[ { "title": "WWP2 binds to NKRF, enhances the NF-\u03baB signaling, and promotes malignant phenotypes of acute myeloid leukemia cells.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2023-11-03", "authors": "Wang Hongjia, Lian Xin, Wang Kexin, Wang Shuye", "reference": { "type": "PubMed", "id": "37921219", "url": "https://pubmed.ncbi.nlm.nih.gov/37921219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00308-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP2", "gene_name": "WWP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0AAG2UWQ9-1", "protein_name": "NF-kappa-B-repressing factor", "gene_name": "NKRF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00308", "url": "https://www.uniprot.org/uniprotkb/O00308" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37921219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanisms of phagocytosis in macrophages.", "journal": "Annual review of immunology", "date": "1999", "authors": "Aderem A, Underhill DM", "reference": { "type": "PubMed", "id": "10358769", "url": "https://pubmed.ncbi.nlm.nih.gov/10358769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10358769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myosin-X provides a motor-based link between integrins and the cytoskeleton.", "journal": "Nat. Cell Biol.", "date": "2004", "authors": "Zhang Hongquan, Berg Jonathan S, Li Zhilun, Wang Yunling, L\u00e5ng Pernilla, Sousa Aurea D, Bhaskar Aparna, Cheney Richard E, Str\u00f6mblad Staffan", "reference": { "type": "PubMed", "id": "15156152", "url": "https://pubmed.ncbi.nlm.nih.gov/15156152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P79114-1", "protein_name": "Unconventional myosin-X", "gene_name": "MYO10", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15156152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Integrin-dependent functions of the angiogenic inducer NOV (CCN3): implication in wound healing.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Lin Cristiane G, Chen Chih-Chiun, Leu Shr-Jeng, Grzeszkiewicz Tatiana M, Lau Lester F", "reference": { "type": "PubMed", "id": "15611078", "url": "https://pubmed.ncbi.nlm.nih.gov/15611078" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q64299-1", "protein_name": "CCN family member 3", "gene_name": "Ccn3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P48745-1", "protein_name": "CCN family member 3", "gene_name": "CCN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15611078", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rab27a regulates phagosomal pH and NADPH oxidase recruitment to dendritic cell phagosomes.", "journal": "Nature cell biology", "date": "2007", "authors": "Jancic C, Savina A, Wasmeier C, Tolmachova T, El-Benna J, Dang PM, Pascolo S, Gougerot-Pocidalo MA, Raposo G, Seabra MC, Amigorena S", "reference": { "type": "PubMed", "id": "17351642", "url": "https://pubmed.ncbi.nlm.nih.gov/17351642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17351642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cell biology of cross-presentation and the role of dendritic cell subsets.", "journal": "Immunology and cell biology", "date": "2008", "authors": "Lin ML, Zhan Y, Villadangos JA, Lew AM", "reference": { "type": "PubMed", "id": "18268517", "url": "https://pubmed.ncbi.nlm.nih.gov/18268517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07711-1", "protein_name": "Procathepsin L", "gene_name": "CTSL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25774-1", "protein_name": "Cathepsin S", "gene_name": "CTSS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60911-1", "protein_name": "Cathepsin L2", "gene_name": "CTSV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIQ6-1", "protein_name": "Leucyl-cystinyl aminopeptidase", "gene_name": "LNPEP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18268517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contributions of proteomics to understanding phagosome maturation.", "journal": "Cellular microbiology", "date": "2008", "authors": "Rogers LD, Foster LJ", "reference": { "type": "PubMed", "id": "18331591", "url": "https://pubmed.ncbi.nlm.nih.gov/18331591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18331591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NADPH oxidase controls phagosomal pH and antigen cross-presentation in human dendritic cells.", "journal": "Blood", "date": "2008", "authors": "Mantegazza AR, Savina A, Vermeulen M, Perez L, Geffner J, Hermine O, Rosenzweig SD, Faure F, Amigorena S", "reference": { "type": "PubMed", "id": "18682599", "url": "https://pubmed.ncbi.nlm.nih.gov/18682599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18682599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intracellular mechanisms of antigen cross presentation in dendritic cells.", "journal": "Current opinion in immunology", "date": "2010", "authors": "Amigorena S, Savina A", "reference": { "type": "PubMed", "id": "20171863", "url": "https://pubmed.ncbi.nlm.nih.gov/20171863" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20171863", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p21-activated kinase 4 phosphorylation of integrin beta5 Ser-759 and Ser-762 regulates cell migration.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Li Z, Zhang H, Lundin L, Thullberg M, Liu Y, Wang Y, Claesson-Welsh L, Stromblad S", "reference": { "type": "PubMed", "id": "20507994", "url": "https://pubmed.ncbi.nlm.nih.gov/20507994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96013-1", "protein_name": "Serine/threonine-protein kinase PAK 4", "gene_name": "PAK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 759, "end_pos": 759, "kinase_uniprot_canonical_ac": "O96013-1", "kinase_gene_name": "PAK4", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P18084", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P18084" }, { "database": "PubMed", "id": "20507994", "url": "https://pubmed.ncbi.nlm.nih.gov/20507994" } ], "site_lbl": "Ser759", "uniprot_canonical_ac": "P18084-1" }, { "start_pos": 759, "end_pos": 759, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P18084", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P18084" }, { "database": "PubMed", "id": "20507994", "url": "https://pubmed.ncbi.nlm.nih.gov/20507994" } ], "site_lbl": "Ser759", "uniprot_canonical_ac": "P18084-1" }, { "start_pos": 762, "end_pos": 762, "kinase_uniprot_canonical_ac": "O96013-1", "kinase_gene_name": "PAK4", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P18084", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P18084" }, { "database": "PubMed", "id": "20507994", "url": "https://pubmed.ncbi.nlm.nih.gov/20507994" } ], "site_lbl": "Ser762", "uniprot_canonical_ac": "P18084-1" }, { "start_pos": 762, "end_pos": 762, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P18084", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P18084" }, { "database": "PubMed", "id": "20507994", "url": "https://pubmed.ncbi.nlm.nih.gov/20507994" } ], "site_lbl": "Ser762", "uniprot_canonical_ac": "P18084-1" } ], "record_id": "pubmed.20507994", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Integrin alphavbeta5 is a primary receptor for adenovirus in CAR-negative cells.", "journal": "Virology journal", "date": "2010-07-08", "authors": "Lyle Cynthia, McCormick Frank", "reference": { "type": "PubMed", "id": "20615244", "url": "https://pubmed.ncbi.nlm.nih.gov/20615244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20615244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA sequence of the human integrin beta 5 subunit.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "McLean JW, Vestal DJ, Cheresh DA, Bodary SC", "reference": { "type": "PubMed", "id": "2211615", "url": "https://pubmed.ncbi.nlm.nih.gov/2211615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2211615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, primary structure and properties of a novel human integrin beta subunit.", "journal": "EMBO J.", "date": "1990", "authors": "Ramaswamy H, Hemler ME", "reference": { "type": "PubMed", "id": "2328726", "url": "https://pubmed.ncbi.nlm.nih.gov/2328726" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2328726", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of an integrin beta subunit exhibiting high homology with integrin beta 3 subunit.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Suzuki S, Huang Z S, Tanihara H", "reference": { "type": "PubMed", "id": "2371275", "url": "https://pubmed.ncbi.nlm.nih.gov/2371275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2371275", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Assessment Of Endometrial Integrin Beta 5 In Women With Unexplained Recurrent Pregnancy Loss.", "journal": "JPMA. The Journal of the Pakistan Medical Association", "date": "2023-04", "authors": "Fathy Ahmed Mohamed, Rizk Ahmed Youssef, El Azeez Nosair Nahla Abd, Abdelkarim Ahmed Mohamed, Ellakany Mostafa Farag", "reference": { "type": "PubMed", "id": "37482842", "url": "https://pubmed.ncbi.nlm.nih.gov/37482842" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37482842", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PTP1B mediates the inhibitory effect of MFGE8 on insulin signaling through the \u03b25 integrin.", "journal": "The Journal of biological chemistry", "date": "2024-02", "authors": "Datta Ritwik, Mukherjee Dibyanti, Podolsky Michael J, Yang Christopher D, Alba Diana L, Singh Sukhmani, Arnold Thomas D, Koliwad Suneil, Lizama Carlos O, Atabai Kamran", "reference": { "type": "PubMed", "id": "38199575", "url": "https://pubmed.ncbi.nlm.nih.gov/38199575" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18031-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 1", "gene_name": "PTPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O70309-1", "protein_name": "Integrin beta-5", "gene_name": "Itgb5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q08431-1", "protein_name": "Lactadherin", "gene_name": "MFGE8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21956-1", "protein_name": "Lactadherin", "gene_name": "Mfge8", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38199575", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ITGB5 facilitates gastric cancer metastasis by promoting TGFBR2 endosomal recycling.", "journal": "Cancer letters", "date": "2024-06-28", "authors": "Lei Tianxiang, Lin Yingying, Lai Xiaofan, Zhang Yongxin, Ma Yuanchen, Wang Xiaofeng, Liu Wenwei, Tang Qiao, Yang Ting, Feng Wei, Song Wu", "reference": { "type": "PubMed", "id": "38729557", "url": "https://pubmed.ncbi.nlm.nih.gov/38729557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38729557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ROS-mediated ITGB5 promotes tongue squamous cell carcinoma metastasis through epithelial mesenchymal transition and cell adhesion signal pathway.", "journal": "Journal of cancer research and clinical oncology", "date": "2024-08-24", "authors": "Chen Weixiong, Yang Haojie, Huang Lei, Fang Caihong, Yao Limin, Liu Faxin, Jin Tingting", "reference": { "type": "PubMed", "id": "39180583", "url": "https://pubmed.ncbi.nlm.nih.gov/39180583" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39180583", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phagocytic processing of bacterial antigens for class I MHC presentation to T cells.", "journal": "Nature", "date": "1993", "authors": "Pfeifer JD, Wick MJ, Roberts RL, Findlay K, Normark SJ, Harding CV", "reference": { "type": "PubMed", "id": "7678924", "url": "https://pubmed.ncbi.nlm.nih.gov/7678924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7678924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immature dendritic cells phagocytose apoptotic cells via alphavbeta5 and CD36, and cross-present antigens to cytotoxic T lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Albert ML, Pearce SF, Francisco LM, Sauter B, Roy P, Silverstein RL, Bhardwaj N", "reference": { "type": "PubMed", "id": "9763615", "url": "https://pubmed.ncbi.nlm.nih.gov/9763615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18084-1", "protein_name": "Integrin beta-5", "gene_name": "ITGB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04839-1", "protein_name": "NADPH oxidase 2", "gene_name": "CYBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06756-1", "protein_name": "Integrin alpha-V", "gene_name": "ITGAV", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14598-1", "protein_name": "Neutrophil cytosol factor 1", "gene_name": "NCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13498-1", "protein_name": "Cytochrome b-245 light chain", "gene_name": "CYBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15080-1", "protein_name": "Neutrophil cytosol factor 4", "gene_name": "NCF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19878-1", "protein_name": "Neutrophil cytosol factor 2", "gene_name": "NCF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P18084", "url": "https://www.uniprot.org/uniprotkb/P18084" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9763615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "circCsnk1g3- and circAnkib1-regulated interferon responses in sarcoma promote tumorigenesis by shaping the immune microenvironment.", "journal": "Nature communications", "date": "2022-11-25", "authors": "Piras Roberta, Ko Emily Y, Barrett Connor, De Simone Marco, Lin Xianzhi, Broz Marina T, Tessaro Fernando H G, Castillo-Martin Mireia, Cordon-Cardo Carlos, Goodridge Helen S, Di Vizio Dolores, Batish Mona, Lawrenson Kate, Chen Y Grace, Chan Keith Syson, Guarnerio Jlenia", "reference": { "type": "PubMed", "id": "36433954", "url": "https://pubmed.ncbi.nlm.nih.gov/36433954" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2G1-1", "protein_name": "Ankyrin repeat and IBR domain-containing protein 1", "gene_name": "ANKIB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6M4-1", "protein_name": "Casein kinase I isoform gamma-3", "gene_name": "CSNK1G3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2G1", "url": "https://www.uniprot.org/uniprotkb/Q9P2G1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36433954", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E3 ubiquitin ligase ANKIB1 attenuates antiviral immune responses by promoting K48-linked polyubiquitination of MAVS.", "journal": "Cell reports", "date": "2024-09-24", "authors": "Liu Wei, Yuan Cui, Fu Buwen, Xie Jiufeng, Li Wenqing, Zhang Guozhi, Ma Zhenling, Jiao Pengtao", "reference": { "type": "PubMed", "id": "39213157", "url": "https://pubmed.ncbi.nlm.nih.gov/39213157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2G1-1", "protein_name": "Ankyrin repeat and IBR domain-containing protein 1", "gene_name": "ANKIB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2G1", "url": "https://www.uniprot.org/uniprotkb/Q9P2G1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39213157", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Guanosine diphosphate-mannose:GlcNAc2-PP-dolichol mannosyltransferase deficiency (congenital disorders of glycosylation type Ik): five new patients and seven novel mutations.", "journal": "Journal of medical genetics", "date": "2010", "authors": "Dupre T, Vuillaumier-Barrot S, Chantret I, Sadou Yaye H, Le Bizec C, Afenjar A, Altuzarra C, Barnerias C, Burglen L, de Lonlay P, Feillet F, Napuri S, Seta N, Moore SE", "reference": { "type": "PubMed", "id": "20679665", "url": "https://pubmed.ncbi.nlm.nih.gov/20679665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "Q9BT22", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9BT22" }, { "id": "rs387906926", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906926" }, { "id": "rs387906926", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs387906926" }, { "id": "20679665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20679665" }, { "id": "rs387906926", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs387906926" } ], "glycoeffect": [], "start_pos": 145, "end_pos": 145, "subjects_tested": "1704", "subjects_positive": "1", "frequency": "0.1", "sequence_org": "G", "sequence_mut": "D", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "16", "chr_pos": "5075431", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "G145", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] }, { "disease_id": "DOID:0080563", "recommended_name": { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation Ik", "description": "A congenital disorder of glycosylation I that is characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly and has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding beta-1,4-mannosyltransferase on chromosome 16p13." }, "synonyms": [ { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "A severe form of congenital disorders of N-linked glycosylation characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly. Additional features include altered blood coagulation with a high probability of hemorrhages or thromboses, nephrotic syndrome, ascites, hepatomegaly, cardiomyopathy, ocular manifestations (strabismus, nystagmus), and immunodeficiency. The disease is caused by loss-of-function mutations in the gene ALG1 (16p13.3)." }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG-Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "carbohydrate deficient glycoprotein syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "mannosyltransferase 1 deficiency", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG (CDG-Ik)", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG 1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation, type Ik", "description": "" }, { "id": "MIM:608540", "resource": "MIM", "url": "https://www.omim.org/entry/608540", "name": "Congenital disorder of glycosylation 1K", "description": "Congenital disorder of glycosylation 1K" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" }, { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "000000010000000000000.00000000000000.000000000001000000.00001.01.000.000", "uniprot_canonical_ac": "Q9BT22-1" }, { "evidence": [ { "id": "rs151173406", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs151173406" }, { "id": "rs151173406", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs151173406" }, { "id": "rs151173406", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs151173406#frequency_tab" }, { "id": "rs151173406", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs151173406" }, { "id": "20679665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20679665" } ], "glycoeffect": [], "start_pos": 276, "end_pos": 276, "sequence_org": "R", "sequence_mut": "W", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "16", "chr_pos": "5078842", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R276", "disease": [ { "disease_id": "DOID:0080563", "recommended_name": { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation Ik", "description": "A congenital disorder of glycosylation I that is characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly and has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding beta-1,4-mannosyltransferase on chromosome 16p13." }, "synonyms": [ { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "A severe form of congenital disorders of N-linked glycosylation characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly. Additional features include altered blood coagulation with a high probability of hemorrhages or thromboses, nephrotic syndrome, ascites, hepatomegaly, cardiomyopathy, ocular manifestations (strabismus, nystagmus), and immunodeficiency. The disease is caused by loss-of-function mutations in the gene ALG1 (16p13.3)." }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG-Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "carbohydrate deficient glycoprotein syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "mannosyltransferase 1 deficiency", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG (CDG-Ik)", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG 1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation, type Ik", "description": "" }, { "id": "MIM:608540", "resource": "MIM", "url": "https://www.omim.org/entry/608540", "name": "Congenital disorder of glycosylation 1K", "description": "Congenital disorder of glycosylation 1K" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" }, { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q9BT22-1" }, { "evidence": [ { "id": "rs387906925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906925" }, { "id": "rs387906925", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs387906925#frequency_tab" }, { "id": "rs387906925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs387906925" }, { "id": "20679665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20679665" } ], "glycoeffect": [], "start_pos": 377, "end_pos": 377, "sequence_org": "M", "sequence_mut": "V", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "16", "chr_pos": "5082615", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M377", "disease": [ { "disease_id": "DOID:0080563", "recommended_name": { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation Ik", "description": "A congenital disorder of glycosylation I that is characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly and has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding beta-1,4-mannosyltransferase on chromosome 16p13." }, "synonyms": [ { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "A severe form of congenital disorders of N-linked glycosylation characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly. Additional features include altered blood coagulation with a high probability of hemorrhages or thromboses, nephrotic syndrome, ascites, hepatomegaly, cardiomyopathy, ocular manifestations (strabismus, nystagmus), and immunodeficiency. The disease is caused by loss-of-function mutations in the gene ALG1 (16p13.3)." }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG-Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "carbohydrate deficient glycoprotein syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "mannosyltransferase 1 deficiency", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG (CDG-Ik)", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG 1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation, type Ik", "description": "" }, { "id": "MIM:608540", "resource": "MIM", "url": "https://www.omim.org/entry/608540", "name": "Congenital disorder of glycosylation 1K", "description": "Congenital disorder of glycosylation 1K" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" }, { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000100000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9BT22-1" }, { "evidence": [ { "id": "rs387906927", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906927" }, { "id": "rs387906927", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906927" }, { "id": "rs387906927", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs387906927" }, { "id": "20679665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20679665" } ], "glycoeffect": [], "start_pos": 396, "end_pos": 396, "sequence_org": "C", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "16", "chr_pos": "5083682", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C396", "disease": [ { "disease_id": "DOID:0080563", "recommended_name": { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation Ik", "description": "A congenital disorder of glycosylation I that is characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly and has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding beta-1,4-mannosyltransferase on chromosome 16p13." }, "synonyms": [ { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "A severe form of congenital disorders of N-linked glycosylation characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly. Additional features include altered blood coagulation with a high probability of hemorrhages or thromboses, nephrotic syndrome, ascites, hepatomegaly, cardiomyopathy, ocular manifestations (strabismus, nystagmus), and immunodeficiency. The disease is caused by loss-of-function mutations in the gene ALG1 (16p13.3)." }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG-Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "carbohydrate deficient glycoprotein syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "mannosyltransferase 1 deficiency", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG (CDG-Ik)", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG 1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation, type Ik", "description": "" }, { "id": "MIM:608540", "resource": "MIM", "url": "https://www.omim.org/entry/608540", "name": "Congenital disorder of glycosylation 1K", "description": "Congenital disorder of glycosylation 1K" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" }, { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000010000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9BT22-1" } ], "record_id": "pubmed.20679665", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ALG1-CDG: a new case with early fatal outcome.", "journal": "Gene", "date": "2014", "authors": "Rohlfing AK, Rust S, Reunert J, Tirre M, Du Chesne I, Wemhoff S, Meinhardt F, Hartmann H, Das AM, Marquardt T", "reference": { "type": "PubMed", "id": "24157261", "url": "https://pubmed.ncbi.nlm.nih.gov/24157261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24157261", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ALG1-CDG: Clinical and Molecular Characterization of 39 Unreported Patients.", "journal": "Human mutation", "date": "2016", "authors": "Ng BG, Shiryaev SA, Rymen D, Eklund EA, Raymond K, Kircher M, Abdenur JE, Alehan F, Midro AT, Bamshad MJ, Barone R, Berry GT, Brumbaugh JE, Buckingham KJ, Clarkson K, Cole FS, O'Connor S, Cooper GM, Van Coster R, Demmer LA, Diogo L, Fay AJ, Ficicioglu C, Fiumara A, Gahl WA, Ganetzky R, Goel H, Harshman LA, He M, Jaeken J, James PM, Katz D, Keldermans L, Kibaek M, Kornberg AJ, Lachlan K, Lam C, Yaplito-Lee J, Nickerson DA, Peters HL, Race V, Regal L, Rush JS, Rutledge SL, Shendure J, Souche E, Sparks SE, Trapane P, Sanchez-Valle A, Vilain E, Vollo A, Waechter CJ, Wang RY, Wolfe LA, Wong DA, Wood T, Yang AC, Matthijs G, Freeze HH", "reference": { "type": "PubMed", "id": "26931382", "url": "https://pubmed.ncbi.nlm.nih.gov/26931382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26931382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Congenital nephrotic syndrome in an infant with ALG1-congenital disorder of glycosylation.", "journal": "Pediatrics international : official journal of the Japan Pediatric Society", "date": "2016-08", "authors": "Harshman Lyndsay A, Ng Bobby G, Freeze Hudson H, Trapane Pamela, Dolezal Anna, Brophy Patrick D, Brumbaugh Jane E", "reference": { "type": "PubMed", "id": "27325525", "url": "https://pubmed.ncbi.nlm.nih.gov/27325525" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "Q9BT22", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q9BT22" }, { "id": "rs28939378", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs28939378" }, { "id": "rs28939378", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs28939378" }, { "id": "rs28939378", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs28939378#frequency_tab" }, { "id": "rs28939378", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs28939378" }, { "id": "14973778", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14973778" }, { "id": "14973782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14973782" }, { "id": "27325525", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27325525" }, { "id": "rs28939378", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs28939378" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 258, "end_pos": 258, "subjects_tested": "1773", "subjects_positive": "1", "frequency": "0.1", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "16", "chr_pos": "5078789", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S258", "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] }, { "disease_id": "DOID:0080563", "recommended_name": { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation Ik", "description": "A congenital disorder of glycosylation I that is characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly and has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding beta-1,4-mannosyltransferase on chromosome 16p13." }, "synonyms": [ { "id": "DOID:0080563", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080563", "name": "congenital disorder of glycosylation 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "A severe form of congenital disorders of N-linked glycosylation characterized by severe developmental and psychomotor delay, muscular hypotonia, intractable early-onset seizures, and microcephaly. Additional features include altered blood coagulation with a high probability of hemorrhages or thromboses, nephrotic syndrome, ascites, hepatomegaly, cardiomyopathy, ocular manifestations (strabismus, nystagmus), and immunodeficiency. The disease is caused by loss-of-function mutations in the gene ALG1 (16p13.3)." }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG-Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "carbohydrate deficient glycoprotein syndrome type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type 1k", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation type Ik", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "mannosyltransferase 1 deficiency", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "ALG1-CDG (CDG-Ik)", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "CDG 1K", "description": "" }, { "id": "MONDO:0012052", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012052", "name": "congenital disorder of glycosylation, type Ik", "description": "" }, { "id": "MIM:608540", "resource": "MIM", "url": "https://www.omim.org/entry/608540", "name": "Congenital disorder of glycosylation 1K", "description": "Congenital disorder of glycosylation 1K" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" }, { "id": "0080563", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080563" } ] }, { "disease_id": "DOID:0080559", "recommended_name": { "id": "DOID:0080559", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080559", "name": "congenital disorder of glycosylation Ig", "description": "A congenital disorder of glycosylation I that is characterized by facial dysmorphism (prominent forehead, large ears, thin upper lip), generalized hypotonia, feeding difficulties, moderate to severe developmental delay, progressive microcephaly, frequent upper respiratory tract infections due to impaired immunity with decreased immunoglobulin levels, and decreased coagulation factors and has_material_basis_in homozygous or compound heterozygous mutation in the gene encoding dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase on chromosome 22q13." }, "synonyms": [ { "id": "DOID:0080559", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080559", "name": "ALG12-congenital disorder of glycosylation", "description": "" }, { "id": "DOID:0080559", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080559", "name": "congenital disorder of glycosylation 1g", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "ALG12-congenital disorder of glycosylation", "description": "A form of congenital disorders of N-linked glycosylation characterized by facial dysmorphism (prominent forehead, large ears, thin upper lip), generalized hypotonia, feeding difficulties, moderate to severe developmental delay, progressive microcephaly, frequent upper respiratory tract infections due to impaired immunity with decreased immunoglobulin levels, and decreased coagulation factors. Additional features include hypogonadism with or without hypospadias in males, skeletal anomalies, seizures and cardiac anomalies in some cases. The disease is caused by loss of function mutations of the gene ALG12 (22q13.33)." }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "ALG12-CDG", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "ALG12-congenital disorder of glycosylation", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "CDG syndrome type Ig", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "CDG-Ig", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "CDG1G", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "CDGIg", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "carbohydrate deficient glycoprotein syndrome type Ig", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "congenital disorder of glycosylation type 1g", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "congenital disorder of glycosylation type Ig", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "mannosyltransferase 8 deficiency", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "ALG12-CDG (CDG-Ig)", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "CDG 1G", "description": "" }, { "id": "MONDO:0011783", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783", "name": "congenital disorder of glycosylation, type Ig", "description": "" }, { "id": "MIM:607143", "resource": "MIM", "url": "https://www.omim.org/entry/607143", "name": "Congenital disorder of glycosylation 1G", "description": "Congenital disorder of glycosylation 1G" } ], "unlinked_id_list": [], "evidence": [ { "id": "0011783", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011783" }, { "id": "607143", "database": "MIM", "url": "https://www.omim.org/entry/607143" }, { "id": "ALG12", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/ALG12/#!details" }, { "id": "79087", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/79087#disease" }, { "id": "0080559", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080559" } ] }, { "disease_id": "DOID:0080390", "recommended_name": { "id": "DOID:0080390", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080390", "name": "nephrotic syndrome type 1", "description": "A familial nephrotic syndrome characterized by prenatal onset of massive proteinuria followed by steroid resistant renal disease that has_material_basis_in homozygous or compound heterozygous mutation in the NPHS1 gene on chromosome 19q13." }, "synonyms": [ { "id": "DOID:0080390", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080390", "name": "Finnish congenital nephrosis", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome, Finnish type", "description": "Congenital nephrotic syndrome, Finnish type is characterized by protein loss beginning during fetal life." }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "Finnish congenital nephrosis", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome - Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome, Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrotic syndrome - NPHS1 associated", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "CnF", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "NPHS1", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome 1", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrosis 1, congenital, Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrosis, congenital", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrotic syndrome, type 1", "description": "" }, { "id": "MIM:256300", "resource": "MIM", "url": "https://www.omim.org/entry/256300", "name": "Nephrotic syndrome 1", "description": "Nephrotic syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080390", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080390" }, { "id": "0080390", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080390" } ] }, { "disease_id": "DOID:2590", "recommended_name": { "id": "DOID:2590", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2590", "name": "familial nephrotic syndrome", "description": "A nephrotic syndrome that has_material_basis_in genetic mutations." }, "synonyms": [ { "id": "DOID:2590", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2590", "name": "Congenital nephrotic syndrome", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome, Finnish type", "description": "Congenital nephrotic syndrome, Finnish type is characterized by protein loss beginning during fetal life." }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "Finnish congenital nephrosis", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome - Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome, Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrotic syndrome - NPHS1 associated", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "CnF", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "NPHS1", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome 1", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "congenital nephrotic syndrome Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrosis 1, congenital, Finnish type", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrosis, congenital", "description": "" }, { "id": "MONDO:0009732", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009732", "name": "nephrotic syndrome, type 1", "description": "" }, { "id": "MIM:256300", "resource": "MIM", "url": "https://www.omim.org/entry/256300", "name": "Nephrotic syndrome 1", "description": "Nephrotic syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "2590", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2590" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "000000000000000100000.00000000000000.000000000001000000.00001.11.000.001", "uniprot_canonical_ac": "Q9BT22-1" } ], "record_id": "pubmed.27325525", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association studies of WD repeat domain 3 and chitobiosyldiphosphodolichol beta-mannosyltransferase genes with schizophrenia in a Japanese population.", "journal": "PloS one", "date": "2018", "authors": "Kobayashi M, Jitoku D, Iwayama Y, Yamamoto N, Toyota T, Suzuki K, Kikuchi M, Hashimoto T, Kanahara N, Kurumaji A, Yoshikawa T, Nishikawa T", "reference": { "type": "PubMed", "id": "29309433", "url": "https://pubmed.ncbi.nlm.nih.gov/29309433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNX4-1", "protein_name": "WD repeat-containing protein 3", "gene_name": "WDR3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29309433", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Topological and enzymatic analysis of human Alg2 mannosyltransferase reveals its role in lipid-linked oligosaccharide biosynthetic pathway.", "journal": "Commun. Biol.", "date": "2022", "authors": "Xiang MH, Xu XX, Wang CD, Chen S, Xu S, Xu XY, Dean N, Wang N, Gao XD", "reference": { "type": "PubMed", "id": "35136180", "url": "https://pubmed.ncbi.nlm.nih.gov/35136180" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H553-1", "protein_name": "Alpha-1,3/1,6-mannosyltransferase ALG2", "gene_name": "ALG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43636-1", "protein_name": "Alpha-1,3/1,6-mannosyltransferase ALG2", "gene_name": "ALG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35136180", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dysregulated proteome and N-glycoproteome in ALG1-deficient fibroblasts.", "journal": "Proteomics", "date": "2024-08", "authors": "Budhraja Rohit, Joshi Neha, Radenkovic Silvia, Kozicz Tamas, Morava Eva, Pandey Akhilesh", "reference": { "type": "PubMed", "id": "38470198", "url": "https://pubmed.ncbi.nlm.nih.gov/38470198" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BT22", "url": "https://www.uniprot.org/uniprotkb/Q9BT22" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38470198", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel frameshift mutations of ANKUB1, GLI3, and TAS2R3 associated with polysyndactyly in a Chinese family.", "journal": "Molecular genetics & genomic medicine", "date": "2020", "authors": "Zhang L, Chen X, Xu L, Guan S, Wang D, Lin Y, Wang Z", "reference": { "type": "PubMed", "id": "32253825", "url": "https://pubmed.ncbi.nlm.nih.gov/32253825" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NFN9-2", "protein_name": "Protein ANKUB1", "gene_name": "ANKUB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYW6-1", "protein_name": "Taste receptor type 2 member 3", "gene_name": "TAS2R3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NFN9", "url": "https://www.uniprot.org/uniprotkb/A6NFN9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32253825", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human AlkB homolog 1 is a mitochondrial protein that demethylates 3-methylcytosine in DNA and RNA.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Westbye MP, Feyzi E, Aas PA, Vagbo CB, Talstad VA, Kavli B, Hagen L, Sundheim O, Akbari M, Liabakk NB, Slupphaug G, Otterlei M, Krokan HE", "reference": { "type": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "I", "sequence_mut": "L", "comment": "Reduces Fe2OG dioxygenase activity by 50%.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 231, "end_pos": 231, "sequence_org": "H", "sequence_mut": "A", "comment": "Near loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 233, "end_pos": 233, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c). Abolished DNAN6-methyl adenine demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "31188562", "url": "https://pubmed.ncbi.nlm.nih.gov/31188562" }, { "database": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 287, "end_pos": 287, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 338, "end_pos": 338, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduced Fe2OG dioxygenase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c).", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 344, "end_pos": 344, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduced Fe2OG dioxygenase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" } ], "record_id": "pubmed.18603530", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human AlkB homologue 1 (ABH1) exhibits DNA lyase activity at abasic sites.", "journal": "DNA repair", "date": "2010", "authors": "Muller TA, Meek K, Hausinger RP", "reference": { "type": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 231, "end_pos": 231, "sequence_org": "H", "sequence_mut": "A", "comment": "Near loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 233, "end_pos": 233, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c). Abolished DNAN6-methyl adenine demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "31188562", "url": "https://pubmed.ncbi.nlm.nih.gov/31188562" }, { "database": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 287, "end_pos": 287, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" } ], "record_id": "pubmed.19959401", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ALKBH1 is a histone H2A dioxygenase involved in neural differentiation.", "journal": "Stem Cells", "date": "2012", "authors": "Ougland R, Lando D, Jonson I, Dahl JA, Moen MN, Nordstrand LM, Rognes T, Lee JT, Klungland A, Kouzarides T, Larsen E", "reference": { "type": "PubMed", "id": "22961808", "url": "https://pubmed.ncbi.nlm.nih.gov/22961808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CB42-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "Alkbh1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22961808", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A covalent protein-DNA 5'-product adduct is generated following AP lyase activity of human ALKBH1 (AlkB homologue 1).", "journal": "The Biochemical journal", "date": "2013", "authors": "Muller TA, Andrzejak MM, Hausinger RP", "reference": { "type": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 116, "end_pos": 116, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 120, "end_pos": 120, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 125, "end_pos": 125, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 133, "end_pos": 133, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced DNA lyase activity. Slightly more reduced DNA lyase activity; when associated with A-25. Strongly reduced activity; when associated with A-154.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 137, "end_pos": 137, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 148, "end_pos": 148, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 154, "end_pos": 154, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity. Strongly reduced activity; when associated with A-133.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 158, "end_pos": 158, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 167, "end_pos": 167, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 182, "end_pos": 182, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 183, "end_pos": 183, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 25, "end_pos": 25, "sequence_org": "K", "sequence_mut": "A", "comment": "Moderate decrease in DNA lyase activity. Reduced DNA lyase activity; when associated with A-133.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 335, "end_pos": 335, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 362, "end_pos": 362, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 381, "end_pos": 381, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 3, "end_pos": 3, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 55, "end_pos": 55, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 61, "end_pos": 61, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "23577621", "url": "https://pubmed.ncbi.nlm.nih.gov/23577621" } ], "uniprot_canonical_ac": "Q13686-1" } ], "record_id": "pubmed.23577621", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homology modeling, molecular dynamics, and site-directed mutagenesis study of AlkB human homolog 1 (ALKBH1).", "journal": "Journal of molecular graphics & modelling", "date": "2014", "authors": "Silvestrov P, Muller TA, Clark KN, Hausinger RP, Cisneros GA", "reference": { "type": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 113, "end_pos": 113, "sequence_org": "H", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 118, "end_pos": 118, "sequence_org": "C", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 129, "end_pos": 129, "sequence_org": "C", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 134, "end_pos": 134, "sequence_org": "H", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 303, "end_pos": 303, "sequence_org": "H", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 304, "end_pos": 304, "sequence_org": "C", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 371, "end_pos": 371, "sequence_org": "C", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 372, "end_pos": 372, "sequence_org": "H", "sequence_mut": "A", "comment": "Does not affect DNA lyase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "25459764", "url": "https://pubmed.ncbi.nlm.nih.gov/25459764" } ], "uniprot_canonical_ac": "Q13686-1" } ], "record_id": "pubmed.25459764", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NSUN3 and ABH1 modify the wobble position of mt-tRNAMet to expand codon recognition in mitochondrial translation.", "journal": "The EMBO journal", "date": "2016", "authors": "Haag S, Sloan KE, Ranjan N, Warda AS, Kretschmer J, Blessing C, Hubner B, Seikowski J, Dennerlein S, Rehling P, Rodnina MV, Hobartner C, Bohnsack MT", "reference": { "type": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H649-1", "protein_name": "tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial", "gene_name": "NSUN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 233, "end_pos": 233, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c). Abolished DNAN6-methyl adenine demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "31188562", "url": "https://pubmed.ncbi.nlm.nih.gov/31188562" }, { "database": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 338, "end_pos": 338, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduced Fe2OG dioxygenase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c).", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 265, "end_pos": 265, "sequence_org": "C", "sequence_mut": "A", "comment": "Catalytic mutant. Abolishes ability to methylate mt-tRNA(Met).", "evidence": [ { "database": "UniProtKB", "id": "Q9H649", "url": "https://www.uniprot.org/uniprotkb/Q9H649" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" } ], "uniprot_canonical_ac": "Q9H649-1" } ], "record_id": "pubmed.27497299", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ALKBH1-Mediated tRNA Demethylation Regulates Translation.", "journal": "Cell", "date": "2016", "authors": "Liu F, Clark W, Luo G, Wang X, Fu Y, Wei J, Wang X, Hao Z, Dai Q, Zheng G, Ma H, Han D, Evans M, Klungland A, Pan T, He C", "reference": { "type": "PubMed", "id": "27745969", "url": "https://pubmed.ncbi.nlm.nih.gov/27745969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CB42-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "Alkbh1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 231, "end_pos": 233, "sequence_org": "HVD", "sequence_mut": "AVA", "comment": "Loss of catalytic activity. Abolishes ability to regulate translation in respose to glucose deprivation.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "27745969", "url": "https://pubmed.ncbi.nlm.nih.gov/27745969" } ], "uniprot_canonical_ac": "Q13686-1" } ], "record_id": "pubmed.27745969", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N(6)-Methyladenine DNA Modification in the Human Genome.", "journal": "Molecular cell", "date": "2018", "authors": "Xiao CL, Zhu S, He M, Chen, Zhang Q, Chen Y, Yu G, Liu J, Xie SQ, Luo F, Liang Z, Wang DP, Bo XC, Gu XF, Wang K, Yan GR", "reference": { "type": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5N5-1", "protein_name": "Methyltransferase HEMK2", "gene_name": "HEMK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 233, "end_pos": 233, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c). Abolished DNAN6-methyl adenine demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "31188562", "url": "https://pubmed.ncbi.nlm.nih.gov/31188562" }, { "database": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" }, { "start_pos": 122, "end_pos": 125, "sequence_org": "NPPY", "sequence_mut": "AAAA", "comment": "Abolished DNA methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y5N5", "url": "https://www.uniprot.org/uniprotkb/Q9Y5N5" }, { "database": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" } ], "uniprot_canonical_ac": "Q9Y5N5-1" } ], "record_id": "pubmed.30017583", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N6-methyladenine DNA Modification in Glioblastoma.", "journal": "Cell", "date": "2018-11-15", "authors": "Xie Qi, Wu Tao P, Gimple Ryan C, Li Zheng, Prager Briana C, Wu Qiulian, Yu Yang, Wang Pengcheng, Wang Yinsheng, Gorkin David U, Zhang Cheng, Dowiak Alexis V, Lin Kaixuan, Zeng Chun, Sui Yinghui, Kim Leo J Y, Miller Tyler E, Jiang Li, Lee Christine H, Huang Zhi, Fang Xiaoguang, Zhai Kui, Mack Stephen C, Sander Maike, Bao Shideng, Kerstetter-Fogle Amber E, Sloan Andrew E, Xiao Andrew Z, Rich Jeremy N", "reference": { "type": "PubMed", "id": "30392959", "url": "https://pubmed.ncbi.nlm.nih.gov/30392959" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5N5-1", "protein_name": "Methyltransferase HEMK2", "gene_name": "HEMK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30392959", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AlkB Homologue 1 Demethylates N(3)-Methylcytidine in mRNA of Mammals.", "journal": "ACS chemical biology", "date": "2019", "authors": "Ma CJ, Ding JH, Ye TT, Yuan BF, Feng YQ", "reference": { "type": "PubMed", "id": "31188562", "url": "https://pubmed.ncbi.nlm.nih.gov/31188562" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 233, "end_pos": 233, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of Fe2OG dioxygenase activity. No effect on DNA lyase activity. Abolishes ability to mediate oxidation of mt-tRNA(Met) methylated at cytosine(34) to form 5-formylcytosine (f(5)c). Abolished DNAN6-methyl adenine demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" }, { "database": "PubMed", "id": "19959401", "url": "https://pubmed.ncbi.nlm.nih.gov/19959401" }, { "database": "PubMed", "id": "27497299", "url": "https://pubmed.ncbi.nlm.nih.gov/27497299" }, { "database": "PubMed", "id": "31188562", "url": "https://pubmed.ncbi.nlm.nih.gov/31188562" }, { "database": "PubMed", "id": "30017583", "url": "https://pubmed.ncbi.nlm.nih.gov/30017583" }, { "database": "PubMed", "id": "18603530", "url": "https://pubmed.ncbi.nlm.nih.gov/18603530" } ], "uniprot_canonical_ac": "Q13686-1" } ], "record_id": "pubmed.31188562", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA demethylase ALKBH1 promotes adipogenic differentiation via regulation of HIF-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2022", "authors": "Liu Y, Chen Y, Wang Y, Jiang S, Lin W, Wu Y, Li Q, Guo Y, Liu W, Yuan Q", "reference": { "type": "PubMed", "id": "34922943", "url": "https://pubmed.ncbi.nlm.nih.gov/34922943" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34922943", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluating the Potential for ABO-incompatible Islet Transplantation: Expression of ABH Antigens on Human Pancreata, Isolated Islets, and Embryonic Stem Cell-derived Islets.", "journal": "Transplantation", "date": "2022-10-13", "authors": "Verhoeff Kevin, Cuesta-Gomez Nerea, Albers Patrick, Pawlick Rena, Marfil-Garza Braulio A, Jasra Ila, Dadheech Nidheesh, O'Gorman Doug, Kin Tatsuya, Halpin Anne, West Lori J, Shapiro A M James", "reference": { "type": "PubMed", "id": "36228319", "url": "https://pubmed.ncbi.nlm.nih.gov/36228319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36228319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ALKBH1 contributes to renal cell carcinoma progression by reducing N6-methyladenine of GPR137.", "journal": "European journal of clinical investigation", "date": "2023-03-15", "authors": "Li Lin, Zhu Chongying, Xu Qiang, Xu Shouying, Ye Jianqing, Xu Da, Wang Lei, Gan Sishun, Liu Bing, Tang Chao", "reference": { "type": "PubMed", "id": "36920340", "url": "https://pubmed.ncbi.nlm.nih.gov/36920340" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96N19-1", "protein_name": "Integral membrane protein GPR137", "gene_name": "GPR137", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36920340", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA 6mA demethylase ALKBH1 regulates DDX18 expression to promote proliferation of human head and neck squamous cell carcinoma.", "journal": "Cellular oncology (Dordrecht)", "date": "2023-08", "authors": "Guo Chengli, Liu Zheming, Zhang Haojian", "reference": { "type": "PubMed", "id": "36976498", "url": "https://pubmed.ncbi.nlm.nih.gov/36976498" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVP1-1", "protein_name": "ATP-dependent RNA helicase DDX18", "gene_name": "DDX18", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36976498", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The N6-methyladenine DNA demethylase ALKBH1 promotes gastric carcinogenesis by disrupting NRF1 binding capacity.", "journal": "Cell reports", "date": "2023-03-28", "authors": "Wang Xiaohong, Wong Chi Chun, Chen Huarong, Fu Kaili, Shi Lingxue, Su Hao, Guo Shang, Gou Hongyan, Hu Xiaoxu, Zhang Lianhai, Ji Jiafu, Yu Jun", "reference": { "type": "PubMed", "id": "36989111", "url": "https://pubmed.ncbi.nlm.nih.gov/36989111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CB42-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "Alkbh1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36989111", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and functional analysis of a human cDNA encoding an Escherichia coli AlkB homolog, a protein involved in DNA alkylation damage repair.", "journal": "Nucleic Acids Res.", "date": "1996", "authors": "Wei YF, Carter KC, Wang RP, Shell BK", "reference": { "type": "PubMed", "id": "8600462", "url": "https://pubmed.ncbi.nlm.nih.gov/8600462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13686", "url": "https://www.uniprot.org/uniprotkb/Q13686" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8600462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AF1q, a differentially expressed gene during neuronal differentiation, transforms HEK cells into neuron-like cells.", "journal": "Brain research. Molecular brain research", "date": "2004", "authors": "Lin HJ, Shaffer KM, Sun Z, Jay G, He WW, Ma W", "reference": { "type": "PubMed", "id": "15530661", "url": "https://pubmed.ncbi.nlm.nih.gov/15530661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97783-1", "protein_name": "Protein AF1q", "gene_name": "Mllt11", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15530661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the functional role of AF1Q in the progression of breast cancer.", "journal": "Breast cancer research and treatment", "date": "2008", "authors": "Chang XZ, Li DQ, Hou YF, Wu J, Lu JS, Di GH, Jin W, Ou ZL, Shen ZZ, Shao ZM", "reference": { "type": "PubMed", "id": "17929166", "url": "https://pubmed.ncbi.nlm.nih.gov/17929166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17929166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncogene AF1q enhances doxorubicin-induced apoptosis through BAD-mediated mitochondrial apoptotic pathway.", "journal": "Molecular cancer therapeutics", "date": "2008", "authors": "Co NN, Tsang WP, Wong TW, Cheung HH, Tsang TY, Kong SK, Kwok TT", "reference": { "type": "PubMed", "id": "18852119", "url": "https://pubmed.ncbi.nlm.nih.gov/18852119" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18852119", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elevated AF1q expression is a poor prognostic marker for adult acute myeloid leukemia patients with normal cytogenetics.", "journal": "American journal of hematology", "date": "2009", "authors": "Strunk CJ, Platzbecker U, Thiede C, Schaich M, Illmer T, Kang Z, Leahy P, Li C, Xie X, Laughlin MJ, Lazarus HM, Gerson SL, Bunting KD, Ehninger G, Tse W", "reference": { "type": "PubMed", "id": "19396856", "url": "https://pubmed.ncbi.nlm.nih.gov/19396856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19396856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway.", "journal": "Blood", "date": "2011", "authors": "Parcelier A, Maharzi N, Delord M, Robledo-Sarmiento M, Nelson E, Belakhdar-Mekid H, Pla M, Kuranda K, Parietti V, Goodhardt M, Legrand N, Bernstein ID, Gluckman JC, Sigaux F, Canque B", "reference": { "type": "PubMed", "id": "21715312", "url": "https://pubmed.ncbi.nlm.nih.gov/21715312" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 24, "end_pos": 32, "sequence_org": "LSELEGLGL", "sequence_mut": "ASEAEGAGA", "comment": "Constitutive nuclear sequestration.", "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" }, { "database": "PubMed", "id": "21715312", "url": "https://pubmed.ncbi.nlm.nih.gov/21715312" } ], "uniprot_canonical_ac": "Q13015-1" } ], "record_id": "pubmed.21715312", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Degradation of AF1Q by chaperone-mediated autophagy.", "journal": "Exp. Cell Res.", "date": "2014", "authors": "Li Peng, Ji Min, Lu Fei, Zhang Jingru, Li Huanjie, Cui Taixing, Li Wang Xing, Tang Dongqi, Ji Chunyan", "reference": { "type": "PubMed", "id": "24880125", "url": "https://pubmed.ncbi.nlm.nih.gov/24880125" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13473-1", "protein_name": "Lysosome-associated membrane glycoprotein 2", "gene_name": "LAMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11142-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "HSPA8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24880125", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis.", "journal": "Oncotarget", "date": "2015-08-21", "authors": "Park Jino, Schlederer Michaela, Schreiber Martin, Ice Ryan, Merkel Olaf, Bilban Martin, Hofbauer Sebastian, Kim Soojin, Addison Joseph, Zou Jie, Ji Chunyan, Bunting Silvia T, Wang Zhengqi, Shoham Menachem, Huang Gang, Bago-Horvath Zsuzsanna, Gibson Laura F, Rojanasakul Yon, Remick Scot, Ivanov Alexey, Pugacheva Elena, Bunting Kevin D, Moriggl Richard, Kenner Lukas, Tse William", "reference": { "type": "PubMed", "id": "26079538", "url": "https://pubmed.ncbi.nlm.nih.gov/26079538" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36402-5", "protein_name": "Transcription factor 7", "gene_name": "TCF7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26079538", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Monoallelic Variant in REST Is Associated with Non-Syndromic Autosomal Dominant Hearing Impairment in a South African Family.", "journal": "Genes", "date": "2021", "authors": "Manyisa N, Schrauwen I, de Souza Rios LA, Mowla S, Tekendo-Ngongang C, Popel K, Esoh K, Bharadwaj T, Nouel-Saied LM, Acharya A, Nasir A, Wonkam-Tingang E, Kock C, Dandara C, Leal SM, Wonkam A", "reference": { "type": "PubMed", "id": "34828371", "url": "https://pubmed.ncbi.nlm.nih.gov/34828371" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34828371", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MLLT11 siRNA Inhibits the Migration and Promotes the Apoptosis of MDA-MB-231 Breast Cancer Cells.", "journal": "The breast journal", "date": "2023", "authors": "Liu Xiangrong, Bai Wenqi, Li Jianrong, Ma Jinfeng, Liu Yan, Wang Zhixiang, Hu Linjie, Li Zheng, Papukashvili Dimitri, Rcheulishvili Nino, Wang Fusheng, Lu Xiaoqing", "reference": { "type": "PubMed", "id": "38075552", "url": "https://pubmed.ncbi.nlm.nih.gov/38075552" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38075552", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MLLT11 Regulates Endometrial Stroma Cell Adhesion, Proliferation and Survival in Ectopic Lesions of Women with Advanced Endometriosis.", "journal": "International journal of molecular sciences", "date": "2023-12-28", "authors": "Proestling Katharina, Husslein Heinrich, Hudson Quanah James, Witzmann-Stern Matthias, Widmar Barbara, Bag\u00f3-Horv\u00e1th Zsuzsanna, Sandrieser Lejla, Perricos Alexandra, Wenzl Ren\u00e9, Yotova Iveta", "reference": { "type": "PubMed", "id": "38203610", "url": "https://pubmed.ncbi.nlm.nih.gov/38203610" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38203610", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel gene, AF1q, fused to MLL in t(1;11)(q21;q23), is specifically expressed in leukemic and immature hematopoietic cells.", "journal": "Blood", "date": "1995", "authors": "Tse W, Zhu W, Chen H S, Cohen A", "reference": { "type": "PubMed", "id": "7833468", "url": "https://pubmed.ncbi.nlm.nih.gov/7833468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13015-1", "protein_name": "Protein AF1q", "gene_name": "MLLT11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13015", "url": "https://www.uniprot.org/uniprotkb/Q13015" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7833468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Organization of the gene for gelatin-binding protein (GBP28).", "journal": "Gene", "date": "1999", "authors": "Saito K, Tobe T, Minoshima S, Asakawa S, Sumiya J, Yoda M, Nakano Y, Shimizu N, Tomita M", "reference": { "type": "PubMed", "id": "10095105", "url": "https://pubmed.ncbi.nlm.nih.gov/10095105" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10095105", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human apM-1, an adipocyte-specific gene linked to the family of TNF's and to genes expressed in activated T cells, is mapped to chromosome 1q21.3-q23, a susceptibility locus identified for familial combined hyperlipidemia (FCH).", "journal": "Biochem. Biophys. Res. Commun.", "date": "1999", "authors": "Schaffler A, Orso E, Palitzsch KD, Buchler C, Drobnik W, Furst A, Scholmerich J, Schmitz G", "reference": { "type": "PubMed", "id": "10403784", "url": "https://pubmed.ncbi.nlm.nih.gov/10403784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10403784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of PPARgamma coactivator-1 through transcription factor docking.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Puigserver P, Adelmant G, Wu Z, Fan M, Xu J, O'Malley B, Spiegelman BM", "reference": { "type": "PubMed", "id": "10558993", "url": "https://pubmed.ncbi.nlm.nih.gov/10558993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10558993", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of AMP-activated protein kinase gamma-subunit isoforms and their role in AMP binding.", "journal": "The Biochemical journal", "date": "2000", "authors": "Cheung PC, Salt IP, Davies SP, Hardie DG, Carling D", "reference": { "type": "PubMed", "id": "10698692", "url": "https://pubmed.ncbi.nlm.nih.gov/10698692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86V24-1", "protein_name": "Adiponectin receptor protein 2", "gene_name": "ADIPOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A54-1", "protein_name": "Adiponectin receptor protein 1", "gene_name": "ADIPOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP71-1", "protein_name": "Carbohydrate-responsive element-binding protein", "gene_name": "MLXIPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGI9-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-3", "gene_name": "PRKAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43741-1", "protein_name": "5'-AMP-activated protein kinase subunit beta-2", "gene_name": "PRKAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGJ0-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-2", "gene_name": "PRKAG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10698692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the human RXRalpha ligand-binding domain bound to its natural ligand: 9-cis retinoic acid.", "journal": "The EMBO journal", "date": "2000-06-01", "authors": "Egea P F, Mitschler A, Rochel N, Ruff M, Chambon P, Moras D", "reference": { "type": "PubMed", "id": "10835357", "url": "https://pubmed.ncbi.nlm.nih.gov/10835357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10835357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asymmetry in the PPARgamma/RXRalpha crystal structure reveals the molecular basis of heterodimerization among nuclear receptors.", "journal": "Molecular cell", "date": "2000-03", "authors": "Gampe R T, Montana V G, Lambert M H, Miller A B, Bledsoe R K, Milburn M V, Kliewer S A, Willson T M, Xu H E", "reference": { "type": "PubMed", "id": "10882139", "url": "https://pubmed.ncbi.nlm.nih.gov/10882139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37231-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "PPARG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10882139", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic structure and mutations in adipose-specific gene, adiponectin.", "journal": "International journal of obesity and related metabolic disorders : journal of the International Association for the Study of Obesity", "date": "2000", "authors": "Takahashi M, Arita Y, Yamagata K, Matsukawa Y, Okutomi K, Horie M, Shimomura I, Hotta K, Kuriyama H, Kihara S, Nakamura T, Yamashita S, Funahashi T, Matsuzawa Y", "reference": { "type": "PubMed", "id": "10918532", "url": "https://pubmed.ncbi.nlm.nih.gov/10918532" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10918532", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adiponectin, a new member of the family of soluble defense collagens, negatively regulates the growth of myelomonocytic progenitors and the functions of macrophages.", "journal": "Blood", "date": "2000", "authors": "Yokota T, Oritani K, Takahashi I, Ishikawa J, Matsuyama A, Ouchi N, Kihara S, Funahashi T, Tenner A J, Tomiyama Y, Matsuzawa Y", "reference": { "type": "PubMed", "id": "10961870", "url": "https://pubmed.ncbi.nlm.nih.gov/10961870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10961870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adiponectin, an adipocyte-derived plasma protein, inhibits endothelial NF-kappaB signaling through a cAMP-dependent pathway.", "journal": "Circulation", "date": "2000", "authors": "Ouchi N, Kihara S, Arita Y, Okamoto Y, Maeda K, Kuriyama H, Hotta K, Nishida M, Takahashi M, Muraguchi M, Ohmoto Y, Nakamura T, Yamashita S, Funahashi T, Matsuzawa Y", "reference": { "type": "PubMed", "id": "10982546", "url": "https://pubmed.ncbi.nlm.nih.gov/10982546" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10982546", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discrete roles for peroxisome proliferator-activated receptor gamma and retinoid X receptor in recruiting nuclear receptor coactivators.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yang W, Rachez C, Freedman LP", "reference": { "type": "PubMed", "id": "11027271", "url": "https://pubmed.ncbi.nlm.nih.gov/11027271" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11027271", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The fat-derived hormone adiponectin reverses insulin resistance associated with both lipoatrophy and obesity.", "journal": "Nature medicine", "date": "2001-08", "authors": "Yamauchi T, Kamon J, Waki H, Terauchi Y, Kubota N, Hara K, Mori Y, Ide T, Murakami K, Tsuboyama-Kasaoka N, Ezaki O, Akanuma Y, Gavrilova O, Vinson C, Reitman M L, Kagechika H, Shudo K, Yoda M, Nakano Y, Tobe K, Nagai R, Kimura S, Tomita M, Froguel P, Kadowaki T", "reference": { "type": "PubMed", "id": "11479627", "url": "https://pubmed.ncbi.nlm.nih.gov/11479627" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60994-1", "protein_name": "Adiponectin", "gene_name": "Adipoq", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11479627", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic variation in the gene encoding adiponectin is associated with an increased risk of type 2 diabetes in the Japanese population.", "journal": "Diabetes", "date": "2002", "authors": "Hara K, Boutin P, Mori Y, Tobe K, Dina C, Yasuda K, Yamauchi T, Otabe S, Okada T, Eto K, Kadowaki H, Hagura R, Akanuma Y, Yazaki Y, Nagai R, Taniyama M, Matsubara K, Yoda M, Nakano Y, Tomita M, Kimura S, Ito C, Froguel P, Kadowaki T", "reference": { "type": "PubMed", "id": "11812766", "url": "https://pubmed.ncbi.nlm.nih.gov/11812766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11812766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of adiponectin mutation with type 2 diabetes: a candidate gene for the insulin resistance syndrome.", "journal": "Diabetes", "date": "2002", "authors": "Kondo H, Shimomura I, Matsukawa Y, Kumada M, Takahashi M, Matsuda M, Ouchi N, Kihara S, Kawamoto T, Sumitsuji S, Funahashi T, Matsuzawa Y", "reference": { "type": "PubMed", "id": "12086969", "url": "https://pubmed.ncbi.nlm.nih.gov/12086969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12086969", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Single-nucleotide polymorphism haplotypes in the both proximal promoter and exon 3 of the APM1 gene modulate adipocyte-secreted adiponectin hormone levels and contribute to the genetic risk for type 2 diabetes in French Caucasians.", "journal": "Human molecular genetics", "date": "2002", "authors": "Vasseur F, Helbecque N, Dina C, Lobbens S, Delannoy V, Gaget S, Boutin P, Vaxillaire M, Lepretre F, Dupont S, Hara K, Clement K, Bihain B, Kadowaki T, Froguel P", "reference": { "type": "PubMed", "id": "12354786", "url": "https://pubmed.ncbi.nlm.nih.gov/12354786" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12354786", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of adiponectin receptors that mediate antidiabetic metabolic effects.", "journal": "Nature", "date": "2003", "authors": "Yamauchi T, Kamon J, Ito Y, Tsuchida A, Yokomizo T, Kita S, Sugiyama T, Miyagishi M, Hara K, Tsunoda M, Murakami K, Ohteki T, Uchida S, Takekawa S, Waki H, Tsuno NH, Shibata Y, Terauchi Y, Froguel P, Tobe K, Koyasu S, Taira K, Kitamura T, Shimizu T, Nagai R, Kadowaki T", "reference": { "type": "PubMed", "id": "12802337", "url": "https://pubmed.ncbi.nlm.nih.gov/12802337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BQS5-1", "protein_name": "Adiponectin receptor protein 2", "gene_name": "Adipor2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86V24-1", "protein_name": "Adiponectin receptor protein 2", "gene_name": "ADIPOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A54-1", "protein_name": "Adiponectin receptor protein 1", "gene_name": "ADIPOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP71-1", "protein_name": "Carbohydrate-responsive element-binding protein", "gene_name": "MLXIPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91VH1-1", "protein_name": "Adiponectin receptor protein 1", "gene_name": "Adipor1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O43741-1", "protein_name": "5'-AMP-activated protein kinase subunit beta-2", "gene_name": "PRKAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGJ0-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-2", "gene_name": "PRKAG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12802337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impaired multimerization of human adiponectin mutants associated with diabetes. Molecular structure and multimer formation of adiponectin.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Waki H, Yamauchi T, Kamon J, Ito Y, Uchida S, Kita S, Hara K, Hada Y, Vasseur F, Froguel P, Kimura S, Nagai R, Kadowaki T", "reference": { "type": "PubMed", "id": "12878598", "url": "https://pubmed.ncbi.nlm.nih.gov/12878598" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86V24-1", "protein_name": "Adiponectin receptor protein 2", "gene_name": "ADIPOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A54-1", "protein_name": "Adiponectin receptor protein 1", "gene_name": "ADIPOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP71-1", "protein_name": "Carbohydrate-responsive element-binding protein", "gene_name": "MLXIPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43741-1", "protein_name": "5'-AMP-activated protein kinase subunit beta-2", "gene_name": "PRKAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGJ0-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-2", "gene_name": "PRKAG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 36, "end_pos": 36, "sequence_org": "C", "sequence_mut": "S", "comment": "Impaired formation of MMW and HMW multimers.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" }, { "database": "PubMed", "id": "12878598", "url": "https://pubmed.ncbi.nlm.nih.gov/12878598" } ], "uniprot_canonical_ac": "Q15848-1" } ], "record_id": "pubmed.12878598", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "9-cis retinoic acid is a high affinity ligand for the retinoid X receptor.", "journal": "Cell", "date": "1992-01-24", "authors": "Heyman R A, Mangelsdorf D J, Dyck J A, Stein R B, Eichele G, Evans R M, Thaller C", "reference": { "type": "PubMed", "id": "1310260", "url": "https://pubmed.ncbi.nlm.nih.gov/1310260" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1310260", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adiponectin multimerization is dependent on conserved lysines in the collagenous domain: evidence for regulation of multimerization by alterations in posttranslational modifications.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Richards AA, Stephens T, Charlton HK, Jones A, Macdonald GA, Prins JB, Whitehead JP", "reference": { "type": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-galactosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "K", "relation": "attached", "comment": "O-linked (Gal...) hydroxylysine;O-galactosylation", "icn3d_view": {}, "start_pos": 101, "start_aa": "Lys", "end_pos": 101, "end_aa": "Lys", "residue": "Lys", "site_lbl": "Lys101", "evidence": [ { "id": "Q15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q15848#ptm_processing" }, { "id": "16497731", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "filter_code": "000000000001000000000.00000100000000.00.01100", "uniprot_canonical_ac": "Q15848-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-galactosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "K", "relation": "attached", "comment": "O-linked (Gal...) hydroxylysine;O-galactosylation", "icn3d_view": {}, "start_pos": 65, "start_aa": "Lys", "end_pos": 65, "end_aa": "Lys", "residue": "Lys", "site_lbl": "Lys65", "evidence": [ { "id": "Q15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q15848#ptm_processing" }, { "id": "16497731", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "filter_code": "000000000001000000000.00000100000000.00.01100", "uniprot_canonical_ac": "Q15848-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-galactosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "K", "relation": "attached", "comment": "O-linked (Gal...) hydroxylysine;O-galactosylation", "icn3d_view": {}, "start_pos": 68, "start_aa": "Lys", "end_pos": 68, "end_aa": "Lys", "residue": "Lys", "site_lbl": "Lys68", "evidence": [ { "id": "Q15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q15848#ptm_processing" }, { "id": "16497731", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "filter_code": "000000000001000000000.00000100000000.00.01100", "uniprot_canonical_ac": "Q15848-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-galactosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "K", "relation": "attached", "comment": "O-linked (Gal...) hydroxylysine;O-galactosylation", "icn3d_view": {}, "start_pos": 77, "start_aa": "Lys", "end_pos": 77, "end_aa": "Lys", "residue": "Lys", "site_lbl": "Lys77", "evidence": [ { "id": "Q15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q15848#ptm_processing" }, { "id": "16497731", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "filter_code": "000000000001000000000.00000100000000.00.01100", "uniprot_canonical_ac": "Q15848-1" } ], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "K", "sequence_mut": "R", "comment": "Impaired formation of HMW multimers; when associated with R-77.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on formation of HMW multimers.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "C", "sequence_mut": "S", "comment": "Impaired formation of MMW and HMW multimers.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" }, { "database": "PubMed", "id": "12878598", "url": "https://pubmed.ncbi.nlm.nih.gov/12878598" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "K", "sequence_mut": "R", "comment": "Impaired formation of HMW multimers; when associated with R-68.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "K", "sequence_mut": "R", "comment": "Impaired formation of HMW multimers; when associated with R-65.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "K", "sequence_mut": "R", "comment": "Impaired formation of HMW multimers; when associated with R-101.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "16497731", "url": "https://pubmed.ncbi.nlm.nih.gov/16497731" } ], "uniprot_canonical_ac": "Q15848-1" } ], "record_id": "pubmed.16497731", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orphan receptor TR3 attenuates the p300-induced acetylation of retinoid X receptor-alpha.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Zhao WX, Tian M, Zhao BX, Li GD, Liu B, Zhan YY, Chen HZ, Wu Q", "reference": { "type": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22736-1", "protein_name": "Nuclear receptor subfamily 4immunitygroup A member 1", "gene_name": "NR4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48443-1", "protein_name": "Retinoic acid receptor RXR-gamma", "gene_name": "RXRG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 133, "end_pos": 156, "sequence_org": "HICAICGDRSSGKHYGVYSCEGCK", "sequence_mut": "", "comment": "Abolishes acetylation by EP300.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" } ], "uniprot_canonical_ac": "P19793-1" }, { "start_pos": 145, "end_pos": 145, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes acetylation by EP300, DNA binding and transcriptional activity. Impairs interaction with EP300.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" } ], "uniprot_canonical_ac": "P19793-1" }, { "start_pos": 206, "end_pos": 216, "sequence_org": "QEERQRGKDRN", "sequence_mut": "", "comment": "No impact on acetylation by EP300.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" } ], "uniprot_canonical_ac": "P19793-1" }, { "start_pos": 352, "end_pos": 462, "sequence_org": "ELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT", "sequence_mut": "", "comment": "No impact on acetylation by EP300.", "evidence": [ { "database": "UniProtKB", "id": "P19793", "url": "https://www.uniprot.org/uniprotkb/P19793" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" } ], "uniprot_canonical_ac": "P19793-1" }, { "start_pos": 1399, "end_pos": 1399, "sequence_org": "D", "sequence_mut": "Y", "comment": "Abolished acetyltransferase and acyltransferase activities. Abolishes autoacetylation. Does not interact with TFAP2A and inhibits transcriptional coactivation of TFAP2A by CITED2. Does not inhibit interaction with CITED2, DNA-binding of TFAP2A or nuclear localization of TFAP2A or CITED2. No enhancement of FOXO1-mediated transcriptional activity. No inhibition of insulin-mediated translocation to the cytoplasm. No acetylation of RXRA.", "evidence": [ { "database": "UniProtKB", "id": "Q09472", "url": "https://www.uniprot.org/uniprotkb/Q09472" }, { "database": "PubMed", "id": "23934153", "url": "https://pubmed.ncbi.nlm.nih.gov/23934153" }, { "database": "PubMed", "id": "15890677", "url": "https://pubmed.ncbi.nlm.nih.gov/15890677" }, { "database": "PubMed", "id": "29775581", "url": "https://pubmed.ncbi.nlm.nih.gov/29775581" }, { "database": "PubMed", "id": "12586840", "url": "https://pubmed.ncbi.nlm.nih.gov/12586840" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" }, { "database": "PubMed", "id": "40240600", "url": "https://pubmed.ncbi.nlm.nih.gov/40240600" } ], "uniprot_canonical_ac": "Q09472-1" }, { "start_pos": 1, "end_pos": 50, "sequence_org": "MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTAL", "sequence_mut": "", "comment": "No impact on the interaction with RXRA.", "evidence": [ { "database": "UniProtKB", "id": "P22736", "url": "https://www.uniprot.org/uniprotkb/P22736" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" } ], "uniprot_canonical_ac": "P22736-1" }, { "start_pos": 299, "end_pos": 361, "sequence_org": "AKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASP", "sequence_mut": "", "comment": "Loss of interaction with RXRA.", "evidence": [ { "database": "UniProtKB", "id": "P22736", "url": "https://www.uniprot.org/uniprotkb/P22736" }, { "database": "PubMed", "id": "17761950", "url": "https://pubmed.ncbi.nlm.nih.gov/17761950" } ], "uniprot_canonical_ac": "P22736-1" } ], "record_id": "pubmed.17761950", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 103 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Y111 H (T415C) polymorphism in exon 3 of the gene encoding adiponectin is uncommon in Polish obese patients.", "journal": "Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme", "date": "2007-11", "authors": "Owecki M, Miczke A, Kaczmarek M, Hoppe-Go\u0142ebiewska J, Pupek-Musialik D, S\u0142omski R, Bryll W, Cymerys M, Nikisch E, Sowi\u0144ski J", "reference": { "type": "PubMed", "id": "17992633", "url": "https://pubmed.ncbi.nlm.nih.gov/17992633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "Y", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "Tyr", "end_pos": 111, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr111", "evidence": [ { "id": "17992633", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17992633" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000000100.00000000001000.00.01001", "uniprot_canonical_ac": "Q15848-1" } ], "record_id": "pubmed.17992633", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Sialic acid modification of adiponectin is not required for multimerization or secretion but determines half-life in circulation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Richards AA, Colgrave ML, Zhang J, Webster J, Simpson F, Preston E, Wilks D, Hoehn KL, Stephenson M, Macdonald GA, Prins JB, Cooney GJ, Xu A, Whitehead JP", "reference": { "type": "PubMed", "id": "19855092", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60994-1", "protein_name": "Adiponectin", "gene_name": "Adipoq", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 21, "start_aa": "Thr", "end_pos": 21, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr21", "evidence": [ { "id": "Q15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q15848#ptm_processing" }, { "id": "19855092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "filter_code": "000000000000000010000.00000010000000.00.01101", "uniprot_canonical_ac": "Q15848-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "Q15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q15848#ptm_processing" }, { "id": "19855092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "filter_code": "000000000000000010000.00000010000000.00.01101", "uniprot_canonical_ac": "Q15848-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "Q60994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q60994#ptm_processing" }, { "id": "19855092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "Q60994-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "Q60994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q60994#ptm_processing" }, { "id": "19855092", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "Q60994-1" } ], "mutagenesis": [ { "start_pos": 20, "end_pos": 20, "sequence_org": "T", "sequence_mut": "A", "comment": "No change in sialylated isoforms.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "19855092", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 21, "end_pos": 21, "sequence_org": "T", "sequence_mut": "A", "comment": "Some loss of sialylated isoforms.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "19855092", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "uniprot_canonical_ac": "Q15848-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes sialylated isoforms.", "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" }, { "database": "PubMed", "id": "19855092", "url": "https://pubmed.ncbi.nlm.nih.gov/19855092" } ], "uniprot_canonical_ac": "Q15848-1" } ], "record_id": "pubmed.19855092", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of a single-chain trimer of human adiponectin globular domain.", "journal": "FEBS Lett.", "date": "2012", "authors": "Min Xiaoshan, Lemon Bryan, Tang Jie, Liu Qiang, Zhang Richard, Walker Nigel, Li Yang, Wang Zhulun", "reference": { "type": "PubMed", "id": "22449980", "url": "https://pubmed.ncbi.nlm.nih.gov/22449980" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22449980", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adipokines, diabetes and atherosclerosis: an inflammatory association.", "journal": "Frontiers in physiology", "date": "2015", "authors": "Freitas Lima LC, Braga VA, do Socorro de Franca Silva M, Cruz JC, Sousa Santos SH, de Oliveira Monteiro MM, Balarini CM", "reference": { "type": "PubMed", "id": "26578976", "url": "https://pubmed.ncbi.nlm.nih.gov/26578976" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86V24-1", "protein_name": "Adiponectin receptor protein 2", "gene_name": "ADIPOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A54-1", "protein_name": "Adiponectin receptor protein 1", "gene_name": "ADIPOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP71-1", "protein_name": "Carbohydrate-responsive element-binding protein", "gene_name": "MLXIPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15831-1", "protein_name": "Serine/threonine-protein kinase STK11", "gene_name": "STK11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43741-1", "protein_name": "5'-AMP-activated protein kinase subunit beta-2", "gene_name": "PRKAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGJ0-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-2", "gene_name": "PRKAG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26578976", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PPAR\u03b3 S273 Phosphorylation Modifies the Dynamics of Coregulator Proteins Recruitment.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Dias Marieli Mariano Gon\u00e7alves, Batista Fernanda Aparecida Heleno, Tittanegro Thais Helena, de Oliveira Andr\u00e9 Gustavo, Le Maire Albane, Torres Felipe Rafael, Filho Helder Veras Ribeiro, Silveira Leonardo Reis, Figueira Ana Carolina Migliorini", "reference": { "type": "PubMed", "id": "33329381", "url": "https://pubmed.ncbi.nlm.nih.gov/33329381" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37231-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "PPARG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 273, "end_pos": 273, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P37231", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P37231" }, { "database": "PubMed", "id": "21892191", "url": "https://pubmed.ncbi.nlm.nih.gov/21892191" }, { "database": "PubMed", "id": "20651683", "url": "https://pubmed.ncbi.nlm.nih.gov/20651683" }, { "database": "PubMed", "id": "21691811", "url": "https://pubmed.ncbi.nlm.nih.gov/21691811" }, { "database": "PubMed", "id": "23320500", "url": "https://pubmed.ncbi.nlm.nih.gov/23320500" }, { "database": "PubMed", "id": "24692390", "url": "https://pubmed.ncbi.nlm.nih.gov/24692390" }, { "database": "PubMed", "id": "24810249", "url": "https://pubmed.ncbi.nlm.nih.gov/24810249" }, { "database": "PubMed", "id": "25734377", "url": "https://pubmed.ncbi.nlm.nih.gov/25734377" }, { "database": "PubMed", "id": "27027223", "url": "https://pubmed.ncbi.nlm.nih.gov/27027223" }, { "database": "PubMed", "id": "27974179", "url": "https://pubmed.ncbi.nlm.nih.gov/27974179" }, { "database": "PubMed", "id": "28811832", "url": "https://pubmed.ncbi.nlm.nih.gov/28811832" }, { "database": "PubMed", "id": "29056962", "url": "https://pubmed.ncbi.nlm.nih.gov/29056962" }, { "database": "PubMed", "id": "29295932", "url": "https://pubmed.ncbi.nlm.nih.gov/29295932" }, { "database": "PubMed", "id": "30199253", "url": "https://pubmed.ncbi.nlm.nih.gov/30199253" }, { "database": "PubMed", "id": "33142057", "url": "https://pubmed.ncbi.nlm.nih.gov/33142057" }, { "database": "PubMed", "id": "33329381", "url": "https://pubmed.ncbi.nlm.nih.gov/33329381" } ], "site_lbl": "Ser273", "uniprot_canonical_ac": "P37231-1" } ], "record_id": "pubmed.33329381", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A dominant negative ADIPOQ mutation in a diabetic family with renal disease, hypoadiponectinemia, and hyperceramidemia.", "journal": "NPJ Genom. Med.", "date": "2022", "authors": "Simeone Christopher A, Wilkerson Joseph L, Poss Annelise M, Banks James A, Varre Joseph V, Guevara Jose Lazaro, Hernandez Edgar Javier, Gorsi Bushra, Atkinson Donald L, Turapov Tursun, Frodsham Scott G, Morales Julio C Fierro, O'Neil Kristina, Moore Barry, Yandell Mark, Summers Scott A, Krolewski Andrzej S, Holland William L, Pezzolesi Marcus G", "reference": { "type": "PubMed", "id": "35869090", "url": "https://pubmed.ncbi.nlm.nih.gov/35869090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35869090", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Weight-loss maintenance is accompanied by interconnected alterations in circulating FGF21-adiponectin-leptin and bioactive sphingolipids.", "journal": "Cell reports. Medicine", "date": "2024-07-16", "authors": "Fiorenza Matteo, Checa Antonio, Sandsdal Rasmus M, Jensen Simon B K, Juhl Christian R, Noer Mikkel H, Bogh Nicolai P, Lundgren Julie R, Janus Charlotte, Stallknecht Bente M, Holst Jens Juul, Madsbad Sten, Wheelock Craig E, Torekov Signe S", "reference": { "type": "PubMed", "id": "38959886", "url": "https://pubmed.ncbi.nlm.nih.gov/38959886" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSA1-1", "protein_name": "Fibroblast growth factor 21", "gene_name": "FGF21", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38959886", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of leptin and adiponectin in the pathogenesis of post-transplant diabetes mellitus.", "journal": "Prostaglandins & other lipid mediators", "date": "2024-10", "authors": "Szumilas Kamila, Wilk Aleksandra, Szumilas Pawe\u0142, Dziedziejko Violetta, Pawlik Andrzej", "reference": { "type": "PubMed", "id": "39032860", "url": "https://pubmed.ncbi.nlm.nih.gov/39032860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41159-1", "protein_name": "Leptin", "gene_name": "LEP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39032860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of adiponectin gene single nucleotide polymorphisms with environmental risk factors in type 2 diabetes mellitus: An updated evidence of haplotype-based analysis study.", "journal": "Gene", "date": "2025-01-15", "authors": "Mamashli Elahe, Goulding Richie P, Iranparvar Manouchehr, Skishahr Farnaz Seifi, Siahkouhian Marefat, Ramezanzade Raziye, Jaspers Richard T, Davarnia Behzad", "reference": { "type": "PubMed", "id": "39128620", "url": "https://pubmed.ncbi.nlm.nih.gov/39128620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39128620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of rs2241766 and rs1501299 polymorphisms in the adiponectin gene with metabolic syndrome.", "journal": "Immunity, inflammation and disease", "date": "2024-09", "authors": "Tang Yinghua, Yin Lianli, Lin Faquan", "reference": { "type": "PubMed", "id": "39290095", "url": "https://pubmed.ncbi.nlm.nih.gov/39290095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39290095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "15-Deoxy-delta 12, 14-prostaglandin J2 is a ligand for the adipocyte determination factor PPAR gamma.", "journal": "Cell", "date": "1995-12-01", "authors": "Forman B M, Tontonoz P, Chen J, Brun R P, Spiegelman B M, Evans R M", "reference": { "type": "PubMed", "id": "8521497", "url": "https://pubmed.ncbi.nlm.nih.gov/8521497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37238-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "Pparg", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8521497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A prostaglandin J2 metabolite binds peroxisome proliferator-activated receptor gamma and promotes adipocyte differentiation.", "journal": "Cell", "date": "1995-12-01", "authors": "Kliewer S A, Lenhard J M, Willson T M, Patel I, Morris D C, Lehmann J M", "reference": { "type": "PubMed", "id": "8521498", "url": "https://pubmed.ncbi.nlm.nih.gov/8521498" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37238-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "Pparg", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8521498", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning and expression of a novel adipose specific collagen-like factor, apM1 (AdiPose Most abundant Gene transcript 1).", "journal": "Biochem. Biophys. Res. Commun.", "date": "1996", "authors": "Maeda K, Okubo K, Shimomura I, Funahashi T, Matsuzawa Y, Matsubara K", "reference": { "type": "PubMed", "id": "8619847", "url": "https://pubmed.ncbi.nlm.nih.gov/8619847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8619847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of GBP28, a novel gelatin-binding protein purified from human plasma.", "journal": "J. Biochem.", "date": "1996", "authors": "Nakano Y, Tobe T, Choi-Miura NH, Mazda T, Tomita M", "reference": { "type": "PubMed", "id": "8947845", "url": "https://pubmed.ncbi.nlm.nih.gov/8947845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8947845", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fatty acids, eicosanoids, and hypolipidemic agents identified as ligands of peroxisome proliferator-activated receptors by coactivator-dependent receptor ligand assay.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1997", "authors": "Krey G, Braissant O, L'Horset F, Kalkhoven E, Perroud M, Parker MG, Wahli W", "reference": { "type": "PubMed", "id": "9171241", "url": "https://pubmed.ncbi.nlm.nih.gov/9171241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96ST3-1", "protein_name": "Paired amphipathic helix protein Sin3a", "gene_name": "SIN3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07148-1", "protein_name": "Fatty acid-binding protein, liver", "gene_name": "FABP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9171241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 109 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ligand binding and co-activator assembly of the peroxisome proliferator-activated receptor-gamma.", "journal": "Nature", "date": "1998", "authors": "Nolte RT, Wisely GB, Westin S, Cobb JE, Lambert MH, Kurokawa R, Rosenfeld MG, Willson TM, Glass CK, Milburn MV", "reference": { "type": "PubMed", "id": "9744270", "url": "https://pubmed.ncbi.nlm.nih.gov/9744270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15848-1", "protein_name": "Adiponectin", "gene_name": "ADIPOQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY76-1", "protein_name": "Angiopoietin-related protein 4", "gene_name": "ANGPTL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEZ4-1", "protein_name": "Histone-lysine N-methyltransferase 2C", "gene_name": "KMT2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15291-1", "protein_name": "Retinoblastoma-binding protein 5", "gene_name": "RBBP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZW49-6", "protein_name": "PAX-interacting protein 1", "gene_name": "PAXIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37231-1", "protein_name": "Peroxisome proliferator-activated receptor gamma", "gene_name": "PPARG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16654-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial", "gene_name": "PDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Q9-1", "protein_name": "Nuclear receptor coactivator 3", "gene_name": "NCOA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13227-1", "protein_name": "G protein pathway suppressor 2", "gene_name": "GPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49715-1", "protein_name": "CCAAT/enhancer-binding protein alpha", "gene_name": "CEBPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05469-1", "protein_name": "Hormone-sensitive lipase", "gene_name": "LIPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14693-1", "protein_name": "Phosphatidate phosphatase LPIN1", "gene_name": "LPIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75448-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 24", "gene_name": "MED24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X0-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "MED16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVC6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "MED17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHV7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "MED13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H944-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "MED20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2C8-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 27", "gene_name": "MED27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULK4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 23", "gene_name": "MED23", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60244-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "MED14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTT4-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "MED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15550-1", "protein_name": "Lysine-specific demethylase 6A", "gene_name": "KDM6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15120-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "AGPAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75586-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD7-1", "protein_name": "Diacylglycerol O-acyltransferase 2", "gene_name": "DGAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43513-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00482-1", "protein_name": "Nuclear receptor subfamily 5 group A member 2", "gene_name": "NR5A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15090-1", "protein_name": "Fatty acid-binding protein, adipocyte", "gene_name": "FABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL3-1", "protein_name": "Set1/Ash2 histone methyltransferase complex subunit ASH2", "gene_name": "ASH2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C005-1", "protein_name": "Protein dpy-30 homolog", "gene_name": "DPY30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61964-1", "protein_name": "WD repeat-containing protein 5", "gene_name": "WDR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00767-1", "protein_name": "Stearoyl-CoA desaturase", "gene_name": "SCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R3-1", "protein_name": "Acyl-CoA synthetase short-chain family member 3, mitochondrial", "gene_name": "ACSS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IF1-1", "protein_name": "LIM domain-containing protein ajuba", "gene_name": "AJUBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPJ6-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14686-1", "protein_name": "Histone-lysine N-methyltransferase 2D", "gene_name": "KMT2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3C7-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "MED31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00535-1", "protein_name": "Cyclin-dependent kinase 5", "gene_name": "CDK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCL2-1", "protein_name": "Glycerol-3-phosphate acyltransferase 1, mitochondrial", "gene_name": "GPAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99541-1", "protein_name": "Perilipin-2", "gene_name": "PLIN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q06-1", "protein_name": "Perilipin-4", "gene_name": "PLIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AD5-1", "protein_name": "Patatin-like phospholipase domain-containing protein 2", "gene_name": "PNPLA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60240-1", "protein_name": "Perilipin-1", "gene_name": "PLIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75192-1", "protein_name": "Peroxisomal membrane protein 11A", "gene_name": "PEX11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YN6-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-beta", "gene_name": "PPARGC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92748-1", "protein_name": "Thyroid hormone-inducible hepatic protein", "gene_name": "THRSP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24863-1", "protein_name": "Cyclin-C", "gene_name": "CCNC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49336-1", "protein_name": "Cyclin-dependent kinase 8", "gene_name": "CDK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HR3-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 30", "gene_name": "MED30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTK6-1", "protein_name": "PAXIP1-associated glutamate-rich protein 1", "gene_name": "PAGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV24-1", "protein_name": "Pleckstrin homology-like domain family A member 1", "gene_name": "PHLDA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93074-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "MED12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99685-1", "protein_name": "Monoglyceride lipase", "gene_name": "MGLL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15848", "url": "https://www.uniprot.org/uniprotkb/Q15848" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9744270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acyl carrier protein-specific 4'-phosphopantetheinyl transferase activates 10-formyltetrahydrofolate dehydrogenase.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Strickland KC, Hoeferlin LA, Oleinik NV, Krupenko NI, Krupenko SA", "reference": { "type": "PubMed", "id": "19933275", "url": "https://pubmed.ncbi.nlm.nih.gov/19933275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3SY69-1", "protein_name": "Mitochondrial 10-formyltetrahydrofolate dehydrogenase", "gene_name": "ALDH1L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75891-1", "protein_name": "Cytosolic 10-formyltetrahydrofolate dehydrogenase", "gene_name": "ALDH1L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRN7-1", "protein_name": "L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase", "gene_name": "AASDHPPT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3SY69", "url": "https://www.uniprot.org/uniprotkb/Q3SY69" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 354, "end_pos": 354, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphopantetheinylation by AASDHPPT. Loss of formyltetrahydrofolate dehydrogenase activity.", "evidence": [ { "database": "UniProtKB", "id": "O75891", "url": "https://www.uniprot.org/uniprotkb/O75891" }, { "database": "PubMed", "id": "19933275", "url": "https://pubmed.ncbi.nlm.nih.gov/19933275" } ], "uniprot_canonical_ac": "O75891-1" } ], "record_id": "pubmed.19933275", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ALDH1L2 regulation of formate, formyl-methionine, and ROS controls cancer cell migration and metastasis.", "journal": "Cell reports", "date": "2023-05-26", "authors": "Hennequart Marc, Pilley Steven E, Labuschagne Christiaan F, Coomes Jack, Mervant Loic, Driscoll Paul C, Legrave Nathalie M, Lee Younghwan, Kreuzaler Peter, Macintyre Benedict, Panina Yulia, Blagih Julianna, Stevenson David, Strathdee Douglas, Schneider-Luftman Deborah, Gr\u00f6nroos Eva, Cheung Eric C, Yuneva Mariia, Swanton Charles, Vousden Karen H", "reference": { "type": "PubMed", "id": "37245210", "url": "https://pubmed.ncbi.nlm.nih.gov/37245210" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3SY69-1", "protein_name": "Mitochondrial 10-formyltetrahydrofolate dehydrogenase", "gene_name": "ALDH1L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3SY69", "url": "https://www.uniprot.org/uniprotkb/Q3SY69" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37245210", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Further delineation of the phenotypic and metabolomic profile of ALDH1L2-related neurodevelopmental disorder.", "journal": "Clinical genetics", "date": "2024-01-09", "authors": "You Mikyoung, Shamseldin Hanan E, Fogle Halle M, Rushing Blake R, AlMalki Reem H, Jaafar Amal, Hashem Mais, Abdulwahab Firdous, Abdel Rahman Anas M, Krupenko Natalia I, Alkuraya Fowzan S, Krupenko Sergey A", "reference": { "type": "PubMed", "id": "38193334", "url": "https://pubmed.ncbi.nlm.nih.gov/38193334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3SY69-1", "protein_name": "Mitochondrial 10-formyltetrahydrofolate dehydrogenase", "gene_name": "ALDH1L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3SY69", "url": "https://www.uniprot.org/uniprotkb/Q3SY69" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38193334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FOXO1 induced fatty acid oxidation in hepatic cells by targeting ALDH1L2.", "journal": "Journal of gastroenterology and hepatology", "date": "2024-10", "authors": "Cheng Jiemin, Yang Siqi, Shou Diwen, Chen Jiawei, Li Yongqiang, Huang Chen, Chen Huiting, Zhou Yongjian", "reference": { "type": "PubMed", "id": "38923573", "url": "https://pubmed.ncbi.nlm.nih.gov/38923573" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3SY69-1", "protein_name": "Mitochondrial 10-formyltetrahydrofolate dehydrogenase", "gene_name": "ALDH1L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K009-1", "protein_name": "Mitochondrial 10-formyltetrahydrofolate dehydrogenase", "gene_name": "Aldh1l2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3SY69", "url": "https://www.uniprot.org/uniprotkb/Q3SY69" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38923573", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of TMEM16E and TMEM16F genes in silico.", "journal": "Int. J. Oncol.", "date": "2004", "authors": "Katoh M, Katoh M", "reference": { "type": "PubMed", "id": "15067359", "url": "https://pubmed.ncbi.nlm.nih.gov/15067359" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4KMQ2", "url": "https://www.uniprot.org/uniprotkb/Q4KMQ2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15067359", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Compound heterozygosity for 2 novel TMEM16F mutations in a patient with Scott syndrome.", "journal": "Blood", "date": "2011", "authors": "Castoldi E, Collins PW, Williamson PL, Bevers EM", "reference": { "type": "PubMed", "id": "21511967", "url": "https://pubmed.ncbi.nlm.nih.gov/21511967" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4KMQ2", "url": "https://www.uniprot.org/uniprotkb/Q4KMQ2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21511967", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and function of epithelial anoctamins.", "journal": "Experimental physiology", "date": "2012-02", "authors": "Kunzelmann Karl, Schreiber Rainer, Kmit Arthur, Jantarajit Walailak, Martins Joana Raquel, Faria Diana, Kongsuphol Patthara, Ousingsawat Jiraporn, Tian Yuemin", "reference": { "type": "PubMed", "id": "21908539", "url": "https://pubmed.ncbi.nlm.nih.gov/21908539" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4KMQ2", "url": "https://www.uniprot.org/uniprotkb/Q4KMQ2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21908539", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anoctamin 6 is an essential component of the outwardly rectifying chloride channel.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-11-01", "authors": "Martins Joana Raquel, Faria Diana, Kongsuphol Patthara, Reisch Barbara, Schreiber Rainer, Kunzelmann Karl", "reference": { "type": "PubMed", "id": "22006324", "url": "https://pubmed.ncbi.nlm.nih.gov/22006324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q4KMQ2", "url": "https://www.uniprot.org/uniprotkb/Q4KMQ2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22006324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]