23453972" }, { "database": "PubMed", "id": "21931631", "url": "https://pubmed.ncbi.nlm.nih.gov/21931631" }, { "database": "PubMed", "id": "30842653", "url": "https://pubmed.ncbi.nlm.nih.gov/30842653" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 30, "end_pos": 30, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreases ubiquitination. Abolishes ubiquitination, phosphorylation and kinase activity; when associated with R-401.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "D", "sequence_mut": "A", "comment": "Decreases phosphorylation and kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 355, "end_pos": 355, "sequence_org": "E", "sequence_mut": "R", "comment": "Decreases phosphorylation and kinase activity. Abolishes dimerization; when associated with A-357 or R-448.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" }, { "database": "PubMed", "id": "23453972", "url": "https://pubmed.ncbi.nlm.nih.gov/23453972" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 357, "end_pos": 357, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreases phosphorylation and kinase activity. Abolishes dimerization; when associated with R-355.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 38, "end_pos": 38, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "10581243", "url": "https://pubmed.ncbi.nlm.nih.gov/10581243" }, { "database": "PubMed", "id": "23453972", "url": "https://pubmed.ncbi.nlm.nih.gov/23453972" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" }, { "database": "PubMed", "id": "31709703", "url": "https://pubmed.ncbi.nlm.nih.gov/31709703" }, { "database": "PubMed", "id": "29150432", "url": "https://pubmed.ncbi.nlm.nih.gov/29150432" }, { "database": "PubMed", "id": "22851595", "url": "https://pubmed.ncbi.nlm.nih.gov/22851595" }, { "database": "PubMed", "id": "31530866", "url": "https://pubmed.ncbi.nlm.nih.gov/31530866" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 401, "end_pos": 401, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreases ubiquitination. Abolishes ubiquitination, phosphorylation and kinase activity; when associated with R-30.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 547, "end_pos": 547, "sequence_org": "R", "sequence_mut": "D", "comment": "Decreases phosphorylation and kinase activity. Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 577, "end_pos": 577, "sequence_org": "Y", "sequence_mut": "A", "comment": "Decreases kinase activity. Reduced phosphorylation of STING1.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" }, { "database": "PubMed", "id": "30842653", "url": "https://pubmed.ncbi.nlm.nih.gov/30842653" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 580, "end_pos": 580, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreases kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 582, "end_pos": 582, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreases kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" }, { "start_pos": 589, "end_pos": 589, "sequence_org": "K", "sequence_mut": "D", "comment": "Decreases phosphorylation and kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHD2", "url": "https://www.uniprot.org/uniprotkb/Q9UHD2" }, { "database": "PubMed", "id": "23453971", "url": "https://pubmed.ncbi.nlm.nih.gov/23453971" } ], "uniprot_canonical_ac": "Q9UHD2-1" } ], "record_id": "pubmed.23453971", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Allosteric communication in the KIX domain proceeds through dynamic repacking of the hydrophobic core.", "journal": "ACS Chem. Biol.", "date": "2013", "authors": "Br\u00fcschweiler Sven, Konrat Robert, Tollinger Martin", "reference": { "type": "PubMed", "id": "23651431", "url": "https://pubmed.ncbi.nlm.nih.gov/23651431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16220-2", "protein_name": "Cyclic AMP-responsive element-binding protein 1", "gene_name": "CREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03164-1", "protein_name": "Histone-lysine N-methyltransferase 2A", "gene_name": "KMT2A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23651431", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SIRT3 deacetylates FOXO3 to protect mitochondria against oxidative damage.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Tseng AH, Shieh SS, Wang DL", "reference": { "type": "PubMed", "id": "23665396", "url": "https://pubmed.ncbi.nlm.nih.gov/23665396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31689-1", "protein_name": "DnaJ homolog subfamily A member 1", "gene_name": "DNAJA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04179-1", "protein_name": "Superoxide dismutase [Mn], mitochondrial", "gene_name": "SOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38646-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "HSPA9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2D1-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-5", "gene_name": "ATF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04040-1", "protein_name": "Catalase", "gene_name": "CAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61604-1", "protein_name": "10 kDa heat shock protein, mitochondrial", "gene_name": "HSPE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01523-1", "protein_name": "Defensin alpha 5", "gene_name": "DEFA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36776-1", "protein_name": "Lon protease homolog, mitochondrial", "gene_name": "LONP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3M7-1", "protein_name": "Thioredoxin-interacting protein", "gene_name": "TXNIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43464-1", "protein_name": "Serine protease HTRA2, mitochondrial", "gene_name": "HTRA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10809-1", "protein_name": "60 kDa heat shock protein, mitochondrial", "gene_name": "HSPD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16656-1", "protein_name": "Nuclear respiratory factor 1", "gene_name": "NRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV9-1", "protein_name": "Heat shock 70 kDa protein 1B", "gene_name": "HSPA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DMV8-1", "protein_name": "Heat shock 70 kDa protein 1A", "gene_name": "HSPA1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23665396", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nrf2 pathway regulates multidrug-resistance-associated protein 1 in small cell lung cancer.", "journal": "PloS one", "date": "2013", "authors": "Ji Lili, Li Hui, Gao Pan, Shang Guoguo, Zhang Donna D, Zhang Nong, Jiang Tao", "reference": { "type": "PubMed", "id": "23667609", "url": "https://pubmed.ncbi.nlm.nih.gov/23667609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UG63-1", "protein_name": "ATP-binding cassette sub-family F member 2", "gene_name": "ABCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15438-1", "protein_name": "ATP-binding cassette sub-family C member 3", "gene_name": "ABCC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23667609", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.", "journal": "Cell reports", "date": "2013", "authors": "Andrysik Z, Kim J, Tan AC, Espinosa JM", "reference": { "type": "PubMed", "id": "23684607", "url": "https://pubmed.ncbi.nlm.nih.gov/23684607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ8-1", "protein_name": "Ferroptosis suppressor protein 1", "gene_name": "AIFM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ4-1", "protein_name": "Apoptosis-stimulating of p53 protein 1", "gene_name": "PPP1R13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAQ5-1", "protein_name": "Zinc finger protein 420", "gene_name": "ZNF420", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N28-1", "protein_name": "PRELI domain containing protein 3A", "gene_name": "PRELID3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15350-1", "protein_name": "Tumor protein p73", "gene_name": "TP73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55957-1", "protein_name": "BH3-interacting domain death agonist", "gene_name": "BID", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3D4-1", "protein_name": "Tumor protein 63", "gene_name": "TP63", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43715-1", "protein_name": "TP53-regulated inhibitor of apoptosis 1", "gene_name": "TRIAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13794-1", "protein_name": "Phorbol-12-myristate-13-acetate-induced protein 1", "gene_name": "PMAIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60238-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like", "gene_name": "BNIP3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y255-1", "protein_name": "PRELI domain-containing protein 1, mitochondrial", "gene_name": "PRELID1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q658P3-1", "protein_name": "Metalloreductase STEAP3", "gene_name": "STEAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A56-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "TP53INP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN2-1", "protein_name": "p53-regulated apoptosis-inducing protein 1", "gene_name": "TP53AIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13625-1", "protein_name": "Apoptosis-stimulating of p53 protein 2", "gene_name": "TP53BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23684607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-421 induces cell proliferation and apoptosis resistance in human nasopharyngeal carcinoma via downregulation of FOXO4.", "journal": "Biochemical and biophysical research communications", "date": "2013", "authors": "Chen L, Tang Y, Wang J, Yan Z, Xu R", "reference": { "type": "PubMed", "id": "23707940", "url": "https://pubmed.ncbi.nlm.nih.gov/23707940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23511-1", "protein_name": "Nuclear transcription factor Y subunit alpha", "gene_name": "NFYA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35638-1", "protein_name": "DNA damage-inducible transcript 3 protein", "gene_name": "DDIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99967-1", "protein_name": "Cbp/p300-interacting transactivator 2", "gene_name": "CITED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43521-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "BCL2L11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25208-1", "protein_name": "Nuclear transcription factor Y subunit beta", "gene_name": "NFYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41182-1", "protein_name": "B-cell lymphoma 6 protein", "gene_name": "BCL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13952-1", "protein_name": "Nuclear transcription factor Y subunit gamma", "gene_name": "NFYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM7-1", "protein_name": "Serine/threonine-protein kinase PINK1, mitochondrial", "gene_name": "PINK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23707940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Single-cell RNA-Seq profiling of human preimplantation embryos and embryonic stem cells.", "journal": "Nature structural & molecular biology", "date": "2013-09", "authors": "Yan Liying, Yang Mingyu, Guo Hongshan, Yang Lu, Wu Jun, Li Rong, Liu Ping, Lian Ying, Zheng Xiaoying, Yan Jie, Huang Jin, Li Ming, Wu Xinglong, Wen Lu, Lao Kaiqin, Li Ruiqiang, Qiao Jie, Tang Fuchou", "reference": { "type": "PubMed", "id": "23934149", "url": "https://pubmed.ncbi.nlm.nih.gov/23934149" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23934149", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the human thioredoxin gene promoter and its key substrates: a study of functional and putative regulatory elements.", "journal": "Biochimica et biophysica acta", "date": "2014-01", "authors": "Hawkes Hye-Jin Kim, Karlenius Therese C, Tonissen Kathryn F", "reference": { "type": "PubMed", "id": "24041992", "url": "https://pubmed.ncbi.nlm.nih.gov/24041992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24041992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repression of RNA polymerase I upon stress is caused by inhibition of RNA-dependent deacetylation of PAF53 by SIRT7.", "journal": "Molecular cell", "date": "2013", "authors": "Chen S, Seiler J, Santiago-Reichelt M, Felbel K, Grummt I, Voit R", "reference": { "type": "PubMed", "id": "24207024", "url": "https://pubmed.ncbi.nlm.nih.gov/24207024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZS1-2", "protein_name": "DNA-directed RNA polymerase I subunit RPA49", "gene_name": "POLR1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC8-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-7", "gene_name": "SIRT7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 373, "end_pos": 373, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased acetylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9GZS1", "url": "https://www.uniprot.org/uniprotkb/Q9GZS1" }, { "database": "PubMed", "id": "24207024", "url": "https://pubmed.ncbi.nlm.nih.gov/24207024" } ], "uniprot_canonical_ac": "Q9GZS1-2" } ], "record_id": "pubmed.24207024", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DUX4 binding to retroelements creates promoters that are active in FSHD muscle and testis.", "journal": "PLoS genetics", "date": "2013-11", "authors": "Young Janet M, Whiddon Jennifer L, Yao Zizhen, Kasinathan Bhavatharini, Snider Lauren, Geng Linda N, Balog Judit, Tawil Rabi, van der Maarel Silv\u00e8re M, Tapscott Stephen J", "reference": { "type": "PubMed", "id": "24278031", "url": "https://pubmed.ncbi.nlm.nih.gov/24278031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24278031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into acetylated-histone H4 recognition by the bromodomain-PHD finger module of human transcriptional coactivator CBP.", "journal": "Structure", "date": "2014", "authors": "Plotnikov Alexander N, Yang Shuai, Zhou Thomas Jiachi, Rusinova Elena, Frasca Antonio, Zhou Ming-Ming", "reference": { "type": "PubMed", "id": "24361270", "url": "https://pubmed.ncbi.nlm.nih.gov/24361270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24361270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of the histone chaperone ASF1 to the CBP bromodomain promotes histone acetylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Das C, Roy S, Namjoshi S, Malarkey CS, Jones DN, Kutateladze TG, Churchill ME, Tyler JK", "reference": { "type": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVP2-1", "protein_name": "Histone chaperone ASF1B", "gene_name": "ASF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y294-1", "protein_name": "Histone chaperone ASF1A", "gene_name": "ASF1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1116, "end_pos": 1116, "sequence_org": "D", "sequence_mut": "R", "comment": "Impairs binding to acetylated histones.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1126, "end_pos": 1126, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs binding to acetylated histones.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1162, "end_pos": 1162, "sequence_org": "N", "sequence_mut": "E", "comment": "Abolishes interaction with ASF1A.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1162, "end_pos": 1162, "sequence_org": "N", "sequence_mut": "R", "comment": "Abolishes interaction with ASF1A.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1165, "end_pos": 1165, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes interaction with ASF1A.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1170, "end_pos": 1170, "sequence_org": "K", "sequence_mut": "E", "comment": "Impairs binding to acetylated histones.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1179, "end_pos": 1179, "sequence_org": "S", "sequence_mut": "I", "comment": "Impairs interaction with ASF1A.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1180, "end_pos": 1180, "sequence_org": "K", "sequence_mut": "E", "comment": "Abolishes interaction with ASF1A.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" }, { "start_pos": 1183, "end_pos": 1183, "sequence_org": "E", "sequence_mut": "R", "comment": "Abolishes interaction with ASF1A.", "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" }, { "database": "PubMed", "id": "24616510", "url": "https://pubmed.ncbi.nlm.nih.gov/24616510" } ], "uniprot_canonical_ac": "Q92793-1" } ], "record_id": "pubmed.24616510", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functionally distinct effects of the C-terminal regions of IKKepsilon and TBK1 on type I IFN production.", "journal": "PloS one", "date": "2014", "authors": "Nakatsu Y, Matsuoka M, Chang TH, Otsuki N, Noda M, Kimura H, Sakai K, Kato H, Takeda M, Kubota T", "reference": { "type": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 386, "end_pos": 386, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "9463386", "url": "https://pubmed.ncbi.nlm.nih.gov/9463386" }, { "database": "PRO", "id": "Q14653", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14653" }, { "database": "PubMed", "id": "10805757", "url": "https://pubmed.ncbi.nlm.nih.gov/10805757" }, { "database": "PubMed", "id": "10920266", "url": "https://pubmed.ncbi.nlm.nih.gov/10920266" }, { "database": "PubMed", "id": "17526488", "url": "https://pubmed.ncbi.nlm.nih.gov/17526488" }, { "database": "PubMed", "id": "20170763", "url": "https://pubmed.ncbi.nlm.nih.gov/20170763" }, { "database": "PubMed", "id": "20532218", "url": "https://pubmed.ncbi.nlm.nih.gov/20532218" }, { "database": "PubMed", "id": "21347389", "url": "https://pubmed.ncbi.nlm.nih.gov/21347389" }, { "database": "PubMed", "id": "23746807", "url": "https://pubmed.ncbi.nlm.nih.gov/23746807" }, { "database": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, { "database": "PubMed", "id": "24752990", "url": "https://pubmed.ncbi.nlm.nih.gov/24752990" }, { "database": "PubMed", "id": "25506707", "url": "https://pubmed.ncbi.nlm.nih.gov/25506707" }, { "database": "PubMed", "id": "26216125", "url": "https://pubmed.ncbi.nlm.nih.gov/26216125" }, { "database": "PubMed", "id": "26646986", "url": "https://pubmed.ncbi.nlm.nih.gov/26646986" }, { "database": "PubMed", "id": "26811330", "url": "https://pubmed.ncbi.nlm.nih.gov/26811330" }, { "database": "PubMed", "id": "27045107", "url": "https://pubmed.ncbi.nlm.nih.gov/27045107" }, { "database": "PubMed", "id": "27454487", "url": "https://pubmed.ncbi.nlm.nih.gov/27454487" }, { "database": "PubMed", "id": "28295920", "url": "https://pubmed.ncbi.nlm.nih.gov/28295920" }, { "database": "PubMed", "id": "28465426", "url": "https://pubmed.ncbi.nlm.nih.gov/28465426" }, { "database": "PubMed", "id": "28589097", "url": "https://pubmed.ncbi.nlm.nih.gov/28589097" }, { "database": "PubMed", "id": "29962372", "url": "https://pubmed.ncbi.nlm.nih.gov/29962372" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "32161340", "url": "https://pubmed.ncbi.nlm.nih.gov/32161340" }, { "database": "PubMed", "id": "33205822", "url": "https://pubmed.ncbi.nlm.nih.gov/33205822" }, { "database": "PubMed", "id": "33300875", "url": "https://pubmed.ncbi.nlm.nih.gov/33300875" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "36603579", "url": "https://pubmed.ncbi.nlm.nih.gov/36603579" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" } ], "site_lbl": "Ser386", "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE and TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "12524442", "url": "https://pubmed.ncbi.nlm.nih.gov/12524442" }, { "database": "PRO", "id": "Q14653", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14653" }, { "database": "PubMed", "id": "17761676", "url": "https://pubmed.ncbi.nlm.nih.gov/17761676" }, { "database": "PubMed", "id": "18356163", "url": "https://pubmed.ncbi.nlm.nih.gov/18356163" }, { "database": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" }, { "database": "PubMed", "id": "20161788", "url": "https://pubmed.ncbi.nlm.nih.gov/20161788" }, { "database": "PubMed", "id": "20170763", "url": "https://pubmed.ncbi.nlm.nih.gov/20170763" }, { "database": "PubMed", "id": "20416917", "url": "https://pubmed.ncbi.nlm.nih.gov/20416917" }, { "database": "PubMed", "id": "20511230", "url": "https://pubmed.ncbi.nlm.nih.gov/20511230" }, { "database": "PubMed", "id": "20532218", "url": "https://pubmed.ncbi.nlm.nih.gov/20532218" }, { "database": "PubMed", "id": "20609418", "url": "https://pubmed.ncbi.nlm.nih.gov/20609418" }, { "database": "PubMed", "id": "20694008", "url": "https://pubmed.ncbi.nlm.nih.gov/20694008" }, { "database": "PubMed", "id": "21347389", "url": "https://pubmed.ncbi.nlm.nih.gov/21347389" }, { "database": "PubMed", "id": "23090018", "url": "https://pubmed.ncbi.nlm.nih.gov/23090018" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, { "database": "PubMed", "id": "24870145", "url": "https://pubmed.ncbi.nlm.nih.gov/24870145" }, { "database": "PubMed", "id": "25444175", "url": "https://pubmed.ncbi.nlm.nih.gov/25444175" }, { "database": "PubMed", "id": "25891802", "url": "https://pubmed.ncbi.nlm.nih.gov/25891802" }, { "database": "PubMed", "id": "25923723", "url": "https://pubmed.ncbi.nlm.nih.gov/25923723" }, { "database": "PubMed", "id": "26811330", "url": "https://pubmed.ncbi.nlm.nih.gov/26811330" }, { "database": "PubMed", "id": "27576490", "url": "https://pubmed.ncbi.nlm.nih.gov/27576490" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "28150813", "url": "https://pubmed.ncbi.nlm.nih.gov/28150813" }, { "database": "PubMed", "id": "28589097", "url": "https://pubmed.ncbi.nlm.nih.gov/28589097" }, { "database": "PubMed", "id": "28717003", "url": "https://pubmed.ncbi.nlm.nih.gov/28717003" }, { "database": "PubMed", "id": "29677136", "url": "https://pubmed.ncbi.nlm.nih.gov/29677136" }, { "database": "PubMed", "id": "29962372", "url": "https://pubmed.ncbi.nlm.nih.gov/29962372" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30867315", "url": "https://pubmed.ncbi.nlm.nih.gov/30867315" }, { "database": "PubMed", "id": "31618847", "url": "https://pubmed.ncbi.nlm.nih.gov/31618847" }, { "database": "PubMed", "id": "31686982", "url": "https://pubmed.ncbi.nlm.nih.gov/31686982" }, { "database": "PubMed", "id": "32179480", "url": "https://pubmed.ncbi.nlm.nih.gov/32179480" }, { "database": "PubMed", "id": "32634441", "url": "https://pubmed.ncbi.nlm.nih.gov/32634441" }, { "database": "PubMed", "id": "32783398", "url": "https://pubmed.ncbi.nlm.nih.gov/32783398" }, { "database": "PubMed", "id": "33253291", "url": "https://pubmed.ncbi.nlm.nih.gov/33253291" }, { "database": "PubMed", "id": "33300875", "url": "https://pubmed.ncbi.nlm.nih.gov/33300875" }, { "database": "PubMed", "id": "33391252", "url": "https://pubmed.ncbi.nlm.nih.gov/33391252" }, { "database": "PubMed", "id": "33603735", "url": "https://pubmed.ncbi.nlm.nih.gov/33603735" }, { "database": "PubMed", "id": "33986734", "url": "https://pubmed.ncbi.nlm.nih.gov/33986734" }, { "database": "PubMed", "id": "23478265", "url": "https://pubmed.ncbi.nlm.nih.gov/23478265" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "36603579", "url": "https://pubmed.ncbi.nlm.nih.gov/36603579" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" } ], "site_lbl": "Ser396", "uniprot_canonical_ac": "Q14653-1" } ], "record_id": "pubmed.24722368", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CBP and p300 acetylate PCNA to link its degradation with nucleotide excision repair synthesis.", "journal": "Nucleic acids research", "date": "2014", "authors": "Cazzalini O, Sommatis S, Tillhon M, Dutto I, Bachi A, Rapp A, Nardo T, Scovassi AI, Necchi D, Cardoso MC, Stivala LA, Prosperi E", "reference": { "type": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28340-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "POLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 13, "end_pos": 13, "sequence_org": "K", "sequence_mut": "R", "comment": "Inhibits acetylation, recruitment to DNA damage sites, inducible ubiquitination and protein degradation, DNA replication and repair synthesis efficiencies, but homotrimer formation, nuclear recruitment to DNA damage sites, interactions with CREBBP, EP300 and POLD1 are similar as the wild-type; in association with R-14; R-20; R-77 and R-80.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" }, { "start_pos": 14, "end_pos": 14, "sequence_org": "K", "sequence_mut": "R", "comment": "Inhibits acetylation, recruitment to DNA damage sites, inducible ubiquitination and protein degradation, DNA replication and repair synthesis efficiencies, but homotrimer formation, nuclear recruitment to DNA damage sites, interactions with CREBBP, EP300 and POLD1 are similar as the wild-type; in association with R-13; R-20; R-77 and R-80.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" }, { "start_pos": 20, "end_pos": 20, "sequence_org": "K", "sequence_mut": "R", "comment": "Inhibits acetylation, recruitment to DNA damage sites, inducible ubiquitination and protein degradation, DNA replication and repair synthesis efficiencies, but homotrimer formation, nuclear recruitment to DNA damage sites, interactions with CREBBP, EP300 and POLD1 are similar as the wild-type; in association with R-13; R-14; R-77 and R-80.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "K", "sequence_mut": "A", "comment": "Inhibits recruitment to DNA damage sites, but nuclear localization is similar as the wild-type; in association with A-80.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "K", "sequence_mut": "R", "comment": "Inhibits acetylation, recruitment to DNA damage sites, inducible ubiquitination and protein degradation, DNA replication and repair synthesis efficiencies, but homotrimer formation, nuclear recruitment to DNA damage sites, interactions with CREBBP, EP300 and POLD1 are similar as the wild-type; in association with R-13; R-14; R-20 and R-80.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "K", "sequence_mut": "A", "comment": "Inhibits recruitment to DNA damage sites, but nuclear localization is similar as the wild-type; in association with A-77.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "K", "sequence_mut": "R", "comment": "Inhibits acetylation, recruitment to DNA damage sites, inducible ubiquitination and protein degradation, DNA replication and repair synthesis efficiencies, but homotrimer formation, nuclear recruitment to DNA damage sites, interactions with CREBBP, EP300 and POLD1 are similar as the wild-type; in association with R-13; R-14; R-20 and R-77.", "evidence": [ { "database": "UniProtKB", "id": "P12004", "url": "https://www.uniprot.org/uniprotkb/P12004" }, { "database": "PubMed", "id": "24939902", "url": "https://pubmed.ncbi.nlm.nih.gov/24939902" } ], "uniprot_canonical_ac": "P12004-1" } ], "record_id": "pubmed.24939902", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nrf2- and ATF4-dependent upregulation of xCT modulates the sensitivity of T24 bladder carcinoma cells to proteasome inhibition.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Ye P, Mimura J, Okada T, Sato H, Liu T, Maruyama A, Ohyama C, Itoh K", "reference": { "type": "PubMed", "id": "25002527", "url": "https://pubmed.ncbi.nlm.nih.gov/25002527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25002527", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intramitochondrial recruitment of endolysosomes mediates Smac degradation and constitutes a novel intrinsic apoptosis antagonizing function of XIAP E3 ligase.", "journal": "Cell death and differentiation", "date": "2014", "authors": "Hamacher-Brady A, Choe SC, Krijnse-Locker J, Brady NR", "reference": { "type": "PubMed", "id": "25080938", "url": "https://pubmed.ncbi.nlm.nih.gov/25080938" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ8-1", "protein_name": "Ferroptosis suppressor protein 1", "gene_name": "AIFM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ4-1", "protein_name": "Apoptosis-stimulating of p53 protein 1", "gene_name": "PPP1R13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAQ5-1", "protein_name": "Zinc finger protein 420", "gene_name": "ZNF420", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N28-1", "protein_name": "PRELI domain containing protein 3A", "gene_name": "PRELID3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15350-1", "protein_name": "Tumor protein p73", "gene_name": "TP73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55957-1", "protein_name": "BH3-interacting domain death agonist", "gene_name": "BID", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3D4-1", "protein_name": "Tumor protein 63", "gene_name": "TP63", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43715-1", "protein_name": "TP53-regulated inhibitor of apoptosis 1", "gene_name": "TRIAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13794-1", "protein_name": "Phorbol-12-myristate-13-acetate-induced protein 1", "gene_name": "PMAIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60238-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like", "gene_name": "BNIP3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y255-1", "protein_name": "PRELI domain-containing protein 1, mitochondrial", "gene_name": "PRELID1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q658P3-1", "protein_name": "Metalloreductase STEAP3", "gene_name": "STEAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A56-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "TP53INP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN2-1", "protein_name": "p53-regulated apoptosis-inducing protein 1", "gene_name": "TP53AIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13625-1", "protein_name": "Apoptosis-stimulating of p53 protein 2", "gene_name": "TP53BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25080938", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a functional antioxidant response element within the eighth intron of the human ABCC3 gene.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2015-01", "authors": "Canet Mark J, Merrell Matthew D, Harder Bryan G, Maher Jonathan M, Wu Tongde, Lickteig Andrew J, Jackson Jonathan P, Zhang Donna D, Yamamoto Masayuki, Cherrington Nathan J", "reference": { "type": "PubMed", "id": "25349122", "url": "https://pubmed.ncbi.nlm.nih.gov/25349122" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UG63-1", "protein_name": "ATP-binding cassette sub-family F member 2", "gene_name": "ABCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15438-1", "protein_name": "ATP-binding cassette sub-family C member 3", "gene_name": "ABCC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25349122", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insights into genotype-phenotype correlations from CREBBP point mutation screening in a cohort of 46 Rubinstein-Taybi syndrome patients.", "journal": "Clinical genetics", "date": "2015", "authors": "Spena S, Milani D, Rusconi D, Negri G, Colapietro P, Elcioglu N, Bedeschi F, Pilotta A, Spaccini L, Ficcadenti A, Magnani C, Scarano G, Selicorni A, Larizza L, Gervasini C", "reference": { "type": "PubMed", "id": "25388907", "url": "https://pubmed.ncbi.nlm.nih.gov/25388907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25388907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two erbA homologs encoding proteins with different T3 binding capacities are transcribed from opposite DNA strands of the same genetic locus.", "journal": "Cell", "date": "1989", "authors": "Miyajima N, Horiuchi R, Shibuya Y, Fukushige S, Matsubara K, Toyoshima K, Yamamoto T", "reference": { "type": "PubMed", "id": "2539258", "url": "https://pubmed.ncbi.nlm.nih.gov/2539258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10827-1", "protein_name": "Thyroid hormone receptor alpha", "gene_name": "THRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2539258", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Exosome transfer from stromal to breast cancer cells regulates therapy resistance pathways.", "journal": "Cell", "date": "2014", "authors": "Boelens MC, Wu TJ, Nabet BY, Xu B, Qiu Y, Yoon T, Azzam DJ, Twyman-Saint Victor C, Wiemann BZ, Ishwaran H, Ter Brugge PJ, Jonkers J, Slingerland J, Minn AJ", "reference": { "type": "PubMed", "id": "25417103", "url": "https://pubmed.ncbi.nlm.nih.gov/25417103" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM47-1", "protein_name": "Neurogenic locus notch homolog protein 3", "gene_name": "NOTCH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4D7-1", "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IX03-1", "protein_name": "Protein KIBRA", "gene_name": "WWC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15398-2", "protein_name": "Disks large-associated protein 5", "gene_name": "DLGAP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15540-1", "protein_name": "Fatty acid-binding protein, brain", "gene_name": "FABP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40424-1", "protein_name": "Pre-B-cell leukemia transcription factor 1", "gene_name": "PBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ87-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif-like protein", "gene_name": "HEYL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ISU1-1", "protein_name": "Pre T-cell antigen receptor alpha", "gene_name": "PTCRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25417103", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pokemon (FBI-1) interacts with Smad4 to repress TGF-beta-induced transcriptional responses.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Yang Y, Cui J, Xue F, Zhang C, Mei Z, Wang Y, Bi M, Shan D, Meredith A, Li H, Xu ZQ", "reference": { "type": "PubMed", "id": "25514493", "url": "https://pubmed.ncbi.nlm.nih.gov/25514493" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95365-1", "protein_name": "Zinc finger and BTB domain-containing protein 7A", "gene_name": "ZBTB7A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25514493", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insight into the TRIAP1/PRELI-like domain family of mitochondrial phospholipid transfer complexes.", "journal": "EMBO reports", "date": "2015", "authors": "Miliara X, Garnett JA, Tatsuta T, Abid Ali F, Baldie H, Perez-Dorado I, Simpson P, Yague E, Langer T, Matthews S", "reference": { "type": "PubMed", "id": "26071602", "url": "https://pubmed.ncbi.nlm.nih.gov/26071602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRQ8-1", "protein_name": "Ferroptosis suppressor protein 1", "gene_name": "AIFM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ4-1", "protein_name": "Apoptosis-stimulating of p53 protein 1", "gene_name": "PPP1R13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAQ5-1", "protein_name": "Zinc finger protein 420", "gene_name": "ZNF420", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07812-1", "protein_name": "Apoptosis regulator BAX", "gene_name": "BAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N28-1", "protein_name": "PRELI domain containing protein 3A", "gene_name": "PRELID3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15350-1", "protein_name": "Tumor protein p73", "gene_name": "TP73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55957-1", "protein_name": "BH3-interacting domain death agonist", "gene_name": "BID", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3D4-1", "protein_name": "Tumor protein 63", "gene_name": "TP63", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43715-1", "protein_name": "TP53-regulated inhibitor of apoptosis 1", "gene_name": "TRIAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13794-1", "protein_name": "Phorbol-12-myristate-13-acetate-induced protein 1", "gene_name": "PMAIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60238-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like", "gene_name": "BNIP3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y255-1", "protein_name": "PRELI domain-containing protein 1, mitochondrial", "gene_name": "PRELID1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q658P3-1", "protein_name": "Metalloreductase STEAP3", "gene_name": "STEAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A56-1", "protein_name": "Tumor protein p53-inducible nuclear protein 1", "gene_name": "TP53INP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60200-1", "protein_name": "Mitochondrial distribution and morphology protein 35", "gene_name": "MDM35", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05776-1", "protein_name": "Protein UPS1, mitochondrial", "gene_name": "UPS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9HCN2-1", "protein_name": "p53-regulated apoptosis-inducing protein 1", "gene_name": "TP53AIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13625-1", "protein_name": "Apoptosis-stimulating of p53 protein 2", "gene_name": "TP53BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 36, "end_pos": 36, "sequence_org": "V", "sequence_mut": "A", "comment": "Impairs interaction with TRIAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q96N28", "url": "https://www.uniprot.org/uniprotkb/Q96N28" }, { "database": "PubMed", "id": "26071602", "url": "https://pubmed.ncbi.nlm.nih.gov/26071602" } ], "uniprot_canonical_ac": "Q96N28-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs interaction with PRELID3A.", "evidence": [ { "database": "UniProtKB", "id": "O43715", "url": "https://www.uniprot.org/uniprotkb/O43715" }, { "database": "PubMed", "id": "26071602", "url": "https://pubmed.ncbi.nlm.nih.gov/26071602" } ], "uniprot_canonical_ac": "O43715-1" }, { "start_pos": 54, "end_pos": 54, "sequence_org": "R", "sequence_mut": "E", "comment": "Decreases phosphatidic acid transfer activity and impairs cardiolipin biosynthesis.", "evidence": [ { "database": "UniProtKB", "id": "Q05776", "url": "https://www.uniprot.org/uniprotkb/Q05776" }, { "database": "PubMed", "id": "26071602", "url": "https://pubmed.ncbi.nlm.nih.gov/26071602" } ], "uniprot_canonical_ac": "Q05776-1" }, { "start_pos": 62, "end_pos": 62, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreases phosphatidic acid binding and impairs cardiolipin biosynthesis; when associated with A-65.", "evidence": [ { "database": "UniProtKB", "id": "Q05776", "url": "https://www.uniprot.org/uniprotkb/Q05776" }, { "database": "PubMed", "id": "26071602", "url": "https://pubmed.ncbi.nlm.nih.gov/26071602" } ], "uniprot_canonical_ac": "Q05776-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreases phosphatidic acid binding and impairs cardiolipin biosynthesis; when associated with A-62.", "evidence": [ { "database": "UniProtKB", "id": "Q05776", "url": "https://www.uniprot.org/uniprotkb/Q05776" }, { "database": "PubMed", "id": "26071602", "url": "https://pubmed.ncbi.nlm.nih.gov/26071602" } ], "uniprot_canonical_ac": "Q05776-1" } ], "record_id": "pubmed.26071602", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel PRD-like homeodomain transcription factors and retrotransposon elements in early human development.", "journal": "Nature communications", "date": "2015-09-11", "authors": "T\u00f6h\u00f6nen Virpi, Katayama Shintaro, Vesterlund Liselotte, Jouhilahti Eeva-Mari, Sheikhi Mona, Madissoon Elo, Filippini-Cattaneo Giuditta, Jaconi Marisa, Johnsson Anna, B\u00fcrglin Thomas R, Linnarsson Sten, Hovatta Outi, Kere Juha", "reference": { "type": "PubMed", "id": "26360614", "url": "https://pubmed.ncbi.nlm.nih.gov/26360614" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26360614", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anti-estrogen Resistance in Human Breast Tumors Is Driven by JAG1-NOTCH4-Dependent Cancer Stem Cell Activity.", "journal": "Cell reports", "date": "2015", "authors": "Simoes BM, O'Brien CS, Eyre R, Silva A, Yu L, Sarmiento-Castro A, Alferez DG, Spence K, Santiago-Gomez A, Chemi F, Acar A, Gandhi A, Howell A, Brennan K, Ryden L, Catalano S, Ando S, Gee J, Ucar A, Sims AH, Marangoni E, Farnie G, Landberg G, Howell SJ, Clarke RB", "reference": { "type": "PubMed", "id": "26387946", "url": "https://pubmed.ncbi.nlm.nih.gov/26387946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99466-1", "protein_name": "Neurogenic locus notch homolog protein 4", "gene_name": "NOTCH4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04721-1", "protein_name": "Neurogenic locus notch homolog protein 2", "gene_name": "NOTCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62736-1", "protein_name": "Actin, aortic smooth muscle", "gene_name": "ACTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35916-2", "protein_name": "Vascular endothelial growth factor receptor 3", "gene_name": "FLT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26387946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NRF2 regulates serine biosynthesis in non-small cell lung cancer.", "journal": "Nature genetics", "date": "2015-12", "authors": "DeNicola Gina M, Chen Pei-Hsuan, Mullarky Edouard, Sudderth Jessica A, Hu Zeping, Wu David, Tang Hao, Xie Yang, Asara John M, Huffman Kenneth E, Wistuba Ignacio I, Minna John D, DeBerardinis Ralph J, Cantley Lewis C", "reference": { "type": "PubMed", "id": "26482881", "url": "https://pubmed.ncbi.nlm.nih.gov/26482881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26482881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Toward Personalized Lymphoma Immunotherapy: Identification of Common Driver Mutations Recognized by Patient CD8+ T Cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2016-05-01", "authors": "Nielsen Julie S, Sedgwick Colin G, Shahid Aniqa, Zong Zusheng, Brumme Zabrina L, Yu Stephen, Liu Lewis, Kroeger David R, Treon Steven P, Connors Joseph M, Gascoyne Randy D, Berry Brian R, Marra Marco A, Morin Ryan D, Macpherson Nicol, Nelson Brad H", "reference": { "type": "PubMed", "id": "26631611", "url": "https://pubmed.ncbi.nlm.nih.gov/26631611" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02080-1", "protein_name": "Myocyte-specific enhancer factor 2B", "gene_name": "MEF2B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26631611", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "microRNA-150 promotes cervical cancer cell growth and survival by targeting FOXO4.", "journal": "BMC molecular biology", "date": "2015", "authors": "Li J, Hu L, Tian C, Lu F, Wu J, Liu L", "reference": { "type": "PubMed", "id": "26715362", "url": "https://pubmed.ncbi.nlm.nih.gov/26715362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23511-1", "protein_name": "Nuclear transcription factor Y subunit alpha", "gene_name": "NFYA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35638-1", "protein_name": "DNA damage-inducible transcript 3 protein", "gene_name": "DDIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99967-1", "protein_name": "Cbp/p300-interacting transactivator 2", "gene_name": "CITED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43521-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "BCL2L11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25208-1", "protein_name": "Nuclear transcription factor Y subunit beta", "gene_name": "NFYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41182-1", "protein_name": "B-cell lymphoma 6 protein", "gene_name": "BCL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13952-1", "protein_name": "Nuclear transcription factor Y subunit gamma", "gene_name": "NFYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM7-1", "protein_name": "Serine/threonine-protein kinase PINK1, mitochondrial", "gene_name": "PINK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26715362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Notch4 Signaling Induces a Mesenchymal-Epithelial-like Transition in Melanoma Cells to Suppress Malignant Behaviors.", "journal": "Cancer research", "date": "2016", "authors": "Bonyadi Rad E, Hammerlindl H, Wels C, Popper U, Ravindran Menon D, Breiteneder H, Kitzwoegerer M, Hafner C, Herlyn M, Bergler H, Schaider H", "reference": { "type": "PubMed", "id": "26801977", "url": "https://pubmed.ncbi.nlm.nih.gov/26801977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99466-1", "protein_name": "Neurogenic locus notch homolog protein 4", "gene_name": "NOTCH4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04721-1", "protein_name": "Neurogenic locus notch homolog protein 2", "gene_name": "NOTCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62736-1", "protein_name": "Actin, aortic smooth muscle", "gene_name": "ACTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35916-2", "protein_name": "Vascular endothelial growth factor receptor 3", "gene_name": "FLT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26801977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DUX4 recruits p300/CBP through its C-terminus and induces global H3K27 acetylation changes.", "journal": "Nucleic Acids Res.", "date": "2016", "authors": "Choi SH, Gearhart MD, Cui Z, Bosnakovski D, Kim M, Schennum N, Kyba M", "reference": { "type": "PubMed", "id": "26951377", "url": "https://pubmed.ncbi.nlm.nih.gov/26951377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 159, "end_pos": 326, "sequence_org": "QAGGLCSAAPGGGHPAPSWVAFAHTGAWGTGLPAPHVPCAPGALPQGAFVSQAARAAPALQPSQAAPAEGISQPAPARGDFAYAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGPCAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQ", "sequence_mut": "", "comment": "No effect on activity as transcriptional activator.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBX2", "url": "https://www.uniprot.org/uniprotkb/Q9UBX2" }, { "database": "PubMed", "id": "26951377", "url": "https://pubmed.ncbi.nlm.nih.gov/26951377" } ], "uniprot_canonical_ac": "Q9UBX2-1" }, { "start_pos": 159, "end_pos": 371, "sequence_org": "QAGGLCSAAPGGGHPAPSWVAFAHTGAWGTGLPAPHVPCAPGALPQGAFVSQAARAAPALQPSQAAPAEGISQPAPARGDFAYAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGPCAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCG", "sequence_mut": "", "comment": "Decreased activity as transcriptional activator.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBX2", "url": "https://www.uniprot.org/uniprotkb/Q9UBX2" }, { "database": "PubMed", "id": "26951377", "url": "https://pubmed.ncbi.nlm.nih.gov/26951377" } ], "uniprot_canonical_ac": "Q9UBX2-1" }, { "start_pos": 327, "end_pos": 424, "sequence_org": "AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL", "sequence_mut": "", "comment": "Loss of interaction with EP300 and CREBBP.", "evidence": [ { "database": "UniProtKB", "id": "Q9UBX2", "url": "https://www.uniprot.org/uniprotkb/Q9UBX2" }, { "database": "PubMed", "id": "26951377", "url": "https://pubmed.ncbi.nlm.nih.gov/26951377" } ], "uniprot_canonical_ac": "Q9UBX2-1" } ], "record_id": "pubmed.26951377", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Single-Cell RNA-Seq Reveals Lineage and X Chromosome Dynamics in Human Preimplantation Embryos.", "journal": "Cell", "date": "2016-05-05", "authors": "Petropoulos Sophie, Edsg\u00e4rd Daniel, Reinius Bj\u00f6rn, Deng Qiaolin, Panula Sarita Pauliina, Codeluppi Simone, Plaza Reyes Alvaro, Linnarsson Sten, Sandberg Rickard, Lanner Fredrik", "reference": { "type": "PubMed", "id": "27062923", "url": "https://pubmed.ncbi.nlm.nih.gov/27062923" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27062923", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bilirubin Binding to PPARalpha Inhibits Lipid Accumulation.", "journal": "PloS one", "date": "2016", "authors": "Stec DE, John K, Trabbic CJ, Luniwal A, Hankins MW, Baum J, Hinds TD Jr", "reference": { "type": "PubMed", "id": "27071062", "url": "https://pubmed.ncbi.nlm.nih.gov/27071062" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27071062", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of Nrf2/HO-1 system in development, oxidative stress response and diseases: an evolutionarily conserved mechanism.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Loboda A, Damulewicz M, Pyza E, Jozkowicz A, Dulak J", "reference": { "type": "PubMed", "id": "27100828", "url": "https://pubmed.ncbi.nlm.nih.gov/27100828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27100828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The biochemical pharmacology of fenofibrate.", "journal": "Cardiology", "date": "1989", "authors": "Caldwell J", "reference": { "type": "PubMed", "id": "2713875", "url": "https://pubmed.ncbi.nlm.nih.gov/2713875" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2713875", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AMPK Facilitates Nuclear Accumulation of Nrf2 by Phosphorylating at Serine 550.", "journal": "Molecular and cellular biology", "date": "2016", "authors": "Joo MS, Kim WD, Lee KY, Kim JH, Koo JH, Kim SG", "reference": { "type": "PubMed", "id": "27161318", "url": "https://pubmed.ncbi.nlm.nih.gov/27161318" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60795-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "Nfe2l2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13501-1", "protein_name": "Sequestosome-1", "gene_name": "SQSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15525-1", "protein_name": "Transcription factor MafG", "gene_name": "MAFG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14145-1", "protein_name": "Kelch-like ECH-associated protein 1", "gene_name": "KEAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 550, "end_pos": 550, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q60795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60795" }, { "database": "PubMed", "id": "27161318", "url": "https://pubmed.ncbi.nlm.nih.gov/27161318" } ], "site_lbl": "Ser550", "uniprot_canonical_ac": "Q60795-1" }, { "start_pos": 558, "end_pos": 558, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q60795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q60795" }, { "database": "PubMed", "id": "27161318", "url": "https://pubmed.ncbi.nlm.nih.gov/27161318" } ], "site_lbl": "Ser558", "uniprot_canonical_ac": "Q60795-1" } ], "record_id": "pubmed.27161318", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2016", "authors": "Zhao B, Shu C, Gao X, Sankaran B, Du F, Shelton CL, Herr AB, Ji JY, Li P", "reference": { "type": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 358, "end_pos": 358, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreased phosphorylation by TBK1, leading to reduced ability to activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "18818105", "url": "https://pubmed.ncbi.nlm.nih.gov/18818105" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" }, { "database": "PubMed", "id": "29478775", "url": "https://pubmed.ncbi.nlm.nih.gov/29478775" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 362, "end_pos": 362, "sequence_org": "E", "sequence_mut": "A", "comment": "Slightly affects ability to induce the production of type I interferon.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 363, "end_pos": 363, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolished ability to induce the production of type I interferon.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 364, "end_pos": 364, "sequence_org": "L", "sequence_mut": "A", "comment": "Slightly affects ability to induce the production of type I interferon.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 365, "end_pos": 365, "sequence_org": "I", "sequence_mut": "A", "comment": "Abolished ability to induce the production of type I interferon.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 366, "end_pos": 366, "sequence_org": "S", "sequence_mut": "A", "comment": "Induces a decrease in phosphorylation by TBK1. Abolished ability to activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 366, "end_pos": 366, "sequence_org": "S", "sequence_mut": "C", "comment": "Induces a decrease in phosphorylation by TBK1. Abolished ability to activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 366, "end_pos": 366, "sequence_org": "S", "sequence_mut": "N", "comment": "Induces a decrease in phosphorylation by TBK1. Abolished ability to activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 376, "end_pos": 376, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect ability to activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 379, "end_pos": 379, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect ability to activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 285, "end_pos": 285, "sequence_org": "R", "sequence_mut": "S", "comment": "Abolished interaction with STING1, MAVS or TICAM1.", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 288, "end_pos": 288, "sequence_org": "H", "sequence_mut": "S", "comment": "Decreased interaction with TICAM1.", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 290, "end_pos": 290, "sequence_org": "H", "sequence_mut": "S", "comment": "Decreased interaction with TICAM1.", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 313, "end_pos": 313, "sequence_org": "K", "sequence_mut": "S", "comment": "Abolished interaction with STING1, MAVS or TICAM1.", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 386, "end_pos": 386, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant; interacts with CREBBP; when associated with E-396.", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 396, "end_pos": 396, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant; interacts with CREBBP; when associated with E-386.", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 442, "end_pos": 442, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished ability to bind and activate IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "uniprot_canonical_ac": "Q7Z434-1" }, { "start_pos": 202, "end_pos": 202, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreased interaction with IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q8IUC6-1" }, { "start_pos": 210, "end_pos": 210, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished interaction with IRF3.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" } ], "uniprot_canonical_ac": "Q8IUC6-1" } ], "phosphorylation": [ { "start_pos": 366, "end_pos": 366, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q86WV6", "url": "https://www.uniprot.org/uniprotkb/Q86WV6" }, { "database": "iPTMnet", "id": "Q86WV6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86WV6" }, { "database": "PubMed", "id": "29491158", "url": "https://pubmed.ncbi.nlm.nih.gov/29491158" }, { "database": "PubMed", "id": "30321235", "url": "https://pubmed.ncbi.nlm.nih.gov/30321235" }, { "database": "PubMed", "id": "32582856", "url": "https://pubmed.ncbi.nlm.nih.gov/32582856" }, { "database": "PubMed", "id": "32690950", "url": "https://pubmed.ncbi.nlm.nih.gov/32690950" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "32753499", "url": "https://pubmed.ncbi.nlm.nih.gov/32753499" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "site_lbl": "Ser366", "uniprot_canonical_ac": "Q86WV6-1" }, { "start_pos": 386, "end_pos": 386, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "9463386", "url": "https://pubmed.ncbi.nlm.nih.gov/9463386" }, { "database": "PRO", "id": "Q14653", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14653" }, { "database": "PubMed", "id": "10805757", "url": "https://pubmed.ncbi.nlm.nih.gov/10805757" }, { "database": "PubMed", "id": "10920266", "url": "https://pubmed.ncbi.nlm.nih.gov/10920266" }, { "database": "PubMed", "id": "17526488", "url": "https://pubmed.ncbi.nlm.nih.gov/17526488" }, { "database": "PubMed", "id": "20170763", "url": "https://pubmed.ncbi.nlm.nih.gov/20170763" }, { "database": "PubMed", "id": "20532218", "url": "https://pubmed.ncbi.nlm.nih.gov/20532218" }, { "database": "PubMed", "id": "21347389", "url": "https://pubmed.ncbi.nlm.nih.gov/21347389" }, { "database": "PubMed", "id": "23746807", "url": "https://pubmed.ncbi.nlm.nih.gov/23746807" }, { "database": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, { "database": "PubMed", "id": "24752990", "url": "https://pubmed.ncbi.nlm.nih.gov/24752990" }, { "database": "PubMed", "id": "25506707", "url": "https://pubmed.ncbi.nlm.nih.gov/25506707" }, { "database": "PubMed", "id": "26216125", "url": "https://pubmed.ncbi.nlm.nih.gov/26216125" }, { "database": "PubMed", "id": "26646986", "url": "https://pubmed.ncbi.nlm.nih.gov/26646986" }, { "database": "PubMed", "id": "26811330", "url": "https://pubmed.ncbi.nlm.nih.gov/26811330" }, { "database": "PubMed", "id": "27045107", "url": "https://pubmed.ncbi.nlm.nih.gov/27045107" }, { "database": "PubMed", "id": "27454487", "url": "https://pubmed.ncbi.nlm.nih.gov/27454487" }, { "database": "PubMed", "id": "28295920", "url": "https://pubmed.ncbi.nlm.nih.gov/28295920" }, { "database": "PubMed", "id": "28465426", "url": "https://pubmed.ncbi.nlm.nih.gov/28465426" }, { "database": "PubMed", "id": "28589097", "url": "https://pubmed.ncbi.nlm.nih.gov/28589097" }, { "database": "PubMed", "id": "29962372", "url": "https://pubmed.ncbi.nlm.nih.gov/29962372" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "32161340", "url": "https://pubmed.ncbi.nlm.nih.gov/32161340" }, { "database": "PubMed", "id": "33205822", "url": "https://pubmed.ncbi.nlm.nih.gov/33205822" }, { "database": "PubMed", "id": "33300875", "url": "https://pubmed.ncbi.nlm.nih.gov/33300875" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "36603579", "url": "https://pubmed.ncbi.nlm.nih.gov/36603579" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" } ], "site_lbl": "Ser386", "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE and TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "12524442", "url": "https://pubmed.ncbi.nlm.nih.gov/12524442" }, { "database": "PRO", "id": "Q14653", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14653" }, { "database": "PubMed", "id": "17761676", "url": "https://pubmed.ncbi.nlm.nih.gov/17761676" }, { "database": "PubMed", "id": "18356163", "url": "https://pubmed.ncbi.nlm.nih.gov/18356163" }, { "database": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" }, { "database": "PubMed", "id": "20161788", "url": "https://pubmed.ncbi.nlm.nih.gov/20161788" }, { "database": "PubMed", "id": "20170763", "url": "https://pubmed.ncbi.nlm.nih.gov/20170763" }, { "database": "PubMed", "id": "20416917", "url": "https://pubmed.ncbi.nlm.nih.gov/20416917" }, { "database": "PubMed", "id": "20511230", "url": "https://pubmed.ncbi.nlm.nih.gov/20511230" }, { "database": "PubMed", "id": "20532218", "url": "https://pubmed.ncbi.nlm.nih.gov/20532218" }, { "database": "PubMed", "id": "20609418", "url": "https://pubmed.ncbi.nlm.nih.gov/20609418" }, { "database": "PubMed", "id": "20694008", "url": "https://pubmed.ncbi.nlm.nih.gov/20694008" }, { "database": "PubMed", "id": "21347389", "url": "https://pubmed.ncbi.nlm.nih.gov/21347389" }, { "database": "PubMed", "id": "23090018", "url": "https://pubmed.ncbi.nlm.nih.gov/23090018" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, { "database": "PubMed", "id": "24870145", "url": "https://pubmed.ncbi.nlm.nih.gov/24870145" }, { "database": "PubMed", "id": "25444175", "url": "https://pubmed.ncbi.nlm.nih.gov/25444175" }, { "database": "PubMed", "id": "25891802", "url": "https://pubmed.ncbi.nlm.nih.gov/25891802" }, { "database": "PubMed", "id": "25923723", "url": "https://pubmed.ncbi.nlm.nih.gov/25923723" }, { "database": "PubMed", "id": "26811330", "url": "https://pubmed.ncbi.nlm.nih.gov/26811330" }, { "database": "PubMed", "id": "27576490", "url": "https://pubmed.ncbi.nlm.nih.gov/27576490" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "28150813", "url": "https://pubmed.ncbi.nlm.nih.gov/28150813" }, { "database": "PubMed", "id": "28589097", "url": "https://pubmed.ncbi.nlm.nih.gov/28589097" }, { "database": "PubMed", "id": "28717003", "url": "https://pubmed.ncbi.nlm.nih.gov/28717003" }, { "database": "PubMed", "id": "29677136", "url": "https://pubmed.ncbi.nlm.nih.gov/29677136" }, { "database": "PubMed", "id": "29962372", "url": "https://pubmed.ncbi.nlm.nih.gov/29962372" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30867315", "url": "https://pubmed.ncbi.nlm.nih.gov/30867315" }, { "database": "PubMed", "id": "31618847", "url": "https://pubmed.ncbi.nlm.nih.gov/31618847" }, { "database": "PubMed", "id": "31686982", "url": "https://pubmed.ncbi.nlm.nih.gov/31686982" }, { "database": "PubMed", "id": "32179480", "url": "https://pubmed.ncbi.nlm.nih.gov/32179480" }, { "database": "PubMed", "id": "32634441", "url": "https://pubmed.ncbi.nlm.nih.gov/32634441" }, { "database": "PubMed", "id": "32783398", "url": "https://pubmed.ncbi.nlm.nih.gov/32783398" }, { "database": "PubMed", "id": "33253291", "url": "https://pubmed.ncbi.nlm.nih.gov/33253291" }, { "database": "PubMed", "id": "33300875", "url": "https://pubmed.ncbi.nlm.nih.gov/33300875" }, { "database": "PubMed", "id": "33391252", "url": "https://pubmed.ncbi.nlm.nih.gov/33391252" }, { "database": "PubMed", "id": "33603735", "url": "https://pubmed.ncbi.nlm.nih.gov/33603735" }, { "database": "PubMed", "id": "33986734", "url": "https://pubmed.ncbi.nlm.nih.gov/33986734" }, { "database": "PubMed", "id": "23478265", "url": "https://pubmed.ncbi.nlm.nih.gov/23478265" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "36603579", "url": "https://pubmed.ncbi.nlm.nih.gov/36603579" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" } ], "site_lbl": "Ser396", "uniprot_canonical_ac": "Q14653-1" }, { "start_pos": 442, "end_pos": 442, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "iPTMnet", "id": "Q7Z434", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q7Z434" }, { "database": "PubMed", "id": "33205822", "url": "https://pubmed.ncbi.nlm.nih.gov/33205822" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "site_lbl": "Ser442", "uniprot_canonical_ac": "Q7Z434-1" }, { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "iPTMnet", "id": "Q8IUC6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IUC6" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "25636800", "url": "https://pubmed.ncbi.nlm.nih.gov/25636800" } ], "site_lbl": "Ser210", "uniprot_canonical_ac": "Q8IUC6-1" } ], "record_id": "pubmed.27302953", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CREBBP mutations in individuals without Rubinstein-Taybi syndrome phenotype.", "journal": "American journal of medical genetics. Part A", "date": "2016", "authors": "Menke LA, van Belzen MJ, Alders M, Cristofoli F, Ehmke N, Fergelot P, Foster A, Gerkes EH, Hoffer MJ, Horn D, Kant SG, Lacombe D, Leon E, Maas SM, Melis D, Muto V, Park SM, Peeters H, Peters DJ, Pfundt R, van Ravenswaaij-Arts CM, Tartaglia M, Hennekam RC", "reference": { "type": "PubMed", "id": "27311832", "url": "https://pubmed.ncbi.nlm.nih.gov/27311832" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27311832", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insulin Downregulates the Transcriptional Coregulator CITED2, an Inhibitor of Proangiogenic Function in Endothelial Cells.", "journal": "Diabetes", "date": "2016", "authors": "Wang X, Lockhart SM, Rathjen T, Albadawi H, Sorensen D, O'Neill BT, Dwivedi N, Preil SR, Beck HC, Dunwoodie SL, Watkins MT, Rasmussen LM, Rask-Madsen C", "reference": { "type": "PubMed", "id": "27561725", "url": "https://pubmed.ncbi.nlm.nih.gov/27561725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23511-1", "protein_name": "Nuclear transcription factor Y subunit alpha", "gene_name": "NFYA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35638-1", "protein_name": "DNA damage-inducible transcript 3 protein", "gene_name": "DDIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99967-1", "protein_name": "Cbp/p300-interacting transactivator 2", "gene_name": "CITED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43521-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "BCL2L11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25208-1", "protein_name": "Nuclear transcription factor Y subunit beta", "gene_name": "NFYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41182-1", "protein_name": "B-cell lymphoma 6 protein", "gene_name": "BCL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13952-1", "protein_name": "Nuclear transcription factor Y subunit gamma", "gene_name": "NFYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM7-1", "protein_name": "Serine/threonine-protein kinase PINK1, mitochondrial", "gene_name": "PINK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27561725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peroxiredoxin 1 - an antioxidant enzyme in cancer.", "journal": "Journal of cellular and molecular medicine", "date": "2017", "authors": "Ding C, Fan X, Wu G", "reference": { "type": "PubMed", "id": "27653015", "url": "https://pubmed.ncbi.nlm.nih.gov/27653015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27653015", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PlexinD1 Is a Novel Transcriptional Target and Effector of Notch Signaling in Cancer Cells.", "journal": "PloS one", "date": "2016", "authors": "Rehman M, Gurrapu S, Cagnoni G, Capparuccia L, Tamagnone L", "reference": { "type": "PubMed", "id": "27749937", "url": "https://pubmed.ncbi.nlm.nih.gov/27749937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM47-1", "protein_name": "Neurogenic locus notch homolog protein 3", "gene_name": "NOTCH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4D7-1", "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IX03-1", "protein_name": "Protein KIBRA", "gene_name": "WWC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15398-2", "protein_name": "Disks large-associated protein 5", "gene_name": "DLGAP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15540-1", "protein_name": "Fatty acid-binding protein, brain", "gene_name": "FABP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40424-1", "protein_name": "Pre-B-cell leukemia transcription factor 1", "gene_name": "PBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ87-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif-like protein", "gene_name": "HEYL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ISU1-1", "protein_name": "Pre T-cell antigen receptor alpha", "gene_name": "PTCRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27749937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel putative interaction partner of the nucleoporin ALADIN.", "journal": "Biology open", "date": "2016", "authors": "Juhlen R, Landgraf D, Huebner A, Koehler K", "reference": { "type": "PubMed", "id": "27754849", "url": "https://pubmed.ncbi.nlm.nih.gov/27754849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58742-1", "protein_name": "Aladin", "gene_name": "Aaas", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27754849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of peroxiredoxin 1 in redox sensing and transducing.", "journal": "Archives of biochemistry and biophysics", "date": "2017", "authors": "Ledgerwood EC, Marshall JW, Weijman JF", "reference": { "type": "PubMed", "id": "27756681", "url": "https://pubmed.ncbi.nlm.nih.gov/27756681" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27756681", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Notch3 inhibits epithelial-mesenchymal transition by activating Kibra-mediated Hippo/YAP signaling in breast cancer epithelial cells.", "journal": "Oncogenesis", "date": "2016", "authors": "Zhang X, Liu X, Luo J, Xiao W, Ye X, Chen M, Li Y, Zhang GJ", "reference": { "type": "PubMed", "id": "27841855", "url": "https://pubmed.ncbi.nlm.nih.gov/27841855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM47-1", "protein_name": "Neurogenic locus notch homolog protein 3", "gene_name": "NOTCH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4D7-1", "protein_name": "Plexin-D1", "gene_name": "PLXND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IX03-1", "protein_name": "Protein KIBRA", "gene_name": "WWC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15398-2", "protein_name": "Disks large-associated protein 5", "gene_name": "DLGAP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15540-1", "protein_name": "Fatty acid-binding protein, brain", "gene_name": "FABP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40424-1", "protein_name": "Pre-B-cell leukemia transcription factor 1", "gene_name": "PBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ87-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif-like protein", "gene_name": "HEYL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ISU1-1", "protein_name": "Pre T-cell antigen receptor alpha", "gene_name": "PTCRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27841855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ligand and Target Discovery by Fragment-Based Screening in Human Cells.", "journal": "Cell", "date": "2017", "authors": "Parker CG, Galmozzi A, Wang Y, Correia BE, Sasaki K, Joslyn CM, Kim AS, Cavallaro CL, Lawrence RM, Johnson SR, Narvaiza I, Saez E, Cravatt BF", "reference": { "type": "PubMed", "id": "28111073", "url": "https://pubmed.ncbi.nlm.nih.gov/28111073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28111073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ABCF2, an Nrf2 target gene, contributes to cisplatin resistance in ovarian cancer cells.", "journal": "Molecular carcinogenesis", "date": "2017", "authors": "Bao L, Wu J, Dodson M, Rojo de la Vega EM, Ning Y, Zhang Z, Yao M, Zhang DD, Xu C, Yi X", "reference": { "type": "PubMed", "id": "28112439", "url": "https://pubmed.ncbi.nlm.nih.gov/28112439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UG63-1", "protein_name": "ATP-binding cassette sub-family F member 2", "gene_name": "ABCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15438-1", "protein_name": "ATP-binding cassette sub-family C member 3", "gene_name": "ABCC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28112439", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA helicase DDX3 maintains lipid homeostasis through upregulation of the microsomal triglyceride transfer protein by interacting with HNF4 and SHP.", "journal": "Sci. Rep.", "date": "2017", "authors": "Tsai TY, Wang WT, Li HK, Chen WJ, Tsai YH, Chao CH, Wu Lee YH", "reference": { "type": "PubMed", "id": "28128295", "url": "https://pubmed.ncbi.nlm.nih.gov/28128295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41235-1", "protein_name": "Hepatocyte nuclear factor 4-alpha", "gene_name": "HNF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00571-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "DDX3X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15466-1", "protein_name": "Nuclear receptor subfamily 0 group B member 2", "gene_name": "NR0B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 382, "end_pos": 384, "sequence_org": "SAT", "sequence_mut": "AAA", "comment": "Loss of RNA helicase, but not ATPase activity; no effect on the repression of cap- and IRES-dependent translation, WNT/beta catenin signaling, up-regulation of CDKN1A promoter activity, HNF4A-mediated MTTP transcriptional activation, nor on stress granule assembly.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "17667941", "url": "https://pubmed.ncbi.nlm.nih.gov/17667941" }, { "database": "PubMed", "id": "23413191", "url": "https://pubmed.ncbi.nlm.nih.gov/23413191" }, { "database": "PubMed", "id": "21883093", "url": "https://pubmed.ncbi.nlm.nih.gov/21883093" }, { "database": "PubMed", "id": "28128295", "url": "https://pubmed.ncbi.nlm.nih.gov/28128295" } ], "uniprot_canonical_ac": "O00571-1" } ], "record_id": "pubmed.28128295", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DUX-family transcription factors regulate zygotic genome activation in placental mammals.", "journal": "Nature genetics", "date": "2017-06", "authors": "De Iaco Alberto, Planet Evarist, Coluccio Andrea, Verp Sonia, Duc Julien, Trono Didier", "reference": { "type": "PubMed", "id": "28459456", "url": "https://pubmed.ncbi.nlm.nih.gov/28459456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28459456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conserved roles of mouse DUX and human DUX4 in activating cleavage-stage genes and MERVL/HERVL retrotransposons.", "journal": "Nature genetics", "date": "2017-06", "authors": "Hendrickson Peter G, Dor\u00e1is Jessie A, Grow Edward J, Whiddon Jennifer L, Lim Jong-Won, Wike Candice L, Weaver Bradley D, Pflueger Christian, Emery Benjamin R, Wilcox Aaron L, Nix David A, Peterson C Matthew, Tapscott Stephen J, Carrell Douglas T, Cairns Bradley R", "reference": { "type": "PubMed", "id": "28459457", "url": "https://pubmed.ncbi.nlm.nih.gov/28459457" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28459457", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ATP-dependent chromatin remodeling enzymes CHD6, CHD7, and CHD8 exhibit distinct nucleosome binding and remodeling activities.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Manning BJ, Yusufzai T", "reference": { "type": "PubMed", "id": "28533432", "url": "https://pubmed.ncbi.nlm.nih.gov/28533432" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Z6-1", "protein_name": "Protein FAM124B", "gene_name": "FAM124B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13330-1", "protein_name": "Metastasis-associated protein MTA1", "gene_name": "MTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCK8-1", "protein_name": "ATP-dependent chromatin remodeler CHD8", "gene_name": "CHD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YP4-1", "protein_name": "Transcriptional repressor p66-alpha", "gene_name": "GATAD2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUJ5-1", "protein_name": "PWWP domain-containing protein 2B", "gene_name": "PWWP2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75956-1", "protein_name": "Cyclin-dependent kinase 2-associated protein 2", "gene_name": "CDK2AP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU2-1", "protein_name": "Dickkopf-related protein 2", "gene_name": "DKK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95983-1", "protein_name": "Methyl-CpG-binding domain protein 3", "gene_name": "MBD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14839-1", "protein_name": "ATP-dependent chromatin remodeler CHD4", "gene_name": "CHD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDI0-1", "protein_name": "ATP-dependent chromatin remodeler CHD5", "gene_name": "CHD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969F2-1", "protein_name": "Protein naked cuticle homolog 2", "gene_name": "NKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49711-1", "protein_name": "Transcriptional repressor CTCF", "gene_name": "CTCF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHZ7-1", "protein_name": "Methyl-CpG-binding domain protein 3-like 2", "gene_name": "MBD3L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63279-1", "protein_name": "SUMO-conjugating enzyme UBC9", "gene_name": "UBE2I", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T1-1", "protein_name": "Axin-2", "gene_name": "AXIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63165-1", "protein_name": "Small ubiquitin-related modifier 1", "gene_name": "SUMO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12873-1", "protein_name": "ATP-dependent chromatin remodeler CHD3", "gene_name": "CHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94776-1", "protein_name": "Metastasis-associated protein MTA2", "gene_name": "MTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTC8-1", "protein_name": "Metastasis-associated protein MTA3", "gene_name": "MTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWY6-1", "protein_name": "Methyl-CpG-binding domain protein 3-like 1", "gene_name": "MBD3L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N64-1", "protein_name": "PWWP domain-containing protein 2A", "gene_name": "PWWP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14519-1", "protein_name": "Cyclin-dependent kinase 2-associated protein 1", "gene_name": "CDK2AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2D1-1", "protein_name": "ATP-dependent chromatin remodeler CHD7", "gene_name": "CHD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01344-1", "protein_name": "Insulin-like growth factor 2", "gene_name": "IGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBB5-1", "protein_name": "Methyl-CpG-binding domain protein 2", "gene_name": "MBD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXI9-1", "protein_name": "Transcriptional repressor p66-beta", "gene_name": "GATAD2B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28533432", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 67 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of CO-bound cytochrome c oxidase determined by serial femtosecond X-ray crystallography at room temperature.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Ishigami I, Zatsepin NA, Hikita M, Conrad CE, Nelson G, Coe JD, Basu S, Grant TD, Seaberg MH, Sierra RG, Hunter MS, Fromme P, Fromme R, Yeh SR, Rousseau DL", "reference": { "type": "PubMed", "id": "28698372", "url": "https://pubmed.ncbi.nlm.nih.gov/28698372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P99999-1", "protein_name": "Cytochrome c", "gene_name": "CYCS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20674-1", "protein_name": "Cytochrome c oxidase subunit 5A, mitochondrial", "gene_name": "COX5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13073-1", "protein_name": "Cytochrome c oxidase subunit 4 isoform 1, mitochondrial", "gene_name": "COX4I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15954-1", "protein_name": "Cytochrome c oxidase subunit 7C, mitochondrial", "gene_name": "COX7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4L0-1", "protein_name": "Cytochrome c oxidase subunit 8C, mitochondrial", "gene_name": "COX8C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09669-1", "protein_name": "Cytochrome c oxidase subunit 6C", "gene_name": "COX6C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGK3-1", "protein_name": "Signal-transducing adaptor protein 2", "gene_name": "STAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MV81-1", "protein_name": "HIG1 domain family member 1C", "gene_name": "HIGD1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00483-1", "protein_name": "Cytochrome c oxidase subunit FA4", "gene_name": "COXFA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53004-1", "protein_name": "Biliverdin reductase A", "gene_name": "BLVRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14406-1", "protein_name": "Cytochrome c oxidase subunit 7A2, mitochondrial", "gene_name": "COX7A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24310-1", "protein_name": "Cytochrome c oxidase subunit 7A1, mitochondrial", "gene_name": "COX7A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24311-1", "protein_name": "Cytochrome c oxidase subunit 7B, mitochondrial", "gene_name": "COX7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6YFQ2-1", "protein_name": "Cytochrome c oxidase subunit 6B2", "gene_name": "COX6B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3M7-1", "protein_name": "Thioredoxin-interacting protein", "gene_name": "TXNIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00395-1", "protein_name": "Cytochrome c oxidase subunit 1", "gene_name": "MT-CO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00414-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "MT-CO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KJ9-1", "protein_name": "Cytochrome c oxidase subunit 4 isoform 2, mitochondrial", "gene_name": "COX4I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14548-1", "protein_name": "Cytochrome c oxidase subunit 7A2-like, mitochondrial", "gene_name": "COX7A2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02221-1", "protein_name": "Cytochrome c oxidase subunit 6A2, mitochondrial", "gene_name": "COX6A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00403-1", "protein_name": "Cytochrome c oxidase subunit 2", "gene_name": "MT-CO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10176-1", "protein_name": "Cytochrome c oxidase subunit 8A, mitochondrial", "gene_name": "COX8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12074-1", "protein_name": "Cytochrome c oxidase subunit 6A1, mitochondrial", "gene_name": "COX6A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14854-1", "protein_name": "Cytochrome c oxidase subunit 6B1", "gene_name": "COX6B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10606-1", "protein_name": "Cytochrome c oxidase subunit 5B, mitochondrial", "gene_name": "COX5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30043-1", "protein_name": "Flavin reductase (NADPH)", "gene_name": "BLVRB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30519-1", "protein_name": "Heme oxygenase 2", "gene_name": "HMOX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28698372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SIRT7 and the DEAD-box helicase DDX21 cooperate to resolve genomic R loops and safeguard genome stability.", "journal": "Genes & development", "date": "2017", "authors": "Song C, Hotz-Wagenblatt A, Voit R, Grummt I", "reference": { "type": "PubMed", "id": "28790157", "url": "https://pubmed.ncbi.nlm.nih.gov/28790157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR30-1", "protein_name": "Nucleolar RNA helicase 2", "gene_name": "DDX21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC8-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-7", "gene_name": "SIRT7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 137, "end_pos": 137, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation; impaired ability to resolve R-loops; when associated with Q-18 and Q-600.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR30", "url": "https://www.uniprot.org/uniprotkb/Q9NR30" }, { "database": "PubMed", "id": "28790157", "url": "https://pubmed.ncbi.nlm.nih.gov/28790157" } ], "uniprot_canonical_ac": "Q9NR30-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation; impaired ability to resolve R-loops; when associated with Q-137 and Q-600.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR30", "url": "https://www.uniprot.org/uniprotkb/Q9NR30" }, { "database": "PubMed", "id": "28790157", "url": "https://pubmed.ncbi.nlm.nih.gov/28790157" } ], "uniprot_canonical_ac": "Q9NR30-1" }, { "start_pos": 339, "end_pos": 340, "sequence_org": "DE", "sequence_mut": "HG", "comment": "In mutant DEV; loss of helicase activity. Defects in release of P-TEFb from inhibitory 7SK snRNP.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR30", "url": "https://www.uniprot.org/uniprotkb/Q9NR30" }, { "database": "PubMed", "id": "9461305", "url": "https://pubmed.ncbi.nlm.nih.gov/9461305" }, { "database": "PubMed", "id": "25470060", "url": "https://pubmed.ncbi.nlm.nih.gov/25470060" }, { "database": "PubMed", "id": "28790157", "url": "https://pubmed.ncbi.nlm.nih.gov/28790157" } ], "uniprot_canonical_ac": "Q9NR30-1" }, { "start_pos": 375, "end_pos": 376, "sequence_org": "SA", "sequence_mut": "LE", "comment": "In mutant SAT; ATPase defective. Defects in release of P-TEFb from inhibitory 7SK snRNP.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR30", "url": "https://www.uniprot.org/uniprotkb/Q9NR30" }, { "database": "PubMed", "id": "9461305", "url": "https://pubmed.ncbi.nlm.nih.gov/9461305" }, { "database": "PubMed", "id": "25470060", "url": "https://pubmed.ncbi.nlm.nih.gov/25470060" }, { "database": "PubMed", "id": "28790157", "url": "https://pubmed.ncbi.nlm.nih.gov/28790157" } ], "uniprot_canonical_ac": "Q9NR30-1" }, { "start_pos": 600, "end_pos": 600, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation; impaired ability to resolve R-loops; when associated with Q-18 and Q-137.", "evidence": [ { "database": "UniProtKB", "id": "Q9NR30", "url": "https://www.uniprot.org/uniprotkb/Q9NR30" }, { "database": "PubMed", "id": "28790157", "url": "https://pubmed.ncbi.nlm.nih.gov/28790157" } ], "uniprot_canonical_ac": "Q9NR30-1" } ], "record_id": "pubmed.28790157", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NRF2 Is a Major Target of ARF in p53-Independent Tumor Suppression.", "journal": "Molecular cell", "date": "2017", "authors": "Chen D, Tavana O, Chu B, Erber L, Chen Y, Baer R, Gu W", "reference": { "type": "PubMed", "id": "28985506", "url": "https://pubmed.ncbi.nlm.nih.gov/28985506" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13501-1", "protein_name": "Sequestosome-1", "gene_name": "SQSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15525-1", "protein_name": "Transcription factor MafG", "gene_name": "MAFG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14145-1", "protein_name": "Kelch-like ECH-associated protein 1", "gene_name": "KEAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28985506", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The NOTCH4-HEY1 Pathway Induces Epithelial-Mesenchymal Transition in Head and Neck Squamous Cell Carcinoma.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2018", "authors": "Fukusumi T, Guo TW, Sakai A, Ando M, Ren S, Haft S, Liu C, Amornphimoltham P, Gutkind JS, Califano JA", "reference": { "type": "PubMed", "id": "29146722", "url": "https://pubmed.ncbi.nlm.nih.gov/29146722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TA89-1", "protein_name": "Transcription factor HES-5", "gene_name": "HES5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99466-1", "protein_name": "Neurogenic locus notch homolog protein 4", "gene_name": "NOTCH4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04721-1", "protein_name": "Neurogenic locus notch homolog protein 2", "gene_name": "NOTCH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46531-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "NOTCH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06330-1", "protein_name": "Recombining binding protein suppressor of hairless", "gene_name": "RBPJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZL2-1", "protein_name": "Mastermind-like protein 2", "gene_name": "MAML2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92830-1", "protein_name": "Histone acetyltransferase KAT2A", "gene_name": "KAT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JK9-1", "protein_name": "Mastermind-like protein 3", "gene_name": "MAML3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62736-1", "protein_name": "Actin, aortic smooth muscle", "gene_name": "ACTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35916-2", "protein_name": "Vascular endothelial growth factor receptor 3", "gene_name": "FLT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP5-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 2", "gene_name": "HEY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5J3-1", "protein_name": "Hairy/enhancer-of-split related with YRPW motif protein 1", "gene_name": "HEY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14469-1", "protein_name": "Transcription factor HES-1", "gene_name": "HES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13495-1", "protein_name": "Mastermind-like domain-containing protein 1", "gene_name": "MAMLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92585-1", "protein_name": "Mastermind-like protein 1", "gene_name": "MAML1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29146722", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Further delineation of an entity caused by CREBBP and EP300 mutations but not resembling Rubinstein-Taybi syndrome.", "journal": "American journal of medical genetics. Part A", "date": "2018", "authors": "Menke LA, Gardeitchik T, Hammond P, Heimdal KR, Houge G, Hufnagel SB, Ji J, Johansson S, Kant SG, Kinning E, Leon EL, Newbury-Ecob R, Paolacci S, Pfundt R, Ragge NK, Rinne T, Ruivenkamp C, Saitta SC, Sun Y, Tartaglia M, Terhal PA, van Essen AJ, Vigeland MD, Xiao B, Hennekam RC", "reference": { "type": "PubMed", "id": "29460469", "url": "https://pubmed.ncbi.nlm.nih.gov/29460469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29460469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophagy Inhibition Mediates Apoptosis Sensitization in Cancer Therapy by Relieving FOXO3a Turnover.", "journal": "Developmental cell", "date": "2018", "authors": "Fitzwalter BE, Towers CG, Sullivan KD, Andrysik Z, Hoh M, Ludwig M, O'Prey J, Ryan KM, Espinosa JM, Morgan MJ, Thorburn A", "reference": { "type": "PubMed", "id": "29533771", "url": "https://pubmed.ncbi.nlm.nih.gov/29533771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23511-1", "protein_name": "Nuclear transcription factor Y subunit alpha", "gene_name": "NFYA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12778-1", "protein_name": "Forkhead box protein O1", "gene_name": "FOXO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35638-1", "protein_name": "DNA damage-inducible transcript 3 protein", "gene_name": "DDIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99967-1", "protein_name": "Cbp/p300-interacting transactivator 2", "gene_name": "CITED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43521-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "BCL2L11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25208-1", "protein_name": "Nuclear transcription factor Y subunit beta", "gene_name": "NFYB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98177-1", "protein_name": "Forkhead box protein O4", "gene_name": "FOXO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41182-1", "protein_name": "B-cell lymphoma 6 protein", "gene_name": "BCL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13952-1", "protein_name": "Nuclear transcription factor Y subunit gamma", "gene_name": "NFYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM7-1", "protein_name": "Serine/threonine-protein kinase PINK1, mitochondrial", "gene_name": "PINK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29533771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A review on heme oxygenase-1 induction: is it a necessary evil.", "journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]", "date": "2018", "authors": "Waza AA, Hamid Z, Ali S, Bhat SA, Bhat MA", "reference": { "type": "PubMed", "id": "29693710", "url": "https://pubmed.ncbi.nlm.nih.gov/29693710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29693710", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The multifaceted role of glutathione S-transferases in cancer.", "journal": "Cancer letters", "date": "2018", "authors": "Chatterjee A, Gupta S", "reference": { "type": "PubMed", "id": "29959055", "url": "https://pubmed.ncbi.nlm.nih.gov/29959055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29959055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SIRT7-Dependent Deacetylation of Fibrillarin Controls Histone H2A Methylation and rRNA Synthesis during the Cell Cycle.", "journal": "Cell reports", "date": "2018", "authors": "Iyer-Bierhoff A, Krogh N, Tessarz P, Ruppert T, Nielsen H, Grummt I", "reference": { "type": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22087-1", "protein_name": "rRNA 2'-O-methyltransferase fibrillarin", "gene_name": "FBL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC8-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-7", "gene_name": "SIRT7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 102, "end_pos": 102, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation; impaired ability to methylate histone H2A; when associated with Q-121 and 205-Q-Q-206.", "evidence": [ { "database": "UniProtKB", "id": "P22087", "url": "https://www.uniprot.org/uniprotkb/P22087" }, { "database": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" } ], "uniprot_canonical_ac": "P22087-1" }, { "start_pos": 102, "end_pos": 102, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased acetylation; restores ability to methylate histone H2A; when associated with R-121 and 205-R-R-206.", "evidence": [ { "database": "UniProtKB", "id": "P22087", "url": "https://www.uniprot.org/uniprotkb/P22087" }, { "database": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" } ], "uniprot_canonical_ac": "P22087-1" }, { "start_pos": 121, "end_pos": 121, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation; impaired ability to methylate histone H2A; when associated with Q-102 and 205-Q-Q-206.", "evidence": [ { "database": "UniProtKB", "id": "P22087", "url": "https://www.uniprot.org/uniprotkb/P22087" }, { "database": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" } ], "uniprot_canonical_ac": "P22087-1" }, { "start_pos": 121, "end_pos": 121, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased acetylation; restores ability to methylate histone H2A; when associated with R-102 and 205-R-R-206.", "evidence": [ { "database": "UniProtKB", "id": "P22087", "url": "https://www.uniprot.org/uniprotkb/P22087" }, { "database": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" } ], "uniprot_canonical_ac": "P22087-1" }, { "start_pos": 205, "end_pos": 206, "sequence_org": "KK", "sequence_mut": "QQ", "comment": "Mimics acetylation; impaired ability to methylate histone H2A; when associated with Q-102 and Q-121.", "evidence": [ { "database": "UniProtKB", "id": "P22087", "url": "https://www.uniprot.org/uniprotkb/P22087" }, { "database": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" } ], "uniprot_canonical_ac": "P22087-1" }, { "start_pos": 205, "end_pos": 206, "sequence_org": "KK", "sequence_mut": "RR", "comment": "Decreased acetylation; restores ability to methylate histone H2A; when associated with R-102 and R-121.", "evidence": [ { "database": "UniProtKB", "id": "P22087", "url": "https://www.uniprot.org/uniprotkb/P22087" }, { "database": "PubMed", "id": "30540930", "url": "https://pubmed.ncbi.nlm.nih.gov/30540930" } ], "uniprot_canonical_ac": "P22087-1" } ], "record_id": "pubmed.30540930", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Respiratory Syncytial Virus NS 1 Targets TRIM25 to Suppress RIG-I Ubiquitination and Subsequent RIG-I-Mediated Antiviral Signaling.", "journal": "Viruses", "date": "2018", "authors": "Ban J, Lee NR, Lee NJ, Lee JK, Quan FS, Inn KS", "reference": { "type": "PubMed", "id": "30558248", "url": "https://pubmed.ncbi.nlm.nih.gov/30558248" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93034-1", "protein_name": "Cullin-5", "gene_name": "CUL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62877-1", "protein_name": "E3 ubiquitin-protein ligase RBX1", "gene_name": "RBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30558248", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Confirmation of a new phenotype in an individual with a variant in the last part of exon 30 of CREBBP.", "journal": "American journal of medical genetics. Part A", "date": "2019", "authors": "Angius A, Uva P, Oppo M, Persico I, Onano S, Olla S, Pes V, Perria C, Cuccuru G, Atzeni R, Serra G, Cucca F, Sotgiu S, Hennekam RC, Crisponi L", "reference": { "type": "PubMed", "id": "30737887", "url": "https://pubmed.ncbi.nlm.nih.gov/30737887" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30737887", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Programmed Cell-Death by Ferroptosis: Antioxidants as Mitigators.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Kajarabille N, Latunde-Dada GO", "reference": { "type": "PubMed", "id": "31597407", "url": "https://pubmed.ncbi.nlm.nih.gov/31597407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13501-1", "protein_name": "Sequestosome-1", "gene_name": "SQSTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15525-1", "protein_name": "Transcription factor MafG", "gene_name": "MAFG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14145-1", "protein_name": "Kelch-like ECH-associated protein 1", "gene_name": "KEAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31597407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DUX4-induced bidirectional HSATII satellite repeat transcripts form intranuclear double-stranded RNA foci in human cell models of FSHD.", "journal": "Human molecular genetics", "date": "2019-12-01", "authors": "Shadle Sean C, Bennett Sean R, Wong Chao-Jen, Karreman Nancy A, Campbell Amy E, van der Maarel Silv\u00e8re M, Bass Brenda L, Tapscott Stephen J", "reference": { "type": "PubMed", "id": "31630170", "url": "https://pubmed.ncbi.nlm.nih.gov/31630170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RXH2-1", "protein_name": "Lysine-specific demethylase 4E", "gene_name": "KDM4E", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MZ59-2", "protein_name": "Paired-like homeodomain transcription factor LEUTX", "gene_name": "LEUTX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7L190-1", "protein_name": "Developmental pluripotency-associated protein 4", "gene_name": "DPPA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NLW8-1", "protein_name": "Double homeobox protein A", "gene_name": "DUXA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DV77-1", "protein_name": "Tetrapeptide repeat homeobox protein 2", "gene_name": "TPRX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBX2-1", "protein_name": "Double homeobox protein 4", "gene_name": "DUX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1W2PPF3-1", "protein_name": "Double homeobox protein B", "gene_name": "DUXB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7U7-1", "protein_name": "Tetra-peptide repeat homeobox protein 1", "gene_name": "TPRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q17RH7-1", "protein_name": "Tetra-peptide repeat homeobox-like protein", "gene_name": "TPRXL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAM6-1", "protein_name": "Zinc finger and SCAN domain-containing protein 4", "gene_name": "ZSCAN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VYS8-1", "protein_name": "Terminal uridylyltransferase 7", "gene_name": "TUT7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15561-1", "protein_name": "Transcriptional enhancer factor TEF-3", "gene_name": "TEAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7J5-1", "protein_name": "Developmental pluripotency-associated protein 2", "gene_name": "DPPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31630170", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PGRMC2 is an intracellular haem chaperone critical for adipocyte function.", "journal": "Nature", "date": "2019", "authors": "Galmozzi A, Kok BP, Kim AS, Montenegro-Burke JR, Lee JY, Spreafico R, Mosure S, Albert V, Cintron-Colon R, Godio C, Webb WR, Conti B, Solt LA, Kojetin D, Parker CG, Peluso JJ, Pru JK, Siuzdak G, Cravatt BF, Saez E", "reference": { "type": "PubMed", "id": "31748741", "url": "https://pubmed.ncbi.nlm.nih.gov/31748741" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "O55022-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "Pgrmc1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80UU9-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "Pgrmc2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3UV55-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "Nr1d1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31748741", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 49 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ABCC3 Expressed by CD56dim CD16+ NK Cells Predicts Response in Glioblastoma Patients Treated with Combined Chemotherapy and Dendritic Cell Immunotherapy.", "journal": "International journal of molecular sciences", "date": "2019-11-23", "authors": "Pellegatta Serena, Di Ianni Natalia, Pessina Sara, Paterra Rosina, Anghileri Elena, Eoli Marica, Finocchiaro Gaetano", "reference": { "type": "PubMed", "id": "31771235", "url": "https://pubmed.ncbi.nlm.nih.gov/31771235" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33527-1", "protein_name": "Multidrug resistance-associated protein 1", "gene_name": "ABCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UG63-1", "protein_name": "ATP-binding cassette sub-family F member 2", "gene_name": "ABCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15438-1", "protein_name": "ATP-binding cassette sub-family C member 3", "gene_name": "ABCC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31771235", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZBP1 and TAK1: Master Regulators of NLRP3 Inflammasome/Pyroptosis, Apoptosis, and Necroptosis (PAN-optosis).", "journal": "Frontiers in cellular and infection microbiology", "date": "2019", "authors": "Malireddi RKS, Kesavardhana S, Kanneganti TD", "reference": { "type": "PubMed", "id": "31850239", "url": "https://pubmed.ncbi.nlm.nih.gov/31850239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31850239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A SARS-CoV-2 protein interaction map reveals targets for drug repurposing.", "journal": "Nature", "date": "2020", "authors": "Gordon DE, Jang GM, Bouhaddou M, Xu J, Obernier K, White KM, O'Meara MJ, Rezelj VV, Guo JZ, Swaney DL, Tummino TA, Huttenhain R, Kaake RM, Richards AL, Tutuncuoglu B, Foussard H, Batra J, Haas K, Modak M, Kim M, Haas P, Polacco BJ, Braberg H, Fabius JM, Eckhardt M, Soucheray M, Bennett MJ, Cakir M, McGregor MJ, Li Q, Meyer B, Roesch F, Vallet T, Mac Kain A, Miorin L, Moreno E, Naing ZZC, Zhou Y, Peng S, Shi Y, Zhang Z, Shen W, Kirby IT, Melnyk JE, Chorba JS, Lou K, Dai SA, Barrio-Hernandez I, Memon D, Hernandez-Armenta C, Lyu J, Mathy CJP, Perica T, Pilla KB, Ganesan SJ, Saltzberg DJ, Rakesh R, Liu X, Rosenthal SB, Calviello L, Venkataramanan S, Liboy-Lugo J, Lin Y, Huang XP, Liu Y, Wankowicz SA, Bohn M, Safari M, Ugur FS, Koh C, Savar NS, Tran QD, Shengjuler D, Fletcher SJ, O'Neal MC, Cai Y, Chang JCJ, Broadhurst DJ, Klippsten S, Sharp PP, Wenzell NA, Kuzuoglu-Ozturk D, Wang HY, Trenker R, Young JM, Cavero DA, Hiatt J, Roth TL, Rathore U, Subramanian A, Noack J, Hubert M, Stroud RM, Frankel AD, Rosenberg OS, Verba KA, Agard DA, Ott M, Emerman M, Jura N, von Zastrow M, Verdin E, Ashworth A, Schwartz O, d'Enfert C, Mukherjee S, Jacobson M, Malik HS, Fujimori DG, Ideker T, Craik CS, Floor SN, Fraser JS, Gross JD, Sali A, Roth BL, Ruggero D, Taunton J, Kortemme T, Beltrao P, Vignuzzi M, Garcia-Sastre A, Shokat KM, Shoichet BK, Krogan NJ", "reference": { "type": "PubMed", "id": "32353859", "url": "https://pubmed.ncbi.nlm.nih.gov/32353859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32353859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heme induces human and mouse platelet activation through C-type-lectin-like receptor-2.", "journal": "Haematologica", "date": "2021", "authors": "Bourne JH, Colicchia M, Di Y, Martin E, Slater A, Roumenina LT, Dimitrov JD, Watson SP, Rayes J", "reference": { "type": "PubMed", "id": "32354867", "url": "https://pubmed.ncbi.nlm.nih.gov/32354867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32354867", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization and Noncovalent Inhibition of the Deubiquitinase and deISGylase Activity of SARS-CoV-2 Papain-Like Protease.", "journal": "ACS infectious diseases", "date": "2020", "authors": "Freitas BT, Durie IA, Murray J, Longo JE, Miller HC, Crich D, Hogan RJ, Tripp RA, Pegan SD", "reference": { "type": "PubMed", "id": "32428392", "url": "https://pubmed.ncbi.nlm.nih.gov/32428392" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32428392", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway.", "journal": "Virus research", "date": "2020", "authors": "Li JY, Liao CH, Wang Q, Tan YJ, Luo R, Qiu Y, Ge XY", "reference": { "type": "PubMed", "id": "32589897", "url": "https://pubmed.ncbi.nlm.nih.gov/32589897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32589897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nrf2 inhibits ferroptosis and protects against acute lung injury due to intestinal ischemia reperfusion via regulating SLC7A11 and HO-1.", "journal": "Aging", "date": "2020", "authors": "Dong H, Qiang Z, Chai D, Peng J, Xia Y, Hu R, Jiang H", "reference": { "type": "PubMed", "id": "32601262", "url": "https://pubmed.ncbi.nlm.nih.gov/32601262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD26-1", "protein_name": "ATP-dependent chromatin remodeler CHD6", "gene_name": "CHD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48507-1", "protein_name": "Glutamate--cysteine ligase regulatory subunit", "gene_name": "GCLM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16881-1", "protein_name": "Thioredoxin reductase 1, cytoplasmic", "gene_name": "TXNRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08294-1", "protein_name": "Extracellular superoxide dismutase [Cu-Zn]", "gene_name": "SOD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPY5-1", "protein_name": "Cystine/glutamate transporter", "gene_name": "SLC7A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10599-1", "protein_name": "Thioredoxin", "gene_name": "TXN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15559-1", "protein_name": "NAD(P)H dehydrogenase [quinone] 1", "gene_name": "NQO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06830-1", "protein_name": "Peroxiredoxin-1", "gene_name": "PRDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08263-1", "protein_name": "Glutathione S-transferase A1", "gene_name": "GSTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16772-1", "protein_name": "Glutathione S-transferase A3", "gene_name": "GSTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48506-1", "protein_name": "Glutamate--cysteine ligase catalytic subunit", "gene_name": "GCLC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32601262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a Heme Activation Site on the MD-2/TLR4 Complex.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Belcher JD, Zhang P, Nguyen J, Kiser ZM, Nath KA, Hu J, Trent JO, Vercellotti GM", "reference": { "type": "PubMed", "id": "32695117", "url": "https://pubmed.ncbi.nlm.nih.gov/32695117" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32695117", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 Orf9b suppresses type I interferon responses by targeting TOM70.", "journal": "Cellular & molecular immunology", "date": "2020", "authors": "Jiang HW, Zhang HN, Meng QF, Xie J, Li Y, Chen H, Zheng YX, Wang XN, Qi H, Zhang J, Wang PH, Han ZG, Tao SC", "reference": { "type": "PubMed", "id": "32728199", "url": "https://pubmed.ncbi.nlm.nih.gov/32728199" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTD2-1", "protein_name": "ORF9b protein", "gene_name": "9b", "tax_name": "2019-nCoV" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32728199", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 141 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 N protein antagonizes type I interferon signaling by suppressing phosphorylation and nuclear translocation of STAT1 and STAT2.", "journal": "Cell discovery", "date": "2020", "authors": "Mu J, Fang Y, Yang Q, Shu T, Wang A, Huang M, Jin L, Deng F, Qiu Y, Zhou X", "reference": { "type": "PubMed", "id": "32953130", "url": "https://pubmed.ncbi.nlm.nih.gov/32953130" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32953130", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evasion of Type I Interferon by SARS-CoV-2.", "journal": "Cell reports", "date": "2020", "authors": "Xia H, Cao Z, Xie X, Zhang X, Chen JY, Wang H, Menachery VD, Rajsbaum R, Shi PY", "reference": { "type": "PubMed", "id": "32979938", "url": "https://pubmed.ncbi.nlm.nih.gov/32979938" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14457-1", "protein_name": "Beclin-1", "gene_name": "BECN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62633-1", "protein_name": "CCHC-type zinc finger nucleic acid binding protein", "gene_name": "CNBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTC1-1", "protein_name": "Replicase polyprotein 1a", "gene_name": "", "tax_name": "2019-nCoV" }, { "uniprot_canonical_ac": "P0DTC6-1", "protein_name": "ORF6 protein", "gene_name": "6", "tax_name": "2019-nCoV" }, { "uniprot_canonical_ac": "P0DTD1-1", "protein_name": "Replicase polyprotein 1ab", "gene_name": "rep", "tax_name": "2019-nCoV" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13283-1", "protein_name": "Ras GTPase-activating protein-binding protein 1", "gene_name": "G3BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60603-1", "protein_name": "Toll-like receptor 2", "gene_name": "TLR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16552-1", "protein_name": "Interleukin-17A", "gene_name": "IL17A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC29-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 2", "gene_name": "NOD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN86-1", "protein_name": "Ras GTPase-activating protein-binding protein 2", "gene_name": "G3BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNE5-1", "protein_name": "Beclin 1-associated autophagy-related key regulator", "gene_name": "ATG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61088-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "UBE2N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51617-1", "protein_name": "Interleukin-1 receptor-associated kinase 1", "gene_name": "IRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15399-1", "protein_name": "Toll-like receptor 1", "gene_name": "TLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR97-1", "protein_name": "Toll-like receptor 8", "gene_name": "TLR8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y239-1", "protein_name": "Nucleotide-binding oligomerization domain-containing protein 1", "gene_name": "NOD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PKG0-1", "protein_name": "La-related protein 1", "gene_name": "LARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NAC3-1", "protein_name": "Interleukin-17 receptor C", "gene_name": "IL17RC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13404-4", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F46-1", "protein_name": "Interleukin-17 receptor A", "gene_name": "IL17RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59046-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 12", "gene_name": "NLRP12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92793", "url": "https://www.uniprot.org/uniprotkb/Q92793" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32979938", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 124 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]