[ { "title": "Low follistatin level is a causal risk factor for spontaneous abortion: a two-sample mendelian randomization study.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Gong Chen, Yang Wenzhi, Liu Xue, Li Xinliang, Wang Yutong, Tian Chan", "reference": { "type": "PubMed", "id": "38234423", "url": "https://pubmed.ncbi.nlm.nih.gov/38234423" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19883-1", "protein_name": "Follistatin", "gene_name": "FST", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P19883", "url": "https://www.uniprot.org/uniprotkb/P19883" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38234423", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Potential Utility of Urinary Follistatin as a Non-Invasive Indicator of Acute Tubular Damage in Patients with Acute Kidney Injury.", "journal": "Cells", "date": "2024-03-16", "authors": "Nagayama Izumi, Takayanagi Kaori, Nagata Daisuke, Hasegawa Hajime, Maeshima Akito", "reference": { "type": "PubMed", "id": "38534369", "url": "https://pubmed.ncbi.nlm.nih.gov/38534369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19883-1", "protein_name": "Follistatin", "gene_name": "FST", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P19883", "url": "https://www.uniprot.org/uniprotkb/P19883" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38534369", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Follistatin-respiratory connection predicting all-cause mortality among community-dwelling middle-to-old age individuals: Results from the I-Lan Longitudinal Study.", "journal": "The journal of nutrition, health & aging", "date": "2024-08", "authors": "Shen Hsiao-Chin, Lee Wei-Ju, Sun Chuan-Yen, Yu Wen-Kuang, Chen Wei-Chih, Hsiao Fei-Yuan, Yang Kuang-Yao, Chen Liang-Kung", "reference": { "type": "PubMed", "id": "38861881", "url": "https://pubmed.ncbi.nlm.nih.gov/38861881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19883-1", "protein_name": "Follistatin", "gene_name": "FST", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P19883", "url": "https://www.uniprot.org/uniprotkb/P19883" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38861881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ki-1/57 interacts with RACK1 and is a substrate for the phosphorylation by phorbol 12-myristate 13-acetate-activated protein kinase C.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Nery FC, Passos DO, Garcia VS, Kobarg J", "reference": { "type": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JVS0-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "HABP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "P05129-1", "kinase_gene_name": "PRKCG", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "Q04759-1", "kinase_gene_name": "PRKCQ", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "Q05513-1", "kinase_gene_name": "PRKCZ", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "Q05655-1", "kinase_gene_name": "PRKCD", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" }, { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr354", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "P05129-1", "kinase_gene_name": "PRKCG", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "Q04759-1", "kinase_gene_name": "PRKCQ", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "Q05513-1", "kinase_gene_name": "PRKCZ", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "Q05655-1", "kinase_gene_name": "PRKCD", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" }, { "database": "iPTMnet", "id": "Q5JVS0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5JVS0" }, { "database": "PubMed", "id": "14699138", "url": "https://pubmed.ncbi.nlm.nih.gov/14699138" } ], "site_lbl": "Thr375", "uniprot_canonical_ac": "Q5JVS0-1" } ], "record_id": "pubmed.14699138", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for the interaction of the regulatory protein Ki-1/57 with p53 and its interacting proteins.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Nery FC, Rui E, Kuniyoshi TM, Kobarg J", "reference": { "type": "PubMed", "id": "16455055", "url": "https://pubmed.ncbi.nlm.nih.gov/16455055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JVS0-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "HABP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16455055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "From protein interaction profile to functional assignment: the human protein Ki-1/57 is associated with pre-mRNA splicing events.", "journal": "RNA biology", "date": "2010", "authors": "Bressan GC, Kobarg J", "reference": { "type": "PubMed", "id": "20436279", "url": "https://pubmed.ncbi.nlm.nih.gov/20436279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JVS0-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "HABP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20436279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Confirmation of linkage to and localization of familial colon cancer risk haplotype on chromosome 9q22.", "journal": "Cancer research", "date": "2010", "authors": "Gray-McGuire C, Guda K, Adrianto I, Lin CP, Natale L, Potter JD, Newcomb P, Poole EM, Ulrich CM, Lindor N, Goode EL, Fridley BL, Jenkins R, Le Marchand L, Casey G, Haile R, Hopper J, Jenkins M, Young J, Buchanan D, Gallinger S, Adams M, Lewis S, Willis J, Elston R, Markowitz SD, Wiesner GL", "reference": { "type": "PubMed", "id": "20551049", "url": "https://pubmed.ncbi.nlm.nih.gov/20551049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JVS0-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "HABP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20551049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization, mapping and partial cDNA sequence of the 57-kD intracellular Ki-1 antigen.", "journal": "Exp. Clin. Immunogenet.", "date": "1997", "authors": "Kobarg J, Schnittger S, Fonatsch C, Lemke H, Bowen MA, Buck F, Hansen HP", "reference": { "type": "PubMed", "id": "9523163", "url": "https://pubmed.ncbi.nlm.nih.gov/9523163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JVS0-1", "protein_name": "Intracellular hyaluronan-binding protein 4", "gene_name": "HABP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JVS0", "url": "https://www.uniprot.org/uniprotkb/Q5JVS0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9523163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate binding stabilizes S-adenosylhomocysteine hydrolase in a closed conformation.", "journal": "Biochemistry", "date": "2000-08-15", "authors": "Yin D, Yang X, Hu Y, Kuczera K, Schowen R L, Borchardt R T, Squier T C", "reference": { "type": "PubMed", "id": "10933798", "url": "https://pubmed.ncbi.nlm.nih.gov/10933798" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10933798", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S-adenosylhomocysteine hydrolase deficiency in a human: a genetic disorder of methionine metabolism.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Baric I, Fumic K, Glenn B, Cuk M, Schulze A, Finkelstein JD, James SJ, Mejaski-Bosnjak V, Pazanin L, Pogribny IP, Rados M, Sarnavka V, Scukanec-Spoljar M, Allen RH, Stabler S, Uzelac L, Vugrek O, Wagner C, Zeisel S, Mudd SH", "reference": { "type": "PubMed", "id": "15024124", "url": "https://pubmed.ncbi.nlm.nih.gov/15024124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15024124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effect of genetic variation in the human S-adenosylhomocysteine hydrolase gene on total homocysteine concentrations and risk of recurrent venous thrombosis.", "journal": "Eur. J. Hum. Genet.", "date": "2004", "authors": "Gellekink Henkjan, den Heijer Martin, Kluijtmans Leo A J, Blom Henk J", "reference": { "type": "PubMed", "id": "15241484", "url": "https://pubmed.ncbi.nlm.nih.gov/15241484" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15241484", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S-adenosylhomocysteine hydrolase deficiency in a 26-year-old man.", "journal": "Journal of inherited metabolic disease", "date": "2006", "authors": "Buist NR, Glenn B, Vugrek O, Wagner C, Stabler S, Allen RH, Pogribny I, Schulze A, Zeisel SH, Baric I, Mudd SH", "reference": { "type": "PubMed", "id": "16736098", "url": "https://pubmed.ncbi.nlm.nih.gov/16736098" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16736098", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A single mutation at Tyr143 of human S-adenosylhomocysteine hydrolase renders the enzyme thermosensitive and affects the oxidation state of bound cofactor nicotinamide-adenine dinucleotide.", "journal": "The Biochemical journal", "date": "2006-12-01", "authors": "Beluzi\u0107 Robert, Cuk Mario, Pavkov Tea, Fumi\u0107 Ksenija, Bari\u0107 Ivo, Mudd S Harvey, Jurak Igor, Vugrek Oliver", "reference": { "type": "PubMed", "id": "16872278", "url": "https://pubmed.ncbi.nlm.nih.gov/16872278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 115, "end_pos": 115, "sequence_org": "E", "sequence_mut": "L", "comment": "Slightly reduced adenosylhomocysteinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "16872278", "url": "https://pubmed.ncbi.nlm.nih.gov/16872278" } ], "uniprot_canonical_ac": "P23526-1" } ], "record_id": "pubmed.16872278", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S-Adenosylhomocysteine hydrolase (AdoHcyase) deficiency: enzymatic capabilities of human AdoHcyase are highly effected by changes to codon 89 and its surrounding residues.", "journal": "Biochemical and biophysical research communications", "date": "2008-03-28", "authors": "Beluzi\u0107 R, Cuk M, Pavkov T, Bari\u0107 I, Vugrek O", "reference": { "type": "PubMed", "id": "18211827", "url": "https://pubmed.ncbi.nlm.nih.gov/18211827" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 84, "end_pos": 84, "sequence_org": "T", "sequence_mut": "A", "comment": "Severely decreased adenosylhomocysteinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "18211827", "url": "https://pubmed.ncbi.nlm.nih.gov/18211827" } ], "uniprot_canonical_ac": "P23526-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "T", "sequence_mut": "S", "comment": "Decreased adenosylhomocysteinase activity; when associated with V-89.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "18211827", "url": "https://pubmed.ncbi.nlm.nih.gov/18211827" } ], "uniprot_canonical_ac": "P23526-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "T", "sequence_mut": "S", "comment": "No effect on adenosylhomocysteinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "18211827", "url": "https://pubmed.ncbi.nlm.nih.gov/18211827" } ], "uniprot_canonical_ac": "P23526-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "A", "sequence_mut": "V", "comment": "Decreased adenosylhomocysteinase activity; when associated with S-84.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "18211827", "url": "https://pubmed.ncbi.nlm.nih.gov/18211827" } ], "uniprot_canonical_ac": "P23526-1" } ], "record_id": "pubmed.18211827", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S-adenosylhomocysteine hydrolase (AHCY) deficiency: two novel mutations with lethal outcome.", "journal": "Human mutation", "date": "2009", "authors": "Vugrek O, Beluzic R, Nakic N, Mudd SH", "reference": { "type": "PubMed", "id": "19177456", "url": "https://pubmed.ncbi.nlm.nih.gov/19177456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19177456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S-adenosylhomocysteine hydrolase deficiency: two siblings with fetal hydrops and fatal outcomes.", "journal": "Journal of inherited metabolic disease", "date": "2010", "authors": "Grubbs R, Vugrek O, Deisch J, Wagner C, Stabler S, Allen R, Baric I, Rados M, Mudd SH", "reference": { "type": "PubMed", "id": "20852937", "url": "https://pubmed.ncbi.nlm.nih.gov/20852937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20852937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical picture of S-adenosylhomocysteine hydrolase deficiency resembles phosphomannomutase 2 deficiency.", "journal": "Molecular genetics and metabolism", "date": "2012-11", "authors": "Honz\u00edk Tom\u00e1\u0161, Magner Martin, Krijt Jakub, Sokolov\u00e1 Jitka, Vugrek Oliver, Belu\u017ei\u0107 Robert, Bari\u0107 Ivo, Hans\u00edkova Hana, Elleder Milan, Vesel\u00e1 Kate\u0159ina, Bauerov\u00e1 Lenka, Ondru\u0161kov\u00e1 Nina, Je\u0161ina Pavel, Zeman Ji\u0159\u00ed, Ko\u017eich Viktor", "reference": { "type": "PubMed", "id": "22959829", "url": "https://pubmed.ncbi.nlm.nih.gov/22959829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22959829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isozyme and DNA analysis of human S-adenosyl-L-homocysteine hydrolase (AHCY).", "journal": "Ann. Hum. Genet.", "date": "1989", "authors": "Arredondo-Vega FX, Charlton JA, Edwards YH, Hopkinson DA, Whitehouse DB", "reference": { "type": "PubMed", "id": "2574561", "url": "https://pubmed.ncbi.nlm.nih.gov/2574561" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2574561", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence of full length cDNA for human S-adenosylhomocysteine hydrolase.", "journal": "Ann. Hum. Genet.", "date": "1989", "authors": "Coulter-Karis D E, Hershfield M S", "reference": { "type": "PubMed", "id": "2596825", "url": "https://pubmed.ncbi.nlm.nih.gov/2596825" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2596825", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Liver transplantation for treatment of severe S-adenosylhomocysteine hydrolase deficiency.", "journal": "Molecular genetics and metabolism", "date": "2015", "authors": "Strauss Kevin A, Ferreira Carlos, Bottiglieri Teodoro, Zhao Xueqing, Arning Erland, Zhang Shucha, Zeisel Steven H, Escolar Maria L, Presnick Nancy, Puffenberger Erik G, Vugrek Oliver, Kovacevic Lucija, Wagner Conrad, Mazariegos George V, Mudd S Harvey, Soltys Kyle", "reference": { "type": "PubMed", "id": "26095522", "url": "https://pubmed.ncbi.nlm.nih.gov/26095522" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26095522", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in S-adenosylhomocysteine hydrolase (AHCY) affect its nucleocytoplasmic distribution and capability to interact with S-adenosylhomocysteine hydrolase-like 1 protein.", "journal": "European journal of cell biology", "date": "2017", "authors": "Grbesa I, Kalo A, Beluzic R, Kovacevic L, Lepur A, Rokic F, Hochberg H, Kanter I, Simunovic V, Munoz-Torres PM, Shav-Tal Y, Vugrek O", "reference": { "type": "PubMed", "id": "28647132", "url": "https://pubmed.ncbi.nlm.nih.gov/28647132" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 127, "sequence_org": "MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNM", "sequence_mut": "", "comment": "Affects nuclear-cytoplasmic protein distribution resulting in increased protein amount in the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "28647132", "url": "https://pubmed.ncbi.nlm.nih.gov/28647132" } ], "uniprot_canonical_ac": "P23526-1" }, { "start_pos": 365, "end_pos": 432, "sequence_org": "QVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY", "sequence_mut": "", "comment": "Affects nuclear-cytoplasmic protein distribution resulting in increased protein amount in the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "28647132", "url": "https://pubmed.ncbi.nlm.nih.gov/28647132" } ], "uniprot_canonical_ac": "P23526-1" }, { "start_pos": 7, "end_pos": 7, "sequence_org": "Y", "sequence_mut": "F", "comment": "Does not affect nuclear-cytoplasmic protein distribution resulting in subcellular localization similar to the wild-type protein.", "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" }, { "database": "PubMed", "id": "28647132", "url": "https://pubmed.ncbi.nlm.nih.gov/28647132" } ], "uniprot_canonical_ac": "P23526-1" } ], "record_id": "pubmed.28647132", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic and transcriptomic profiling of hepatoid adenocarcinoma of the stomach.", "journal": "Oncogene", "date": "2021", "authors": "Liu Z, Wang A, Pu Y, Li Z, Xue R, Zhang C, Xiang X, E JY, Bu Z, Bai F, Ji J", "reference": { "type": "PubMed", "id": "34326469", "url": "https://pubmed.ncbi.nlm.nih.gov/34326469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34326469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metabolic profiling stratifies colorectal cancer and reveals adenosylhomocysteinase as a therapeutic target.", "journal": "Nature metabolism", "date": "2023-08", "authors": "Vande Voorde Johan, Steven Rory T, Najumudeen Arafath K, Ford Catriona A, Dexter Alex, Gonzalez-Fernandez Ariadna, Nikula Chelsea J, Xiang Yuchen, Ford Lauren, Maneta Stavrakaki Stefania, Gilroy Kathryn, Zeiger Lucas B, Pennel Kathryn, Hatthakarnkul Phimmada, Elia Efstathios A, Nasif Ammar, Murta Teresa, Manoli Eftychios, Mason Sam, Gillespie Michael, Lannagan Tamsin R M, Vlahov Nikola, Ridgway Rachel A, Nixon Colin, Raven Alexander, Mills Megan, Athineos Dimitris, Kanellos Georgios, Nourse Craig, Gay David M, Hughes Mark, Burton Amy, Yan Bin, Sellers Katherine, Wu Vincen, De Ridder Kobe, Shokry Engy, Huerta Uribe Alejandro, Clark William, Clark Graeme, Kirschner Kristina, Thienpont Bernard, Li Vivian S W, Maddocks Oliver D K, Barry Simon T, Goodwin Richard J A, Kinross James, Edwards Joanne, Yuneva Mariia O, Sumpton David, Takats Zoltan, Campbell Andrew D, Bunch Josephine, Sansom Owen J", "reference": { "type": "PubMed", "id": "37580540", "url": "https://pubmed.ncbi.nlm.nih.gov/37580540" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50247-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "Ahcy", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37580540", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of S-Adenosylhomocysteine Hydrolase Downregulation on Wnt Signaling Pathway in SW480 Cells.", "journal": "International journal of molecular sciences", "date": "2023-11-08", "authors": "Pavi\u010di\u0107 Ivana, Roki\u0107 Filip, Vugrek Oliver", "reference": { "type": "PubMed", "id": "38003292", "url": "https://pubmed.ncbi.nlm.nih.gov/38003292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38003292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of AHCY impedes proliferation and differentiation of mouse and human adipocyte progenitor cells.", "journal": "Adipocyte", "date": "2024-12", "authors": "Boczki Paula, Colombo Marco, Weiner Juliane, Rap\u00f6hn Inka, Lacher Martin, Kiess Wieland, Hanschkow Martha, K\u00f6rner Antje, Landgraf Kathrin", "reference": { "type": "PubMed", "id": "38064408", "url": "https://pubmed.ncbi.nlm.nih.gov/38064408" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50247-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "Ahcy", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38064408", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Photoaffinity labeling of human placental S-adenosylhomocysteine hydrolase with [2-3H]8-azido-adenosine.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Yuan C S, Borchardt R T", "reference": { "type": "PubMed", "id": "7608178", "url": "https://pubmed.ncbi.nlm.nih.gov/7608178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7608178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Limited proteolysis of S-adenosylhomocysteine hydrolase: implications for the three-dimensional structure.", "journal": "Arch. Biochem. Biophys.", "date": "1995", "authors": "Gupta R A, Yuan C S, Ault-Rich\u00e9 D B, Borchardt R T", "reference": { "type": "PubMed", "id": "7786017", "url": "https://pubmed.ncbi.nlm.nih.gov/7786017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23526-1", "protein_name": "Adenosylhomocysteinase", "gene_name": "AHCY", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P23526", "url": "https://www.uniprot.org/uniprotkb/P23526" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7786017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA sequence of human p11 calpactin I light chain.", "journal": "Genomics", "date": "1992", "authors": "Dooley TP, Weiland KL, Simon M", "reference": { "type": "PubMed", "id": "1386341", "url": "https://pubmed.ncbi.nlm.nih.gov/1386341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1386341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of the human gene encoding p11: structural similarity to other members of the S-100 gene family.", "journal": "Gene", "date": "1992", "authors": "Harder T, Kube E, Gerke V", "reference": { "type": "PubMed", "id": "1533380", "url": "https://pubmed.ncbi.nlm.nih.gov/1533380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1533380", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure of human, chicken, and Xenopus laevis p11, a cellular ligand of the Src-kinase substrate, annexin II.", "journal": "Gene", "date": "1991", "authors": "Kube E, Weber K, Gerke V", "reference": { "type": "PubMed", "id": "1831433", "url": "https://pubmed.ncbi.nlm.nih.gov/1831433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27003-1", "protein_name": "Protein S100-A10", "gene_name": "LOC121107546; S100A10", "tax_name": "Chicken" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1831433", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S100 calcium-binding protein A10 contributes to malignant traits in osteosarcoma cells by regulating glycolytic metabolism via the AKT/mTOR pathway.", "journal": "Bioengineered", "date": "2022", "authors": "Ling F, Lu Q", "reference": { "type": "PubMed", "id": "35579448", "url": "https://pubmed.ncbi.nlm.nih.gov/35579448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35579448", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S100A10 promotes HCC development and progression via transfer in extracellular vesicles and regulating their protein cargos.", "journal": "Gut", "date": "2023-01-11", "authors": "Wang Xia, Huang Hongyang, Sze Karen Man-Fong, Wang Jin, Tian Lu, Lu Jingyi, Tsui Yu-Man, Ma Hoi Tang, Lee Eva, Chen Ao, Lee Joyce, Wang Ying, Yam Judy Wai Ping, Cheung Tan-To, Guan Xinyuan, Ng Irene Oi-Lin", "reference": { "type": "PubMed", "id": "36631249", "url": "https://pubmed.ncbi.nlm.nih.gov/36631249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36631249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[S100A10 promotes proliferation and invasion of lung adenocarcinoma cells by activating the Akt-mTOR signaling pathway].", "journal": "Nan fang yi ke da xue xue bao = Journal of Southern Medical University", "date": "2023-05-20", "authors": "Wang H, Sun Z, Zhao W, Geng B", "reference": { "type": "PubMed", "id": "37313814", "url": "https://pubmed.ncbi.nlm.nih.gov/37313814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37313814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accumulation of annexin A2 and S100A10 prevents apoptosis of apically delaminated, transformed epithelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2023-10-24", "authors": "Ito Shoko, Kuromiya Keisuke, Sekai Miho, Sako Hiroaki, Sai Kazuhito, Morikawa Riho, Mukai Yohei, Ida Yoko, Anzai Moe, Ishikawa Susumu, Kozawa Kei, Shirai Takanobu, Tanimura Nobuyuki, Sugie Kenta, Ikenouchi Junichi, Ogawa Motoyuki, Naguro Isao, Ichijo Hidenori, Fujita Yasuyuki", "reference": { "type": "PubMed", "id": "37844241", "url": "https://pubmed.ncbi.nlm.nih.gov/37844241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37844241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S100A10 promotes cancer metastasis via recruitment of MDSCs within the lungs.", "journal": "Oncoimmunology", "date": "2024", "authors": "Li Juan, Zhou Can, Gao Xiaoqian, Tan Tan, Zhang Miao, Li Yazhao, Chen He, Wang Ruiqi, Wang Bo, Liu Jie, Liu Peijun", "reference": { "type": "PubMed", "id": "39071160", "url": "https://pubmed.ncbi.nlm.nih.gov/39071160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P60903-1", "protein_name": "Protein S100-A10", "gene_name": "S100A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P60903", "url": "https://www.uniprot.org/uniprotkb/P60903" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39071160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human scribble (Vartul) is targeted for ubiquitin-mediated degradation by the high-risk papillomavirus E6 proteins and the E6AP ubiquitin-protein ligase.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Nakagawa S, Huibregtse JM", "reference": { "type": "PubMed", "id": "11027293", "url": "https://pubmed.ncbi.nlm.nih.gov/11027293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11027293", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hScrib is a functional homologue of the Drosophila tumour suppressor Scribble.", "journal": "Oncogene", "date": "2003", "authors": "Dow LE, Brumby AM, Muratore R, Coombe ML, Sedelies KA, Trapani JA, Russell SM, Richardson HE, Humbert PO", "reference": { "type": "PubMed", "id": "14681682", "url": "https://pubmed.ncbi.nlm.nih.gov/14681682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14681682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the expression and localisation of a LAP protein, human scribble, in the normal and neoplastic epithelium of uterine cervix.", "journal": "British journal of cancer", "date": "2004", "authors": "Nakagawa S, Yano T, Nakagawa K, Takizawa S, Suzuki Y, Yasugi T, Huibregtse JM, Taketani Y", "reference": { "type": "PubMed", "id": "14710229", "url": "https://pubmed.ncbi.nlm.nih.gov/14710229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14710229", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Junctional recruitment of mammalian Scribble relies on E-cadherin engagement.", "journal": "Oncogene", "date": "2005", "authors": "Navarro C, Nola S, Audebert S, Santoni MJ, Arsanto JP, Ginestier C, Marchetto S, Jacquemier J, Isnardon D, Le Bivic A, Birnbaum D, Borg JP", "reference": { "type": "PubMed", "id": "15806148", "url": "https://pubmed.ncbi.nlm.nih.gov/15806148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80U72-3", "protein_name": "Protein scribble homolog", "gene_name": "Scrib", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 305, "end_pos": 305, "sequence_org": "P", "sequence_mut": "L", "comment": "Decreased palmitoylation. Loss of localization at the plasma membrane. Loss of targeting to cell-cell junctions. Alters interaction with TJP2. Loss of pro-apoptotic function. Loss of function in epithelial cell polarization and signaling pathways regulation. Abolishes interaction with YES1 in the closed conformation and instead facilitates SCRIB interaction with YES1 in an open conformation.", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "15182672", "url": "https://pubmed.ncbi.nlm.nih.gov/15182672" }, { "database": "PubMed", "id": "19041750", "url": "https://pubmed.ncbi.nlm.nih.gov/19041750" }, { "database": "PubMed", "id": "15806148", "url": "https://pubmed.ncbi.nlm.nih.gov/15806148" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" }, { "database": "PubMed", "id": "33730553", "url": "https://pubmed.ncbi.nlm.nih.gov/33730553" } ], "uniprot_canonical_ac": "Q14160-3" } ], "record_id": "pubmed.15806148", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mammalian Scribble polarity protein regulates epithelial cell adhesion and migration through E-cadherin.", "journal": "The Journal of cell biology", "date": "2005-12-19", "authors": "Qin Yi, Capaldo Christopher, Gumbiner Barry M, Macara Ian G", "reference": { "type": "PubMed", "id": "16344308", "url": "https://pubmed.ncbi.nlm.nih.gov/16344308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16344308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human homolog of Drosophila tumor suppressor Scribble negatively regulates cell-cycle progression from G1 to S phase by localizing at the basolateral membrane in epithelial cells.", "journal": "Cancer science", "date": "2006-11", "authors": "Nagasaka Kazunori, Nakagawa Shunsuke, Yano Tetsu, Takizawa Shin, Matsumoto Yoko, Tsuruga Tetsushi, Nakagawa Keiichi, Minaguchi Takeo, Oda Katsutoshi, Hiraike-Wada Osamu, Ooishi Hajime, Yasugi Toshiharu, Taketani Yuji", "reference": { "type": "PubMed", "id": "16965391", "url": "https://pubmed.ncbi.nlm.nih.gov/16965391" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16965391", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tick-borne encephalitis virus NS5 associates with membrane protein scribble and impairs interferon-stimulated JAK-STAT signalling.", "journal": "Cell. Microbiol.", "date": "2008", "authors": "Werme Karin, Wigerius Michael, Johansson Magnus", "reference": { "type": "PubMed", "id": "18042258", "url": "https://pubmed.ncbi.nlm.nih.gov/18042258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18042258", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of human Scribble cooperates with H-Ras to promote cell invasion through deregulation of MAPK signalling.", "journal": "Oncogene", "date": "2008-10-09", "authors": "Dow L E, Elsum I A, King C L, Kinross K M, Richardson H E, Humbert P O", "reference": { "type": "PubMed", "id": "18641685", "url": "https://pubmed.ncbi.nlm.nih.gov/18641685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18641685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cell polarity regulator hScrib controls ERK activation through a KIM site-dependent interaction.", "journal": "Oncogene", "date": "2010", "authors": "Nagasaka K, Pim D, Massimi P, Thomas M, Tomaic V, Subbaiah VK, Kranjec C, Nakagawa S, Yano T, Taketani Y, Myers M, Banks L", "reference": { "type": "PubMed", "id": "20622900", "url": "https://pubmed.ncbi.nlm.nih.gov/20622900" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1445, "end_pos": 1445, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "20622900", "url": "https://pubmed.ncbi.nlm.nih.gov/20622900" } ], "site_lbl": "Ser1445", "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 1448, "end_pos": 1448, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "20622900", "url": "https://pubmed.ncbi.nlm.nih.gov/20622900" } ], "site_lbl": "Ser1448", "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 553, "end_pos": 553, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "20622900", "url": "https://pubmed.ncbi.nlm.nih.gov/20622900" } ], "site_lbl": "Thr553", "uniprot_canonical_ac": "Q14160-3" } ], "record_id": "pubmed.20622900", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel interaction between hScrib and PP1gamma downregulates ERK signaling and suppresses oncogene-induced cell transformation.", "journal": "PloS one", "date": "2013", "authors": "Nagasaka K, Seiki T, Yamashita A, Massimi P, Subbaiah VK, Thomas M, Kranjec C, Kawana K, Nakagawa S, Yano T, Taketani Y, Fujii T, Kozuma S, Banks L", "reference": { "type": "PubMed", "id": "23359326", "url": "https://pubmed.ncbi.nlm.nih.gov/23359326" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1445, "end_pos": 1445, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "23359326", "url": "https://pubmed.ncbi.nlm.nih.gov/23359326" } ], "site_lbl": "Ser1445", "uniprot_canonical_ac": "Q14160-3" } ], "record_id": "pubmed.23359326", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinase-interacting substrate screening is a novel method to identify kinase substrates.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Amano M, Hamaguchi T, Shohag MH, Kozawa K, Kato K, Zhang X, Yura Y, Matsuura Y, Kataoka C, Nishioka T, Kaibuchi K", "reference": { "type": "PubMed", "id": "26101221", "url": "https://pubmed.ncbi.nlm.nih.gov/26101221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1378, "end_pos": 1378, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "IEDB", "id": "Q14160", "url": "https://www.iedb.org/epitope/Q14160" }, { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "27920218", "url": "https://pubmed.ncbi.nlm.nih.gov/27920218" }, { "database": "PubMed", "id": "26101221", "url": "https://pubmed.ncbi.nlm.nih.gov/26101221" } ], "site_lbl": "Ser1378", "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 1508, "end_pos": 1508, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "26101221", "url": "https://pubmed.ncbi.nlm.nih.gov/26101221" } ], "site_lbl": "Ser1508", "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 1529, "end_pos": 1529, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14160" }, { "database": "PubMed", "id": "26101221", "url": "https://pubmed.ncbi.nlm.nih.gov/26101221" } ], "site_lbl": "Thr1529", "uniprot_canonical_ac": "Q14160-3" } ], "record_id": "pubmed.26101221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZDHHC7-mediated S-palmitoylation of Scribble regulates cell polarity.", "journal": "Nature chemical biology", "date": "2016", "authors": "Chen B, Zheng B, DeRan M, Jarugumilli GK, Fu J, Brooks YS, Wu X", "reference": { "type": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXF8-1", "protein_name": "Palmitoyltransferase ZDHHC7", "gene_name": "ZDHHC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 10, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of palmitoylation. Loss of palmitoylation, localization to cell-cell junctions and function in epithelial cell polarization and signaling pathways regulation; when associated with S-4.", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" } ], "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" } ], "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 305, "end_pos": 305, "sequence_org": "P", "sequence_mut": "L", "comment": "Decreased palmitoylation. Loss of localization at the plasma membrane. Loss of targeting to cell-cell junctions. Alters interaction with TJP2. Loss of pro-apoptotic function. Loss of function in epithelial cell polarization and signaling pathways regulation. Abolishes interaction with YES1 in the closed conformation and instead facilitates SCRIB interaction with YES1 in an open conformation.", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "15182672", "url": "https://pubmed.ncbi.nlm.nih.gov/15182672" }, { "database": "PubMed", "id": "19041750", "url": "https://pubmed.ncbi.nlm.nih.gov/19041750" }, { "database": "PubMed", "id": "15806148", "url": "https://pubmed.ncbi.nlm.nih.gov/15806148" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" }, { "database": "PubMed", "id": "33730553", "url": "https://pubmed.ncbi.nlm.nih.gov/33730553" } ], "uniprot_canonical_ac": "Q14160-3" }, { "start_pos": 4, "end_pos": 4, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of palmitoylation. Loss of palmitoylation, localization to cell-cell junctions and function in epithelial cell polarization and signaling pathways regulation; when associated with S-10.", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" } ], "uniprot_canonical_ac": "Q14160-3" } ], "phosphorylation": [ { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LATS1 and LATS2", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "IEDB", "id": "P46937", "url": "https://www.iedb.org/epitope/P46937" }, { "database": "iPTMnet", "id": "P46937", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46937" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PRO", "id": "P46937", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P46937" }, { "database": "PubMed", "id": "20153295", "url": "https://pubmed.ncbi.nlm.nih.gov/20153295" }, { "database": "PubMed", "id": "21214929", "url": "https://pubmed.ncbi.nlm.nih.gov/21214929" }, { "database": "PubMed", "id": "21945154", "url": "https://pubmed.ncbi.nlm.nih.gov/21945154" }, { "database": "PubMed", "id": "12535517", "url": "https://pubmed.ncbi.nlm.nih.gov/12535517" }, { "database": "PubMed", "id": "18725387", "url": "https://pubmed.ncbi.nlm.nih.gov/18725387" }, { "database": "PubMed", "id": "19878874", "url": "https://pubmed.ncbi.nlm.nih.gov/19878874" }, { "database": "PubMed", "id": "20048001", "url": "https://pubmed.ncbi.nlm.nih.gov/20048001" }, { "database": "PubMed", "id": "20729916", "url": "https://pubmed.ncbi.nlm.nih.gov/20729916" }, { "database": "PubMed", "id": "20823509", "url": "https://pubmed.ncbi.nlm.nih.gov/20823509" }, { "database": "PubMed", "id": "21224387", "url": "https://pubmed.ncbi.nlm.nih.gov/21224387" }, { "database": "PubMed", "id": "21730131", "url": "https://pubmed.ncbi.nlm.nih.gov/21730131" }, { "database": "PubMed", "id": "21909427", "url": "https://pubmed.ncbi.nlm.nih.gov/21909427" }, { "database": "PubMed", "id": "22329991", "url": "https://pubmed.ncbi.nlm.nih.gov/22329991" }, { "database": "PubMed", "id": "22614006", "url": "https://pubmed.ncbi.nlm.nih.gov/22614006" }, { "database": "PubMed", "id": "22761457", "url": "https://pubmed.ncbi.nlm.nih.gov/22761457" }, { "database": "PubMed", "id": "22884261", "url": "https://pubmed.ncbi.nlm.nih.gov/22884261" }, { "database": "PubMed", "id": "23593160", "url": "https://pubmed.ncbi.nlm.nih.gov/23593160" }, { "database": "PubMed", "id": "23708000", "url": "https://pubmed.ncbi.nlm.nih.gov/23708000" }, { "database": "PubMed", "id": "23727052", "url": "https://pubmed.ncbi.nlm.nih.gov/23727052" }, { "database": "PubMed", "id": "23857250", "url": "https://pubmed.ncbi.nlm.nih.gov/23857250" }, { "database": "PubMed", "id": "23928732", "url": "https://pubmed.ncbi.nlm.nih.gov/23928732" }, { "database": "PubMed", "id": "24040060", "url": "https://pubmed.ncbi.nlm.nih.gov/24040060" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24509725", "url": "https://pubmed.ncbi.nlm.nih.gov/24509725" }, { "database": "PubMed", "id": "24525530", "url": "https://pubmed.ncbi.nlm.nih.gov/24525530" }, { "database": "PubMed", "id": "24621512", "url": "https://pubmed.ncbi.nlm.nih.gov/24621512" }, { "database": "PubMed", "id": "25317030", "url": "https://pubmed.ncbi.nlm.nih.gov/25317030" }, { "database": "PubMed", "id": "25393475", "url": "https://pubmed.ncbi.nlm.nih.gov/25393475" }, { "database": "PubMed", "id": "25601544", "url": "https://pubmed.ncbi.nlm.nih.gov/25601544" }, { "database": "PubMed", "id": "25751139", "url": "https://pubmed.ncbi.nlm.nih.gov/25751139" }, { "database": "PubMed", "id": "25751140", "url": "https://pubmed.ncbi.nlm.nih.gov/25751140" }, { "database": "PubMed", "id": "26265440", "url": "https://pubmed.ncbi.nlm.nih.gov/26265440" }, { "database": "PubMed", "id": "26269582", "url": "https://pubmed.ncbi.nlm.nih.gov/26269582" }, { "database": "PubMed", "id": "26364602", "url": "https://pubmed.ncbi.nlm.nih.gov/26364602" }, { "database": "PubMed", "id": "26417066", "url": "https://pubmed.ncbi.nlm.nih.gov/26417066" }, { "database": "PubMed", "id": "26567630", "url": "https://pubmed.ncbi.nlm.nih.gov/26567630" }, { "database": "PubMed", "id": "26625308", "url": "https://pubmed.ncbi.nlm.nih.gov/26625308" }, { "database": "PubMed", "id": "26625714", "url": "https://pubmed.ncbi.nlm.nih.gov/26625714" }, { "database": "PubMed", "id": "26806348", "url": "https://pubmed.ncbi.nlm.nih.gov/26806348" }, { "database": "PubMed", "id": "26843620", "url": "https://pubmed.ncbi.nlm.nih.gov/26843620" }, { "database": "PubMed", "id": "26876920", "url": "https://pubmed.ncbi.nlm.nih.gov/26876920" }, { "database": "PubMed", "id": "26967905", "url": "https://pubmed.ncbi.nlm.nih.gov/26967905" }, { "database": "PubMed", "id": "27000077", "url": "https://pubmed.ncbi.nlm.nih.gov/27000077" }, { "database": "PubMed", "id": "27009203", "url": "https://pubmed.ncbi.nlm.nih.gov/27009203" }, { "database": "PubMed", "id": "27030211", "url": "https://pubmed.ncbi.nlm.nih.gov/27030211" }, { "database": "PubMed", "id": "27034169", "url": "https://pubmed.ncbi.nlm.nih.gov/27034169" }, { "database": "PubMed", "id": "27065882", "url": "https://pubmed.ncbi.nlm.nih.gov/27065882" }, { "database": "PubMed", "id": "27144834", "url": "https://pubmed.ncbi.nlm.nih.gov/27144834" }, { "database": "PubMed", "id": "27203549", "url": "https://pubmed.ncbi.nlm.nih.gov/27203549" }, { "database": "PubMed", "id": "27205883", "url": "https://pubmed.ncbi.nlm.nih.gov/27205883" }, { "database": "PubMed", "id": "27206784", "url": "https://pubmed.ncbi.nlm.nih.gov/27206784" }, { "database": "PubMed", "id": "27324437", "url": "https://pubmed.ncbi.nlm.nih.gov/27324437" }, { "database": "PubMed", "id": "27334574", "url": "https://pubmed.ncbi.nlm.nih.gov/27334574" }, { "database": "PubMed", "id": "27336605", "url": "https://pubmed.ncbi.nlm.nih.gov/27336605" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" }, { "database": "PubMed", "id": "27409837", "url": "https://pubmed.ncbi.nlm.nih.gov/27409837" }, { "database": "PubMed", "id": "27457617", "url": "https://pubmed.ncbi.nlm.nih.gov/27457617" }, { "database": "PubMed", "id": "27462448", "url": "https://pubmed.ncbi.nlm.nih.gov/27462448" }, { "database": "PubMed", "id": "27476430", "url": "https://pubmed.ncbi.nlm.nih.gov/27476430" }, { "database": "PubMed", "id": "27488962", "url": "https://pubmed.ncbi.nlm.nih.gov/27488962" }, { "database": "PubMed", "id": "27555231", "url": "https://pubmed.ncbi.nlm.nih.gov/27555231" }, { "database": "PubMed", "id": "27556512", "url": "https://pubmed.ncbi.nlm.nih.gov/27556512" }, { "database": "PubMed", "id": "27566107", "url": "https://pubmed.ncbi.nlm.nih.gov/27566107" }, { "database": "PubMed", "id": "27634386", "url": "https://pubmed.ncbi.nlm.nih.gov/27634386" }, { "database": "PubMed", "id": "27669292", "url": "https://pubmed.ncbi.nlm.nih.gov/27669292" }, { "database": "PubMed", "id": "27871934", "url": "https://pubmed.ncbi.nlm.nih.gov/27871934" }, { "database": "PubMed", "id": "27907036", "url": "https://pubmed.ncbi.nlm.nih.gov/27907036" }, { "database": "PubMed", "id": "27911857", "url": "https://pubmed.ncbi.nlm.nih.gov/27911857" }, { "database": "PubMed", "id": "28065575", "url": "https://pubmed.ncbi.nlm.nih.gov/28065575" }, { "database": "PubMed", "id": "28076850", "url": "https://pubmed.ncbi.nlm.nih.gov/28076850" }, { "database": "PubMed", "id": "28098159", "url": "https://pubmed.ncbi.nlm.nih.gov/28098159" }, { "database": "PubMed", "id": "28102225", "url": "https://pubmed.ncbi.nlm.nih.gov/28102225" }, { "database": "PubMed", "id": "28169360", "url": "https://pubmed.ncbi.nlm.nih.gov/28169360" }, { "database": "PubMed", "id": "28239148", "url": "https://pubmed.ncbi.nlm.nih.gov/28239148" }, { "database": "PubMed", "id": "28332498", "url": "https://pubmed.ncbi.nlm.nih.gov/28332498" }, { "database": "PubMed", "id": "28339095", "url": "https://pubmed.ncbi.nlm.nih.gov/28339095" }, { "database": "PubMed", "id": "28376152", "url": "https://pubmed.ncbi.nlm.nih.gov/28376152" }, { "database": "PubMed", "id": "28406163", "url": "https://pubmed.ncbi.nlm.nih.gov/28406163" }, { "database": "PubMed", "id": "28420424", "url": "https://pubmed.ncbi.nlm.nih.gov/28420424" }, { "database": "PubMed", "id": "28454447", "url": "https://pubmed.ncbi.nlm.nih.gov/28454447" }, { "database": "PubMed", "id": "28464980", "url": "https://pubmed.ncbi.nlm.nih.gov/28464980" }, { "database": "PubMed", "id": "28470935", "url": "https://pubmed.ncbi.nlm.nih.gov/28470935" }, { "database": "PubMed", "id": "28671675", "url": "https://pubmed.ncbi.nlm.nih.gov/28671675" }, { "database": "PubMed", "id": "28708445", "url": "https://pubmed.ncbi.nlm.nih.gov/28708445" }, { "database": "PubMed", "id": "28725753", "url": "https://pubmed.ncbi.nlm.nih.gov/28725753" }, { "database": "PubMed", "id": "28745364", "url": "https://pubmed.ncbi.nlm.nih.gov/28745364" }, { "database": "PubMed", "id": "28757481", "url": "https://pubmed.ncbi.nlm.nih.gov/28757481" }, { "database": "PubMed", "id": "28815883", "url": "https://pubmed.ncbi.nlm.nih.gov/28815883" }, { "database": "PubMed", "id": "28827520", "url": "https://pubmed.ncbi.nlm.nih.gov/28827520" }, { "database": "PubMed", "id": "28923839", "url": "https://pubmed.ncbi.nlm.nih.gov/28923839" }, { "database": "PubMed", "id": "28951205", "url": "https://pubmed.ncbi.nlm.nih.gov/28951205" }, { "database": "PubMed", "id": "28969054", "url": "https://pubmed.ncbi.nlm.nih.gov/28969054" }, { "database": "PubMed", "id": "29066438", "url": "https://pubmed.ncbi.nlm.nih.gov/29066438" }, { "database": "PubMed", "id": "29069755", "url": "https://pubmed.ncbi.nlm.nih.gov/29069755" }, { "database": "PubMed", "id": "29093443", "url": "https://pubmed.ncbi.nlm.nih.gov/29093443" }, { "database": "PubMed", "id": "29136529", "url": "https://pubmed.ncbi.nlm.nih.gov/29136529" }, { "database": "PubMed", "id": "29154888", "url": "https://pubmed.ncbi.nlm.nih.gov/29154888" }, { "database": "PubMed", "id": "29212185", "url": "https://pubmed.ncbi.nlm.nih.gov/29212185" }, { "database": "PubMed", "id": "29228705", "url": "https://pubmed.ncbi.nlm.nih.gov/29228705" }, { "database": "PubMed", "id": "29296196", "url": "https://pubmed.ncbi.nlm.nih.gov/29296196" }, { "database": "PubMed", "id": "29339449", "url": "https://pubmed.ncbi.nlm.nih.gov/29339449" }, { "database": "PubMed", "id": "29487715", "url": "https://pubmed.ncbi.nlm.nih.gov/29487715" }, { "database": "PubMed", "id": "29496737", "url": "https://pubmed.ncbi.nlm.nih.gov/29496737" }, { "database": "PubMed", "id": "29535383", "url": "https://pubmed.ncbi.nlm.nih.gov/29535383" }, { "database": "PubMed", "id": "29562176", "url": "https://pubmed.ncbi.nlm.nih.gov/29562176" }, { "database": "PubMed", "id": "29725063", "url": "https://pubmed.ncbi.nlm.nih.gov/29725063" }, { "database": "PubMed", "id": "29758328", "url": "https://pubmed.ncbi.nlm.nih.gov/29758328" }, { "database": "PubMed", "id": "29891922", "url": "https://pubmed.ncbi.nlm.nih.gov/29891922" }, { "database": "PubMed", "id": "29895829", "url": "https://pubmed.ncbi.nlm.nih.gov/29895829" }, { "database": "PubMed", "id": "29903769", "url": "https://pubmed.ncbi.nlm.nih.gov/29903769" }, { "database": "PubMed", "id": "29909276", "url": "https://pubmed.ncbi.nlm.nih.gov/29909276" }, { "database": "PubMed", "id": "29930727", "url": "https://pubmed.ncbi.nlm.nih.gov/29930727" }, { "database": "PubMed", "id": "30037330", "url": "https://pubmed.ncbi.nlm.nih.gov/30037330" }, { "database": "PubMed", "id": "30139767", "url": "https://pubmed.ncbi.nlm.nih.gov/30139767" }, { "database": "PubMed", "id": "30250159", "url": "https://pubmed.ncbi.nlm.nih.gov/30250159" }, { "database": "PubMed", "id": "30272278", "url": "https://pubmed.ncbi.nlm.nih.gov/30272278" }, { "database": "PubMed", "id": "30404014", "url": "https://pubmed.ncbi.nlm.nih.gov/30404014" }, { "database": "PubMed", "id": "30446657", "url": "https://pubmed.ncbi.nlm.nih.gov/30446657" }, { "database": "PubMed", "id": "30466467", "url": "https://pubmed.ncbi.nlm.nih.gov/30466467" }, { "database": "PubMed", "id": "30504771", "url": "https://pubmed.ncbi.nlm.nih.gov/30504771" }, { "database": "PubMed", "id": "30559289", "url": "https://pubmed.ncbi.nlm.nih.gov/30559289" }, { "database": "PubMed", "id": "30565133", "url": "https://pubmed.ncbi.nlm.nih.gov/30565133" }, { "database": "PubMed", "id": "30566960", "url": "https://pubmed.ncbi.nlm.nih.gov/30566960" }, { "database": "PubMed", "id": "30574018", "url": "https://pubmed.ncbi.nlm.nih.gov/30574018" }, { "database": "PubMed", "id": "30618636", "url": "https://pubmed.ncbi.nlm.nih.gov/30618636" }, { "database": "PubMed", "id": "30631061", "url": "https://pubmed.ncbi.nlm.nih.gov/30631061" }, { "database": "PubMed", "id": "30824374", "url": "https://pubmed.ncbi.nlm.nih.gov/30824374" }, { "database": "PubMed", "id": "30833665", "url": "https://pubmed.ncbi.nlm.nih.gov/30833665" }, { "database": "PubMed", "id": "30865227", "url": "https://pubmed.ncbi.nlm.nih.gov/30865227" }, { "database": "PubMed", "id": "30935014", "url": "https://pubmed.ncbi.nlm.nih.gov/30935014" }, { "database": "PubMed", "id": "30948712", "url": "https://pubmed.ncbi.nlm.nih.gov/30948712" }, { "database": "PubMed", "id": "31015465", "url": "https://pubmed.ncbi.nlm.nih.gov/31015465" }, { "database": "PubMed", "id": "31076104", "url": "https://pubmed.ncbi.nlm.nih.gov/31076104" }, { "database": "PubMed", "id": "31100067", "url": "https://pubmed.ncbi.nlm.nih.gov/31100067" }, { "database": "PubMed", "id": "31139191", "url": "https://pubmed.ncbi.nlm.nih.gov/31139191" }, { "database": "PubMed", "id": "31142342", "url": "https://pubmed.ncbi.nlm.nih.gov/31142342" }, { "database": "PubMed", "id": "31145543", "url": "https://pubmed.ncbi.nlm.nih.gov/31145543" }, { "database": "PubMed", "id": "31208368", "url": "https://pubmed.ncbi.nlm.nih.gov/31208368" }, { "database": "PubMed", "id": "31296870", "url": "https://pubmed.ncbi.nlm.nih.gov/31296870" }, { "database": "PubMed", "id": "31307004", "url": "https://pubmed.ncbi.nlm.nih.gov/31307004" }, { "database": "PubMed", "id": "31455378", "url": "https://pubmed.ncbi.nlm.nih.gov/31455378" }, { "database": "PubMed", "id": "31477715", "url": "https://pubmed.ncbi.nlm.nih.gov/31477715" }, { "database": "PubMed", "id": "31487690", "url": "https://pubmed.ncbi.nlm.nih.gov/31487690" }, { "database": "PubMed", "id": "31619268", "url": "https://pubmed.ncbi.nlm.nih.gov/31619268" }, { "database": "PubMed", "id": "31627466", "url": "https://pubmed.ncbi.nlm.nih.gov/31627466" }, { "database": "PubMed", "id": "31649888", "url": "https://pubmed.ncbi.nlm.nih.gov/31649888" }, { "database": "PubMed", "id": "31659153", "url": "https://pubmed.ncbi.nlm.nih.gov/31659153" }, { "database": "PubMed", "id": "31669263", "url": "https://pubmed.ncbi.nlm.nih.gov/31669263" }, { "database": "PubMed", "id": "31690112", "url": "https://pubmed.ncbi.nlm.nih.gov/31690112" }, { "database": "PubMed", "id": "31693448", "url": "https://pubmed.ncbi.nlm.nih.gov/31693448" }, { "database": "PubMed", "id": "31717606", "url": "https://pubmed.ncbi.nlm.nih.gov/31717606" }, { "database": "PubMed", "id": "31788086", "url": "https://pubmed.ncbi.nlm.nih.gov/31788086" }, { "database": "PubMed", "id": "31827075", "url": "https://pubmed.ncbi.nlm.nih.gov/31827075" }, { "database": "PubMed", "id": "31835563", "url": "https://pubmed.ncbi.nlm.nih.gov/31835563" }, { "database": "PubMed", "id": "31926547", "url": "https://pubmed.ncbi.nlm.nih.gov/31926547" }, { "database": "PubMed", "id": "31963871", "url": "https://pubmed.ncbi.nlm.nih.gov/31963871" }, { "database": "PubMed", "id": "32205868", "url": "https://pubmed.ncbi.nlm.nih.gov/32205868" }, { "database": "PubMed", "id": "32210573", "url": "https://pubmed.ncbi.nlm.nih.gov/32210573" }, { "database": "PubMed", "id": "32210629", "url": "https://pubmed.ncbi.nlm.nih.gov/32210629" }, { "database": "PubMed", "id": "32219176", "url": "https://pubmed.ncbi.nlm.nih.gov/32219176" }, { "database": "PubMed", "id": "32231000", "url": "https://pubmed.ncbi.nlm.nih.gov/32231000" }, { "database": "PubMed", "id": "32271880", "url": "https://pubmed.ncbi.nlm.nih.gov/32271880" }, { "database": "PubMed", "id": "32322664", "url": "https://pubmed.ncbi.nlm.nih.gov/32322664" }, { "database": "PubMed", "id": "32457342", "url": "https://pubmed.ncbi.nlm.nih.gov/32457342" }, { "database": "PubMed", "id": "32483419", "url": "https://pubmed.ncbi.nlm.nih.gov/32483419" }, { "database": "PubMed", "id": "32493454", "url": "https://pubmed.ncbi.nlm.nih.gov/32493454" }, { "database": "PubMed", "id": "32589311", "url": "https://pubmed.ncbi.nlm.nih.gov/32589311" }, { "database": "PubMed", "id": "32707998", "url": "https://pubmed.ncbi.nlm.nih.gov/32707998" }, { "database": "PubMed", "id": "32711570", "url": "https://pubmed.ncbi.nlm.nih.gov/32711570" }, { "database": "PubMed", "id": "32848033", "url": "https://pubmed.ncbi.nlm.nih.gov/32848033" }, { "database": "PubMed", "id": "32894161", "url": "https://pubmed.ncbi.nlm.nih.gov/32894161" }, { "database": "PubMed", "id": "33014146", "url": "https://pubmed.ncbi.nlm.nih.gov/33014146" }, { "database": "PubMed", "id": "33032653", "url": "https://pubmed.ncbi.nlm.nih.gov/33032653" }, { "database": "PubMed", "id": "33097058", "url": "https://pubmed.ncbi.nlm.nih.gov/33097058" }, { "database": "PubMed", "id": "33218077", "url": "https://pubmed.ncbi.nlm.nih.gov/33218077" }, { "database": "PubMed", "id": "33277245", "url": "https://pubmed.ncbi.nlm.nih.gov/33277245" }, { "database": "PubMed", "id": "33416116", "url": "https://pubmed.ncbi.nlm.nih.gov/33416116" }, { "database": "PubMed", "id": "33420363", "url": "https://pubmed.ncbi.nlm.nih.gov/33420363" }, { "database": "PubMed", "id": "33504879", "url": "https://pubmed.ncbi.nlm.nih.gov/33504879" }, { "database": "PubMed", "id": "33571521", "url": "https://pubmed.ncbi.nlm.nih.gov/33571521" }, { "database": "PubMed", "id": "33628300", "url": "https://pubmed.ncbi.nlm.nih.gov/33628300" }, { "database": "PubMed", "id": "33672268", "url": "https://pubmed.ncbi.nlm.nih.gov/33672268" }, { "database": "PubMed", "id": "33707576", "url": "https://pubmed.ncbi.nlm.nih.gov/33707576" }, { "database": "PubMed", "id": "33777675", "url": "https://pubmed.ncbi.nlm.nih.gov/33777675" }, { "database": "PubMed", "id": "33897882", "url": "https://pubmed.ncbi.nlm.nih.gov/33897882" }, { "database": "PubMed", "id": "33937255", "url": "https://pubmed.ncbi.nlm.nih.gov/33937255" }, { "database": "PubMed", "id": "34206989", "url": "https://pubmed.ncbi.nlm.nih.gov/34206989" }, { "database": "PubMed", "id": "34343153", "url": "https://pubmed.ncbi.nlm.nih.gov/34343153" }, { "database": "PubMed", "id": "35015027", "url": "https://pubmed.ncbi.nlm.nih.gov/35015027" }, { "database": "PubMed", "id": "35358489", "url": "https://pubmed.ncbi.nlm.nih.gov/35358489" }, { "database": "PubMed", "id": "35586495", "url": "https://pubmed.ncbi.nlm.nih.gov/35586495" }, { "database": "PubMed", "id": "35713503", "url": "https://pubmed.ncbi.nlm.nih.gov/35713503" }, { "database": "PubMed", "id": "36115593", "url": "https://pubmed.ncbi.nlm.nih.gov/36115593" }, { "database": "PubMed", "id": "36374802", "url": "https://pubmed.ncbi.nlm.nih.gov/36374802" }, { "database": "PubMed", "id": "18158288", "url": "https://pubmed.ncbi.nlm.nih.gov/18158288" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "17974916", "url": "https://pubmed.ncbi.nlm.nih.gov/17974916" } ], "site_lbl": "Ser127", "uniprot_canonical_ac": "P46937-1" } ], "record_id": "pubmed.27380321", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Scribble sub-cellular localization modulates recruitment of YES1 to regulate YAP1 phosphorylation.", "journal": "Cell chemical biology", "date": "2021", "authors": "Zhao D, Yin Z, Soellner MB, Martin BR", "reference": { "type": "PubMed", "id": "33730553", "url": "https://pubmed.ncbi.nlm.nih.gov/33730553" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07947-1", "protein_name": "Tyrosine-protein kinase Yes", "gene_name": "YES1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 305, "end_pos": 305, "sequence_org": "P", "sequence_mut": "L", "comment": "Decreased palmitoylation. Loss of localization at the plasma membrane. Loss of targeting to cell-cell junctions. Alters interaction with TJP2. Loss of pro-apoptotic function. Loss of function in epithelial cell polarization and signaling pathways regulation. Abolishes interaction with YES1 in the closed conformation and instead facilitates SCRIB interaction with YES1 in an open conformation.", "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" }, { "database": "PubMed", "id": "15182672", "url": "https://pubmed.ncbi.nlm.nih.gov/15182672" }, { "database": "PubMed", "id": "19041750", "url": "https://pubmed.ncbi.nlm.nih.gov/19041750" }, { "database": "PubMed", "id": "15806148", "url": "https://pubmed.ncbi.nlm.nih.gov/15806148" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" }, { "database": "PubMed", "id": "33730553", "url": "https://pubmed.ncbi.nlm.nih.gov/33730553" } ], "uniprot_canonical_ac": "Q14160-3" } ], "record_id": "pubmed.33730553", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of Tick Born encephalitis virus NS5 mediated subversion of apico-basal cell polarity signalling.", "journal": "Biochem. J.", "date": "2022", "authors": "Kvansakul M., Humbert P.O., Javorsky A.", "reference": { "type": "PubMed", "id": "35670457", "url": "https://pubmed.ncbi.nlm.nih.gov/35670457" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35670457", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An interaction between OTULIN and SCRIB uncovers roles for linear ubiquitination in planar cell polarity.", "journal": "Disease models & mechanisms", "date": "2023-08-01", "authors": "Almeida Stephanie M, Ivantsiv Sofiia, Niibori Rieko, Dunham Wade H, Green Brooke A, Zhao Liang, Gingras Anne-Claude, Cordes Sabine P", "reference": { "type": "PubMed", "id": "37589075", "url": "https://pubmed.ncbi.nlm.nih.gov/37589075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37589075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Moderate SCRIB Expression Levels Correlate with Worse Prognosis in OPSCC Patients Regardless of HPV Status.", "journal": "Cells", "date": "2024-06-08", "authors": "Luli\u0107 Lucija, \u0160imi\u0107 Ivana, Bo\u017einovi\u0107 Ksenija, Pe\u0161ut Ena, Manojlovi\u0107 Luka, Grce Magdalena, Dediol Emil, Sabol Ivan, Tomai\u0107 Vjekoslav", "reference": { "type": "PubMed", "id": "38920638", "url": "https://pubmed.ncbi.nlm.nih.gov/38920638" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14160", "url": "https://www.uniprot.org/uniprotkb/Q14160" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38920638", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for the regulation of inducible nitric oxide synthase by the SPRY domain-containing SOCS box protein SPSB2, an E3 ubiquitin ligase.", "journal": "Nitric oxide : biology and chemistry", "date": "2021", "authors": "Li K, You T, Zhao P, Luo Y, Zhang D, Wei H, Wang Y, Yang J, Guan X, Kuang Z", "reference": { "type": "PubMed", "id": "33862200", "url": "https://pubmed.ncbi.nlm.nih.gov/33862200" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99619-1", "protein_name": "SPRY domain-containing SOCS box protein 2", "gene_name": "SPSB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88838-1", "protein_name": "SPRY domain-containing SOCS box protein 2", "gene_name": "Spsb2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99619", "url": "https://www.uniprot.org/uniprotkb/Q99619" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33862200", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fab antibodies capable of blocking T cells by competitive binding have the identical specificity but a higher affinity to the MHC-peptide-complex than the T cell receptor.", "journal": "Immunology letters", "date": "2009-08-15", "authors": "Neumann Frank, Sturm Christine, H\u00fclsmeyer Martin, Dauth Nina, Guillaume Philippe, Luescher Immanuel F, Pfreundschuh Michael, Held Gerhard", "reference": { "type": "PubMed", "id": "19524620", "url": "https://pubmed.ncbi.nlm.nih.gov/19524620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q16385-1", "protein_name": "Protein SSX2", "gene_name": "SSX2B; SSX2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q16385", "url": "https://www.uniprot.org/uniprotkb/Q16385" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19524620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vaccines targeting the cancer-testis antigen SSX-2 elicit HLA-A2 epitope-specific cytolytic T cells.", "journal": "Journal of immunotherapy (Hagerstown, Md. : 1997)", "date": "2011-10", "authors": "Smith Heath A, McNeel Douglas G", "reference": { "type": "PubMed", "id": "21904219", "url": "https://pubmed.ncbi.nlm.nih.gov/21904219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q16385-1", "protein_name": "Protein SSX2", "gene_name": "SSX2B; SSX2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q16385", "url": "https://www.uniprot.org/uniprotkb/Q16385" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21904219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Remodeling and destabilization of chromosome 1 pericentromeric heterochromatin by SSX proteins.", "journal": "Nucleic acids research", "date": "2019", "authors": "Traynor S, Mollegaard NE, Jorgensen MG, Bruckmann NH, Pedersen CB, Terp MG, Johansen S, Dejardin J, Ditzel HJ, Gjerstorff MF", "reference": { "type": "PubMed", "id": "31114908", "url": "https://pubmed.ncbi.nlm.nih.gov/31114908" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q16385-1", "protein_name": "Protein SSX2", "gene_name": "SSX2B; SSX2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q16385", "url": "https://www.uniprot.org/uniprotkb/Q16385" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q16385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q16385" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "31114908", "url": "https://pubmed.ncbi.nlm.nih.gov/31114908" } ], "site_lbl": "Ser181", "uniprot_canonical_ac": "Q16385-1" } ], "record_id": "pubmed.31114908", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anti-Cancer Effects and Tumor Marker Role of Glutathione S-Transferase Mu 5 in Human Bladder Cancer.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Jou YC, Wang SC, Dia YC, Wang ST, Yu MH, Yang HY, Chen LC, Shen CH, Liu YW", "reference": { "type": "PubMed", "id": "33802702", "url": "https://pubmed.ncbi.nlm.nih.gov/33802702" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46439-1", "protein_name": "Glutathione S-transferase Mu 5", "gene_name": "GSTM5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46439", "url": "https://www.uniprot.org/uniprotkb/P46439" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33802702", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aberrant expression of GSTM5 in lung adenocarcinoma is associated with DNA hypermethylation and poor prognosis.", "journal": "BMC cancer", "date": "2022", "authors": "Hao X, Zhang J, Chen G, Cao W, Chen H, Chen S", "reference": { "type": "PubMed", "id": "35729618", "url": "https://pubmed.ncbi.nlm.nih.gov/35729618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46439-1", "protein_name": "Glutathione S-transferase Mu 5", "gene_name": "GSTM5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46439", "url": "https://www.uniprot.org/uniprotkb/P46439" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35729618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A basis for differentiating among the multiple human Mu-glutathione S-transferases and molecular cloning of brain GSTM5.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Takahashi Y, Campbell EA, Hirata Y, Takayama T, Listowsky I", "reference": { "type": "PubMed", "id": "8473333", "url": "https://pubmed.ncbi.nlm.nih.gov/8473333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46439-1", "protein_name": "Glutathione S-transferase Mu 5", "gene_name": "GSTM5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46439", "url": "https://www.uniprot.org/uniprotkb/P46439" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8473333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Germ-line NF2 mutations and disease severity in neurofibromatosis type 2 patients with retinal abnormalities.", "journal": "American journal of human genetics", "date": "1999", "authors": "Baser ME, Kluwe L, Mautner VF", "reference": { "type": "PubMed", "id": "10090912", "url": "https://pubmed.ncbi.nlm.nih.gov/10090912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10090912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel alternatively spliced isoforms of the neurofibromatosis type 2 tumor suppressor are targeted to the nucleus and cytoplasmic granules.", "journal": "Hum. Mol. Genet.", "date": "1999", "authors": "Schmucker B, Tang Y, Kressel M", "reference": { "type": "PubMed", "id": "10401006", "url": "https://pubmed.ncbi.nlm.nih.gov/10401006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10401006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Detection of novel NF2 mutations by an RNA mismatch cleavage method.", "journal": "Human mutation", "date": "2000", "authors": "Faudoa R, Xue Z, Lee F, Baser ME, Hung G", "reference": { "type": "PubMed", "id": "10790209", "url": "https://pubmed.ncbi.nlm.nih.gov/10790209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10790209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor-regulated tyrosine kinase substrate.", "journal": "Hum. Mol. Genet.", "date": "2000", "authors": "Scoles DR, Huynh DP, Chen MS, Burke SP, Gutmann DH, Pulst SM", "reference": { "type": "PubMed", "id": "10861283", "url": "https://pubmed.ncbi.nlm.nih.gov/10861283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14964-1", "protein_name": "Hepatocyte growth factor-regulated tyrosine kinase substrate", "gene_name": "HGS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10861283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p21-activated kinase links Rac/Cdc42 signaling to merlin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Xiao GH, Beeser A, Chernoff J, Testa JR", "reference": { "type": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "27285107", "url": "https://pubmed.ncbi.nlm.nih.gov/27285107" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.11719502", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple transcription initiation sites, alternative splicing, and differential polyadenylation contribute to the complexity of human neurofibromatosis 2 transcripts.", "journal": "Genomics", "date": "2002", "authors": "Chang Long-Sheng, Akhmametyeva Elena M, Wu Yong, Zhu Lingyun, Welling D Bradley", "reference": { "type": "PubMed", "id": "11827459", "url": "https://pubmed.ncbi.nlm.nih.gov/11827459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11827459", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of the FERM domain of merlin, the neurofibromatosis type 2 gene product.", "journal": "Acta Crystallogr. D", "date": "2002", "authors": "Kang Beom Sik, Cooper David R, Devedjiev Yancho, Derewenda Urszula, Derewenda Zygmunt S", "reference": { "type": "PubMed", "id": "11856822", "url": "https://pubmed.ncbi.nlm.nih.gov/11856822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11856822", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neurofibromatosis 2 and malignant mesothelioma.", "journal": "Neurology", "date": "2002", "authors": "Baser M E, De Rienzo A, Altomare D, Balsara B R, Hedrick N M, Gutmann D H, Pitts L H, Jackler R K, Testa J R", "reference": { "type": "PubMed", "id": "12136076", "url": "https://pubmed.ncbi.nlm.nih.gov/12136076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12136076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Preimplantation diagnosis for neurofibromatosis.", "journal": "Reproductive biomedicine online", "date": "2002", "authors": "Verlinsky Y, Rechitsky S, Verlinsky O, Chistokhina A, Sharapova T, Masciangelo C, Levy M, Kaplan B, Lederer K, Kuliev A", "reference": { "type": "PubMed", "id": "12709270", "url": "https://pubmed.ncbi.nlm.nih.gov/12709270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12709270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effect of merlin phosphorylation on neurofibromatosis 2 (NF2) gene function.", "journal": "Oncogene", "date": "2004", "authors": "Surace EI, Haipek CA, Gutmann DH", "reference": { "type": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 576, "end_pos": 576, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" } ], "site_lbl": "Thr576", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.14724586", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclic AMP-dependent protein kinase phosphorylates merlin at serine 518 independently of p21-activated kinase and promotes merlin-ezrin heterodimerization.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Alfthan K, Heiska L, Gronholm M, Renkema GH, Carpen O", "reference": { "type": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.14981079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Merlin/NF-2 mediates contact inhibition of growth by suppressing recruitment of Rac to the plasma membrane.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Okada T, Lopez-Lago M, Giancotti FG", "reference": { "type": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.16247032", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Phosphorylation status of merlin is important for regulating the Ras-ERK pathway.", "journal": "Molecules and cells", "date": "2005-10-31", "authors": "Jung Ju Ri, Kim Hongtae, Jeun Sin-Soo, Lee Joo Yong, Koh Eun-Jeoung, Ji Cheol", "reference": { "type": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.16267393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evolution and origin of merlin, the product of the Neurofibromatosis type 2 (NF2) tumor-suppressor gene.", "journal": "BMC evolutionary biology", "date": "2005", "authors": "Golovnina K, Blinov A, Akhmametyeva EM, Omelyanchuk LV, Chang LS", "reference": { "type": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 576, "end_pos": 576, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" } ], "site_lbl": "Thr576", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.16324214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the NF2 tumor suppressor in Schwann cells is mediated by Cdc42-Pak and requires paxillin binding.", "journal": "Molecular and cellular neurosciences", "date": "2007", "authors": "Thaxton C, Lopera J, Bott M, Baldwin ME, Kalidas P, Fernandez-Valle C", "reference": { "type": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.17175165", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tumor suppressor merlin interacts with microtubules and modulates Schwann cell microtubule cytoskeleton.", "journal": "Human molecular genetics", "date": "2007", "authors": "Muranen T, Gronholm M, Lampin A, Lallemand D, Zhao F, Giovannini M, Carpen O", "reference": { "type": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.17566081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt phosphorylation regulates the tumour-suppressor merlin through ubiquitination and degradation.", "journal": "Nature cell biology", "date": "2007", "authors": "Tang X, Jang SW, Wang X, Liu Z, Bahr SM, Sun SY, Brat D, Gutmann DH, Ye K", "reference": { "type": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" } ], "site_lbl": "Thr230", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" } ], "site_lbl": "Ser315", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.17891137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Compensative shuttling of merlin to phosphorylation on serine 518 in vestibular schwannoma.", "journal": "The Laryngoscope", "date": "2008", "authors": "Lu J, Zou J, Wu H, Cai L", "reference": { "type": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.17989580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neuregulin and laminin stimulate phosphorylation of the NF2 tumor suppressor in Schwann cells by distinct protein kinase A and p21-activated kinase-dependent pathways.", "journal": "Oncogene", "date": "2008", "authors": "Thaxton C, Lopera J, Bott M, Fernandez-Valle C", "reference": { "type": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.17998937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase A-mediated phosphorylation of the NF2 tumor suppressor protein merlin at serine 10 affects the actin cytoskeleton.", "journal": "Oncogene", "date": "2008", "authors": "Laulajainen M, Muranen T, Carpen O, Gronholm M", "reference": { "type": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "21750658", "url": "https://pubmed.ncbi.nlm.nih.gov/21750658" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "27285107", "url": "https://pubmed.ncbi.nlm.nih.gov/27285107" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "Q13177-1", "kinase_gene_name": "PAK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.18071304", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of the NF2 tumor suppressor protein merlin in DU145 prostate cancer cells.", "journal": "The Prostate", "date": "2008", "authors": "Horiguchi A, Zheng R, Shen R, Nanus DM", "reference": { "type": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.18361411", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional inactivation of NF2/merlin in human mesothelioma.", "journal": "Lung cancer (Amsterdam, Netherlands)", "date": "2009", "authors": "Thurneysen C, Opitz I, Kurtz S, Weder W, Stahel RA, Felley-Bosco E", "reference": { "type": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.18835652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Expression of S518 phosphorylated Merlin and its interaction with CD44 in vestibular schwannoma].", "journal": "Zhonghua er bi yan hou tou jing wai ke za zhi = Chinese journal of otorhinolaryngology head and neck surgery", "date": "2008", "authors": "Cai LH, Wu H, Lu JR, Wang ZY", "reference": { "type": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.19141242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of merlin regulates its stability and tumor suppressive activity.", "journal": "Cell adhesion & migration", "date": "2007", "authors": "Ye K", "reference": { "type": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" } ], "site_lbl": "Thr230", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" } ], "site_lbl": "Ser315", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.19262146", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Laminin is required for Schwann cell morphogenesis.", "journal": "Journal of cell science", "date": "2009", "authors": "Yu WM, Chen ZL, North AJ, Strickland S", "reference": { "type": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.19295124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stable alterations of CD44 isoform expression in prostate cancer cells decrease invasion and growth and alter ligand binding and chemosensitivity.", "journal": "BMC cancer", "date": "2010", "authors": "Yang K, Tang Y, Habermehl GK, Iczkowski KA", "reference": { "type": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.20074368", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of the NF2 gene in Korean patients with neurofibromatosis type 2: a report of four novel mutations.", "journal": "The Korean journal of laboratory medicine", "date": "2010", "authors": "Seong MW, Yeo IK, Cho SI, Park CK, Kim SK, Paek SH, Kim DG, Jung HW, Park H, Kim SY, Kim JY, Park SS", "reference": { "type": "PubMed", "id": "20445339", "url": "https://pubmed.ncbi.nlm.nih.gov/20445339" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20445339", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of mixed lineage kinase 3 is required for Neurofibromatosis-2-mediated growth suppression in human cancer.", "journal": "Oncogene", "date": "2011", "authors": "Zhan Y, Modi N, Stewart AM, Hieronimus RI, Liu J, Gutmann DH, Chadee DN", "reference": { "type": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.20890305", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multistep phosphorylation by oncogenic kinases enhances the degradation of the NF2 tumor suppressor merlin.", "journal": "Neoplasia (New York, N.Y.)", "date": "2011", "authors": "Laulajainen M, Muranen T, Nyman TA, Carpen O, Gronholm M", "reference": { "type": "PubMed", "id": "21750658", "url": "https://pubmed.ncbi.nlm.nih.gov/21750658" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "21750658", "url": "https://pubmed.ncbi.nlm.nih.gov/21750658" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.21750658", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAK1 is a breast cancer oncogene that coordinately activates MAPK and MET signaling.", "journal": "Oncogene", "date": "2012", "authors": "Shrestha Y, Schafer EJ, Boehm JS, Thomas SR, He F, Du J, Wang S, Barretina J, Weir BA, Zhao JJ, Polyak K, Golub TR, Beroukhim R, Hahn WC", "reference": { "type": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.22105362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct overlapping sequences at the carboxy-terminus of merlin regulate its tumour suppressor and morphogenic activity.", "journal": "Journal of cellular and molecular medicine", "date": "2012", "authors": "Laulajainen M, Melikova M, Muranen T, Carpen O, Gronholm M", "reference": { "type": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 581, "end_pos": 581, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" } ], "site_lbl": "Thr581", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 584, "end_pos": 584, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" } ], "site_lbl": "Ser584", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 587, "end_pos": 587, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" } ], "site_lbl": "Ser587", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.22325036", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of the Hippo tumour suppressor pathway by integrin-linked kinase.", "journal": "Nature communications", "date": "2013", "authors": "Serrano I, McDonald PC, Lock F, Muller WJ, Dedhar S", "reference": { "type": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95835-1", "protein_name": "Serine/threonine-protein kinase LATS1", "gene_name": "LATS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14974-1", "protein_name": "Protein phosphatase 1 regulatory subunit 12A", "gene_name": "PPP1R12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" }, { "start_pos": 1079, "end_pos": 1079, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by STK3/MST2", "evidence": [ { "database": "UniProtKB", "id": "O95835", "url": "https://www.uniprot.org/uniprotkb/O95835" }, { "database": "IEDB", "id": "O95835", "url": "https://www.iedb.org/epitope/O95835" }, { "database": "iPTMnet", "id": "O95835", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95835" }, { "database": "PubMed", "id": "32357974", "url": "https://pubmed.ncbi.nlm.nih.gov/32357974" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "25723520", "url": "https://pubmed.ncbi.nlm.nih.gov/25723520" }, { "database": "PubMed", "id": "27555231", "url": "https://pubmed.ncbi.nlm.nih.gov/27555231" }, { "database": "PubMed", "id": "27847303", "url": "https://pubmed.ncbi.nlm.nih.gov/27847303" }, { "database": "PubMed", "id": "30800215", "url": "https://pubmed.ncbi.nlm.nih.gov/30800215" }, { "database": "PubMed", "id": "30863499", "url": "https://pubmed.ncbi.nlm.nih.gov/30863499" }, { "database": "PubMed", "id": "33672268", "url": "https://pubmed.ncbi.nlm.nih.gov/33672268" }, { "database": "PubMed", "id": "15688006", "url": "https://pubmed.ncbi.nlm.nih.gov/15688006" }, { "database": "PubMed", "id": "28087714", "url": "https://pubmed.ncbi.nlm.nih.gov/28087714" } ], "site_lbl": "Thr1079", "uniprot_canonical_ac": "O95835-1" }, { "start_pos": 696, "end_pos": 696, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by ROCK1, ROCK2, CDC42BP, ZIPK/DAPK3 and RAF1", "evidence": [ { "database": "UniProtKB", "id": "O14974", "url": "https://www.uniprot.org/uniprotkb/O14974" }, { "database": "iPTMnet", "id": "O14974", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14974" }, { "database": "PubMed", "id": "15723050", "url": "https://pubmed.ncbi.nlm.nih.gov/15723050" }, { "database": "PRO", "id": "O14974", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O14974" }, { "database": "PubMed", "id": "15124925", "url": "https://pubmed.ncbi.nlm.nih.gov/15124925" }, { "database": "PubMed", "id": "15194681", "url": "https://pubmed.ncbi.nlm.nih.gov/15194681" }, { "database": "PubMed", "id": "15475516", "url": "https://pubmed.ncbi.nlm.nih.gov/15475516" }, { "database": "PubMed", "id": "15665049", "url": "https://pubmed.ncbi.nlm.nih.gov/15665049" }, { "database": "PubMed", "id": "16608882", "url": "https://pubmed.ncbi.nlm.nih.gov/16608882" }, { "database": "PubMed", "id": "18237278", "url": "https://pubmed.ncbi.nlm.nih.gov/18237278" }, { "database": "PubMed", "id": "18423375", "url": "https://pubmed.ncbi.nlm.nih.gov/18423375" }, { "database": "PubMed", "id": "18648664", "url": "https://pubmed.ncbi.nlm.nih.gov/18648664" }, { "database": "PubMed", "id": "19095646", "url": "https://pubmed.ncbi.nlm.nih.gov/19095646" }, { "database": "PubMed", "id": "19531490", "url": "https://pubmed.ncbi.nlm.nih.gov/19531490" }, { "database": "PubMed", "id": "19806255", "url": "https://pubmed.ncbi.nlm.nih.gov/19806255" }, { "database": "PubMed", "id": "19879105", "url": "https://pubmed.ncbi.nlm.nih.gov/19879105" }, { "database": "PubMed", "id": "20130087", "url": "https://pubmed.ncbi.nlm.nih.gov/20130087" }, { "database": "PubMed", "id": "20801872", "url": "https://pubmed.ncbi.nlm.nih.gov/20801872" }, { "database": "PubMed", "id": "21850162", "url": "https://pubmed.ncbi.nlm.nih.gov/21850162" }, { "database": "PubMed", "id": "22155728", "url": "https://pubmed.ncbi.nlm.nih.gov/22155728" }, { "database": "PubMed", "id": "22869619", "url": "https://pubmed.ncbi.nlm.nih.gov/22869619" }, { "database": "PubMed", "id": "22947248", "url": "https://pubmed.ncbi.nlm.nih.gov/22947248" }, { "database": "PubMed", "id": "23161543", "url": "https://pubmed.ncbi.nlm.nih.gov/23161543" }, { "database": "PubMed", "id": "23308222", "url": "https://pubmed.ncbi.nlm.nih.gov/23308222" }, { "database": "PubMed", "id": "23345589", "url": "https://pubmed.ncbi.nlm.nih.gov/23345589" }, { "database": "PubMed", "id": "23362260", "url": "https://pubmed.ncbi.nlm.nih.gov/23362260" }, { "database": "PubMed", "id": "23516539", "url": "https://pubmed.ncbi.nlm.nih.gov/23516539" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24712327", "url": "https://pubmed.ncbi.nlm.nih.gov/24712327" }, { "database": "PubMed", "id": "24815187", "url": "https://pubmed.ncbi.nlm.nih.gov/24815187" }, { "database": "PubMed", "id": "24993595", "url": "https://pubmed.ncbi.nlm.nih.gov/24993595" }, { "database": "PubMed", "id": "25980620", "url": "https://pubmed.ncbi.nlm.nih.gov/25980620" }, { "database": "PubMed", "id": "27725371", "url": "https://pubmed.ncbi.nlm.nih.gov/27725371" }, { "database": "PubMed", "id": "28300193", "url": "https://pubmed.ncbi.nlm.nih.gov/28300193" }, { "database": "PubMed", "id": "28387646", "url": "https://pubmed.ncbi.nlm.nih.gov/28387646" }, { "database": "PubMed", "id": "28827520", "url": "https://pubmed.ncbi.nlm.nih.gov/28827520" }, { "database": "PubMed", "id": "29511289", "url": "https://pubmed.ncbi.nlm.nih.gov/29511289" }, { "database": "PubMed", "id": "31834925", "url": "https://pubmed.ncbi.nlm.nih.gov/31834925" }, { "database": "PubMed", "id": "32421147", "url": "https://pubmed.ncbi.nlm.nih.gov/32421147" }, { "database": "PubMed", "id": "32679023", "url": "https://pubmed.ncbi.nlm.nih.gov/32679023" }, { "database": "PubMed", "id": "33802280", "url": "https://pubmed.ncbi.nlm.nih.gov/33802280" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19701943", "url": "https://pubmed.ncbi.nlm.nih.gov/19701943" }, { "database": "PubMed", "id": "19997641", "url": "https://pubmed.ncbi.nlm.nih.gov/19997641" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "11719507", "url": "https://pubmed.ncbi.nlm.nih.gov/11719507" } ], "site_lbl": "Thr696", "uniprot_canonical_ac": "O14974-1" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LATS1 and LATS2", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "IEDB", "id": "P46937", "url": "https://www.iedb.org/epitope/P46937" }, { "database": "iPTMnet", "id": "P46937", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46937" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PRO", "id": "P46937", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P46937" }, { "database": "PubMed", "id": "20153295", "url": "https://pubmed.ncbi.nlm.nih.gov/20153295" }, { "database": "PubMed", "id": "21214929", "url": "https://pubmed.ncbi.nlm.nih.gov/21214929" }, { "database": "PubMed", "id": "21945154", "url": "https://pubmed.ncbi.nlm.nih.gov/21945154" }, { "database": "PubMed", "id": "12535517", "url": "https://pubmed.ncbi.nlm.nih.gov/12535517" }, { "database": "PubMed", "id": "18725387", "url": "https://pubmed.ncbi.nlm.nih.gov/18725387" }, { "database": "PubMed", "id": "19878874", "url": "https://pubmed.ncbi.nlm.nih.gov/19878874" }, { "database": "PubMed", "id": "20048001", "url": "https://pubmed.ncbi.nlm.nih.gov/20048001" }, { "database": "PubMed", "id": "20729916", "url": "https://pubmed.ncbi.nlm.nih.gov/20729916" }, { "database": "PubMed", "id": "20823509", "url": "https://pubmed.ncbi.nlm.nih.gov/20823509" }, { "database": "PubMed", "id": "21224387", "url": "https://pubmed.ncbi.nlm.nih.gov/21224387" }, { "database": "PubMed", "id": "21730131", "url": "https://pubmed.ncbi.nlm.nih.gov/21730131" }, { "database": "PubMed", "id": "21909427", "url": "https://pubmed.ncbi.nlm.nih.gov/21909427" }, { "database": "PubMed", "id": "22329991", "url": "https://pubmed.ncbi.nlm.nih.gov/22329991" }, { "database": "PubMed", "id": "22614006", "url": "https://pubmed.ncbi.nlm.nih.gov/22614006" }, { "database": "PubMed", "id": "22761457", "url": "https://pubmed.ncbi.nlm.nih.gov/22761457" }, { "database": "PubMed", "id": "22884261", "url": "https://pubmed.ncbi.nlm.nih.gov/22884261" }, { "database": "PubMed", "id": "23593160", "url": "https://pubmed.ncbi.nlm.nih.gov/23593160" }, { "database": "PubMed", "id": "23708000", "url": "https://pubmed.ncbi.nlm.nih.gov/23708000" }, { "database": "PubMed", "id": "23727052", "url": "https://pubmed.ncbi.nlm.nih.gov/23727052" }, { "database": "PubMed", "id": "23857250", "url": "https://pubmed.ncbi.nlm.nih.gov/23857250" }, { "database": "PubMed", "id": "23928732", "url": "https://pubmed.ncbi.nlm.nih.gov/23928732" }, { "database": "PubMed", "id": "24040060", "url": "https://pubmed.ncbi.nlm.nih.gov/24040060" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24509725", "url": "https://pubmed.ncbi.nlm.nih.gov/24509725" }, { "database": "PubMed", "id": "24525530", "url": "https://pubmed.ncbi.nlm.nih.gov/24525530" }, { "database": "PubMed", "id": "24621512", "url": "https://pubmed.ncbi.nlm.nih.gov/24621512" }, { "database": "PubMed", "id": "25317030", "url": "https://pubmed.ncbi.nlm.nih.gov/25317030" }, { "database": "PubMed", "id": "25393475", "url": "https://pubmed.ncbi.nlm.nih.gov/25393475" }, { "database": "PubMed", "id": "25601544", "url": "https://pubmed.ncbi.nlm.nih.gov/25601544" }, { "database": "PubMed", "id": "25751139", "url": "https://pubmed.ncbi.nlm.nih.gov/25751139" }, { "database": "PubMed", "id": "25751140", "url": "https://pubmed.ncbi.nlm.nih.gov/25751140" }, { "database": "PubMed", "id": "26265440", "url": "https://pubmed.ncbi.nlm.nih.gov/26265440" }, { "database": "PubMed", "id": "26269582", "url": "https://pubmed.ncbi.nlm.nih.gov/26269582" }, { "database": "PubMed", "id": "26364602", "url": "https://pubmed.ncbi.nlm.nih.gov/26364602" }, { "database": "PubMed", "id": "26417066", "url": "https://pubmed.ncbi.nlm.nih.gov/26417066" }, { "database": "PubMed", "id": "26567630", "url": "https://pubmed.ncbi.nlm.nih.gov/26567630" }, { "database": "PubMed", "id": "26625308", "url": "https://pubmed.ncbi.nlm.nih.gov/26625308" }, { "database": "PubMed", "id": "26625714", "url": "https://pubmed.ncbi.nlm.nih.gov/26625714" }, { "database": "PubMed", "id": "26806348", "url": "https://pubmed.ncbi.nlm.nih.gov/26806348" }, { "database": "PubMed", "id": "26843620", "url": "https://pubmed.ncbi.nlm.nih.gov/26843620" }, { "database": "PubMed", "id": "26876920", "url": "https://pubmed.ncbi.nlm.nih.gov/26876920" }, { "database": "PubMed", "id": "26967905", "url": "https://pubmed.ncbi.nlm.nih.gov/26967905" }, { "database": "PubMed", "id": "27000077", "url": "https://pubmed.ncbi.nlm.nih.gov/27000077" }, { "database": "PubMed", "id": "27009203", "url": "https://pubmed.ncbi.nlm.nih.gov/27009203" }, { "database": "PubMed", "id": "27030211", "url": "https://pubmed.ncbi.nlm.nih.gov/27030211" }, { "database": "PubMed", "id": "27034169", "url": "https://pubmed.ncbi.nlm.nih.gov/27034169" }, { "database": "PubMed", "id": "27065882", "url": "https://pubmed.ncbi.nlm.nih.gov/27065882" }, { "database": "PubMed", "id": "27144834", "url": "https://pubmed.ncbi.nlm.nih.gov/27144834" }, { "database": "PubMed", "id": "27203549", "url": "https://pubmed.ncbi.nlm.nih.gov/27203549" }, { "database": "PubMed", "id": "27205883", "url": "https://pubmed.ncbi.nlm.nih.gov/27205883" }, { "database": "PubMed", "id": "27206784", "url": "https://pubmed.ncbi.nlm.nih.gov/27206784" }, { "database": "PubMed", "id": "27324437", "url": "https://pubmed.ncbi.nlm.nih.gov/27324437" }, { "database": "PubMed", "id": "27334574", "url": "https://pubmed.ncbi.nlm.nih.gov/27334574" }, { "database": "PubMed", "id": "27336605", "url": "https://pubmed.ncbi.nlm.nih.gov/27336605" }, { "database": "PubMed", "id": "27380321", "url": "https://pubmed.ncbi.nlm.nih.gov/27380321" }, { "database": "PubMed", "id": "27409837", "url": "https://pubmed.ncbi.nlm.nih.gov/27409837" }, { "database": "PubMed", "id": "27457617", "url": "https://pubmed.ncbi.nlm.nih.gov/27457617" }, { "database": "PubMed", "id": "27462448", "url": "https://pubmed.ncbi.nlm.nih.gov/27462448" }, { "database": "PubMed", "id": "27476430", "url": "https://pubmed.ncbi.nlm.nih.gov/27476430" }, { "database": "PubMed", "id": "27488962", "url": "https://pubmed.ncbi.nlm.nih.gov/27488962" }, { "database": "PubMed", "id": "27555231", "url": "https://pubmed.ncbi.nlm.nih.gov/27555231" }, { "database": "PubMed", "id": "27556512", "url": "https://pubmed.ncbi.nlm.nih.gov/27556512" }, { "database": "PubMed", "id": "27566107", "url": "https://pubmed.ncbi.nlm.nih.gov/27566107" }, { "database": "PubMed", "id": "27634386", "url": "https://pubmed.ncbi.nlm.nih.gov/27634386" }, { "database": "PubMed", "id": "27669292", "url": "https://pubmed.ncbi.nlm.nih.gov/27669292" }, { "database": "PubMed", "id": "27871934", "url": "https://pubmed.ncbi.nlm.nih.gov/27871934" }, { "database": "PubMed", "id": "27907036", "url": "https://pubmed.ncbi.nlm.nih.gov/27907036" }, { "database": "PubMed", "id": "27911857", "url": "https://pubmed.ncbi.nlm.nih.gov/27911857" }, { "database": "PubMed", "id": "28065575", "url": "https://pubmed.ncbi.nlm.nih.gov/28065575" }, { "database": "PubMed", "id": "28076850", "url": "https://pubmed.ncbi.nlm.nih.gov/28076850" }, { "database": "PubMed", "id": "28098159", "url": "https://pubmed.ncbi.nlm.nih.gov/28098159" }, { "database": "PubMed", "id": "28102225", "url": "https://pubmed.ncbi.nlm.nih.gov/28102225" }, { "database": "PubMed", "id": "28169360", "url": "https://pubmed.ncbi.nlm.nih.gov/28169360" }, { "database": "PubMed", "id": "28239148", "url": "https://pubmed.ncbi.nlm.nih.gov/28239148" }, { "database": "PubMed", "id": "28332498", "url": "https://pubmed.ncbi.nlm.nih.gov/28332498" }, { "database": "PubMed", "id": "28339095", "url": "https://pubmed.ncbi.nlm.nih.gov/28339095" }, { "database": "PubMed", "id": "28376152", "url": "https://pubmed.ncbi.nlm.nih.gov/28376152" }, { "database": "PubMed", "id": "28406163", "url": "https://pubmed.ncbi.nlm.nih.gov/28406163" }, { "database": "PubMed", "id": "28420424", "url": "https://pubmed.ncbi.nlm.nih.gov/28420424" }, { "database": "PubMed", "id": "28454447", "url": "https://pubmed.ncbi.nlm.nih.gov/28454447" }, { "database": "PubMed", "id": "28464980", "url": "https://pubmed.ncbi.nlm.nih.gov/28464980" }, { "database": "PubMed", "id": "28470935", "url": "https://pubmed.ncbi.nlm.nih.gov/28470935" }, { "database": "PubMed", "id": "28671675", "url": "https://pubmed.ncbi.nlm.nih.gov/28671675" }, { "database": "PubMed", "id": "28708445", "url": "https://pubmed.ncbi.nlm.nih.gov/28708445" }, { "database": "PubMed", "id": "28725753", "url": "https://pubmed.ncbi.nlm.nih.gov/28725753" }, { "database": "PubMed", "id": "28745364", "url": "https://pubmed.ncbi.nlm.nih.gov/28745364" }, { "database": "PubMed", "id": "28757481", "url": "https://pubmed.ncbi.nlm.nih.gov/28757481" }, { "database": "PubMed", "id": "28815883", "url": "https://pubmed.ncbi.nlm.nih.gov/28815883" }, { "database": "PubMed", "id": "28827520", "url": "https://pubmed.ncbi.nlm.nih.gov/28827520" }, { "database": "PubMed", "id": "28923839", "url": "https://pubmed.ncbi.nlm.nih.gov/28923839" }, { "database": "PubMed", "id": "28951205", "url": "https://pubmed.ncbi.nlm.nih.gov/28951205" }, { "database": "PubMed", "id": "28969054", "url": "https://pubmed.ncbi.nlm.nih.gov/28969054" }, { "database": "PubMed", "id": "29066438", "url": "https://pubmed.ncbi.nlm.nih.gov/29066438" }, { "database": "PubMed", "id": "29069755", "url": "https://pubmed.ncbi.nlm.nih.gov/29069755" }, { "database": "PubMed", "id": "29093443", "url": "https://pubmed.ncbi.nlm.nih.gov/29093443" }, { "database": "PubMed", "id": "29136529", "url": "https://pubmed.ncbi.nlm.nih.gov/29136529" }, { "database": "PubMed", "id": "29154888", "url": "https://pubmed.ncbi.nlm.nih.gov/29154888" }, { "database": "PubMed", "id": "29212185", "url": "https://pubmed.ncbi.nlm.nih.gov/29212185" }, { "database": "PubMed", "id": "29228705", "url": "https://pubmed.ncbi.nlm.nih.gov/29228705" }, { "database": "PubMed", "id": "29296196", "url": "https://pubmed.ncbi.nlm.nih.gov/29296196" }, { "database": "PubMed", "id": "29339449", "url": "https://pubmed.ncbi.nlm.nih.gov/29339449" }, { "database": "PubMed", "id": "29487715", "url": "https://pubmed.ncbi.nlm.nih.gov/29487715" }, { "database": "PubMed", "id": "29496737", "url": "https://pubmed.ncbi.nlm.nih.gov/29496737" }, { "database": "PubMed", "id": "29535383", "url": "https://pubmed.ncbi.nlm.nih.gov/29535383" }, { "database": "PubMed", "id": "29562176", "url": "https://pubmed.ncbi.nlm.nih.gov/29562176" }, { "database": "PubMed", "id": "29725063", "url": "https://pubmed.ncbi.nlm.nih.gov/29725063" }, { "database": "PubMed", "id": "29758328", "url": "https://pubmed.ncbi.nlm.nih.gov/29758328" }, { "database": "PubMed", "id": "29891922", "url": "https://pubmed.ncbi.nlm.nih.gov/29891922" }, { "database": "PubMed", "id": "29895829", "url": "https://pubmed.ncbi.nlm.nih.gov/29895829" }, { "database": "PubMed", "id": "29903769", "url": "https://pubmed.ncbi.nlm.nih.gov/29903769" }, { "database": "PubMed", "id": "29909276", "url": "https://pubmed.ncbi.nlm.nih.gov/29909276" }, { "database": "PubMed", "id": "29930727", "url": "https://pubmed.ncbi.nlm.nih.gov/29930727" }, { "database": "PubMed", "id": "30037330", "url": "https://pubmed.ncbi.nlm.nih.gov/30037330" }, { "database": "PubMed", "id": "30139767", "url": "https://pubmed.ncbi.nlm.nih.gov/30139767" }, { "database": "PubMed", "id": "30250159", "url": "https://pubmed.ncbi.nlm.nih.gov/30250159" }, { "database": "PubMed", "id": "30272278", "url": "https://pubmed.ncbi.nlm.nih.gov/30272278" }, { "database": "PubMed", "id": "30404014", "url": "https://pubmed.ncbi.nlm.nih.gov/30404014" }, { "database": "PubMed", "id": "30446657", "url": "https://pubmed.ncbi.nlm.nih.gov/30446657" }, { "database": "PubMed", "id": "30466467", "url": "https://pubmed.ncbi.nlm.nih.gov/30466467" }, { "database": "PubMed", "id": "30504771", "url": "https://pubmed.ncbi.nlm.nih.gov/30504771" }, { "database": "PubMed", "id": "30559289", "url": "https://pubmed.ncbi.nlm.nih.gov/30559289" }, { "database": "PubMed", "id": "30565133", "url": "https://pubmed.ncbi.nlm.nih.gov/30565133" }, { "database": "PubMed", "id": "30566960", "url": "https://pubmed.ncbi.nlm.nih.gov/30566960" }, { "database": "PubMed", "id": "30574018", "url": "https://pubmed.ncbi.nlm.nih.gov/30574018" }, { "database": "PubMed", "id": "30618636", "url": "https://pubmed.ncbi.nlm.nih.gov/30618636" }, { "database": "PubMed", "id": "30631061", "url": "https://pubmed.ncbi.nlm.nih.gov/30631061" }, { "database": "PubMed", "id": "30824374", "url": "https://pubmed.ncbi.nlm.nih.gov/30824374" }, { "database": "PubMed", "id": "30833665", "url": "https://pubmed.ncbi.nlm.nih.gov/30833665" }, { "database": "PubMed", "id": "30865227", "url": "https://pubmed.ncbi.nlm.nih.gov/30865227" }, { "database": "PubMed", "id": "30935014", "url": "https://pubmed.ncbi.nlm.nih.gov/30935014" }, { "database": "PubMed", "id": "30948712", "url": "https://pubmed.ncbi.nlm.nih.gov/30948712" }, { "database": "PubMed", "id": "31015465", "url": "https://pubmed.ncbi.nlm.nih.gov/31015465" }, { "database": "PubMed", "id": "31076104", "url": "https://pubmed.ncbi.nlm.nih.gov/31076104" }, { "database": "PubMed", "id": "31100067", "url": "https://pubmed.ncbi.nlm.nih.gov/31100067" }, { "database": "PubMed", "id": "31139191", "url": "https://pubmed.ncbi.nlm.nih.gov/31139191" }, { "database": "PubMed", "id": "31142342", "url": "https://pubmed.ncbi.nlm.nih.gov/31142342" }, { "database": "PubMed", "id": "31145543", "url": "https://pubmed.ncbi.nlm.nih.gov/31145543" }, { "database": "PubMed", "id": "31208368", "url": "https://pubmed.ncbi.nlm.nih.gov/31208368" }, { "database": "PubMed", "id": "31296870", "url": "https://pubmed.ncbi.nlm.nih.gov/31296870" }, { "database": "PubMed", "id": "31307004", "url": "https://pubmed.ncbi.nlm.nih.gov/31307004" }, { "database": "PubMed", "id": "31455378", "url": "https://pubmed.ncbi.nlm.nih.gov/31455378" }, { "database": "PubMed", "id": "31477715", "url": "https://pubmed.ncbi.nlm.nih.gov/31477715" }, { "database": "PubMed", "id": "31487690", "url": "https://pubmed.ncbi.nlm.nih.gov/31487690" }, { "database": "PubMed", "id": "31619268", "url": "https://pubmed.ncbi.nlm.nih.gov/31619268" }, { "database": "PubMed", "id": "31627466", "url": "https://pubmed.ncbi.nlm.nih.gov/31627466" }, { "database": "PubMed", "id": "31649888", "url": "https://pubmed.ncbi.nlm.nih.gov/31649888" }, { "database": "PubMed", "id": "31659153", "url": "https://pubmed.ncbi.nlm.nih.gov/31659153" }, { "database": "PubMed", "id": "31669263", "url": "https://pubmed.ncbi.nlm.nih.gov/31669263" }, { "database": "PubMed", "id": "31690112", "url": "https://pubmed.ncbi.nlm.nih.gov/31690112" }, { "database": "PubMed", "id": "31693448", "url": "https://pubmed.ncbi.nlm.nih.gov/31693448" }, { "database": "PubMed", "id": "31717606", "url": "https://pubmed.ncbi.nlm.nih.gov/31717606" }, { "database": "PubMed", "id": "31788086", "url": "https://pubmed.ncbi.nlm.nih.gov/31788086" }, { "database": "PubMed", "id": "31827075", "url": "https://pubmed.ncbi.nlm.nih.gov/31827075" }, { "database": "PubMed", "id": "31835563", "url": "https://pubmed.ncbi.nlm.nih.gov/31835563" }, { "database": "PubMed", "id": "31926547", "url": "https://pubmed.ncbi.nlm.nih.gov/31926547" }, { "database": "PubMed", "id": "31963871", "url": "https://pubmed.ncbi.nlm.nih.gov/31963871" }, { "database": "PubMed", "id": "32205868", "url": "https://pubmed.ncbi.nlm.nih.gov/32205868" }, { "database": "PubMed", "id": "32210573", "url": "https://pubmed.ncbi.nlm.nih.gov/32210573" }, { "database": "PubMed", "id": "32210629", "url": "https://pubmed.ncbi.nlm.nih.gov/32210629" }, { "database": "PubMed", "id": "32219176", "url": "https://pubmed.ncbi.nlm.nih.gov/32219176" }, { "database": "PubMed", "id": "32231000", "url": "https://pubmed.ncbi.nlm.nih.gov/32231000" }, { "database": "PubMed", "id": "32271880", "url": "https://pubmed.ncbi.nlm.nih.gov/32271880" }, { "database": "PubMed", "id": "32322664", "url": "https://pubmed.ncbi.nlm.nih.gov/32322664" }, { "database": "PubMed", "id": "32457342", "url": "https://pubmed.ncbi.nlm.nih.gov/32457342" }, { "database": "PubMed", "id": "32483419", "url": "https://pubmed.ncbi.nlm.nih.gov/32483419" }, { "database": "PubMed", "id": "32493454", "url": "https://pubmed.ncbi.nlm.nih.gov/32493454" }, { "database": "PubMed", "id": "32589311", "url": "https://pubmed.ncbi.nlm.nih.gov/32589311" }, { "database": "PubMed", "id": "32707998", "url": "https://pubmed.ncbi.nlm.nih.gov/32707998" }, { "database": "PubMed", "id": "32711570", "url": "https://pubmed.ncbi.nlm.nih.gov/32711570" }, { "database": "PubMed", "id": "32848033", "url": "https://pubmed.ncbi.nlm.nih.gov/32848033" }, { "database": "PubMed", "id": "32894161", "url": "https://pubmed.ncbi.nlm.nih.gov/32894161" }, { "database": "PubMed", "id": "33014146", "url": "https://pubmed.ncbi.nlm.nih.gov/33014146" }, { "database": "PubMed", "id": "33032653", "url": "https://pubmed.ncbi.nlm.nih.gov/33032653" }, { "database": "PubMed", "id": "33097058", "url": "https://pubmed.ncbi.nlm.nih.gov/33097058" }, { "database": "PubMed", "id": "33218077", "url": "https://pubmed.ncbi.nlm.nih.gov/33218077" }, { "database": "PubMed", "id": "33277245", "url": "https://pubmed.ncbi.nlm.nih.gov/33277245" }, { "database": "PubMed", "id": "33416116", "url": "https://pubmed.ncbi.nlm.nih.gov/33416116" }, { "database": "PubMed", "id": "33420363", "url": "https://pubmed.ncbi.nlm.nih.gov/33420363" }, { "database": "PubMed", "id": "33504879", "url": "https://pubmed.ncbi.nlm.nih.gov/33504879" }, { "database": "PubMed", "id": "33571521", "url": "https://pubmed.ncbi.nlm.nih.gov/33571521" }, { "database": "PubMed", "id": "33628300", "url": "https://pubmed.ncbi.nlm.nih.gov/33628300" }, { "database": "PubMed", "id": "33672268", "url": "https://pubmed.ncbi.nlm.nih.gov/33672268" }, { "database": "PubMed", "id": "33707576", "url": "https://pubmed.ncbi.nlm.nih.gov/33707576" }, { "database": "PubMed", "id": "33777675", "url": "https://pubmed.ncbi.nlm.nih.gov/33777675" }, { "database": "PubMed", "id": "33897882", "url": "https://pubmed.ncbi.nlm.nih.gov/33897882" }, { "database": "PubMed", "id": "33937255", "url": "https://pubmed.ncbi.nlm.nih.gov/33937255" }, { "database": "PubMed", "id": "34206989", "url": "https://pubmed.ncbi.nlm.nih.gov/34206989" }, { "database": "PubMed", "id": "34343153", "url": "https://pubmed.ncbi.nlm.nih.gov/34343153" }, { "database": "PubMed", "id": "35015027", "url": "https://pubmed.ncbi.nlm.nih.gov/35015027" }, { "database": "PubMed", "id": "35358489", "url": "https://pubmed.ncbi.nlm.nih.gov/35358489" }, { "database": "PubMed", "id": "35586495", "url": "https://pubmed.ncbi.nlm.nih.gov/35586495" }, { "database": "PubMed", "id": "35713503", "url": "https://pubmed.ncbi.nlm.nih.gov/35713503" }, { "database": "PubMed", "id": "36115593", "url": "https://pubmed.ncbi.nlm.nih.gov/36115593" }, { "database": "PubMed", "id": "36374802", "url": "https://pubmed.ncbi.nlm.nih.gov/36374802" }, { "database": "PubMed", "id": "18158288", "url": "https://pubmed.ncbi.nlm.nih.gov/18158288" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "17974916", "url": "https://pubmed.ncbi.nlm.nih.gov/17974916" } ], "site_lbl": "Ser127", "uniprot_canonical_ac": "P46937-1" } ], "record_id": "pubmed.24356468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular conformation of the full-length tumor suppressor NF2/Merlin--a small-angle neutron scattering study.", "journal": "Journal of molecular biology", "date": "2014", "authors": "Ali Khajeh J, Ju JH, Atchiba M, Allaire M, Stanley C, Heller WT, Callaway DJ, Bu Z", "reference": { "type": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.24882693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncogenic role of Merlin/NF2 in glioblastoma.", "journal": "Oncogene", "date": "2015", "authors": "Guerrero PA, Yin W, Camacho L, Marchetti D", "reference": { "type": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.25043298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway.", "journal": "Cell research", "date": "2015", "authors": "Li Y, Zhou H, Li F, Chan SW, Lin Z, Wei Z, Yang Z, Guo F, Lim CJ, Xing W, Shen Y, Hong W, Long J, Zhang M", "reference": { "type": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.26045165", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The N-cadherin cytoplasmic domain confers anchorage-independent growth and the loss of contact inhibition.", "journal": "Scientific reports", "date": "2015", "authors": "Ozawa M", "reference": { "type": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.26481443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Merlin inhibits Wnt/beta-catenin signaling by blocking LRP6 phosphorylation.", "journal": "Cell death and differentiation", "date": "2016", "authors": "Kim M, Kim S, Lee SH, Kim W, Sohn MJ, Kim HS, Kim J, Jho EH", "reference": { "type": "PubMed", "id": "27285107", "url": "https://pubmed.ncbi.nlm.nih.gov/27285107" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "Q13153-1", "kinase_gene_name": "PAK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "27285107", "url": "https://pubmed.ncbi.nlm.nih.gov/27285107" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.27285107", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The conformation change and tumor suppressor role of Merlin are both independent of Serine 518 phosphorylation.", "journal": "Biochemical and biophysical research communications", "date": "2017", "authors": "Xing W, Li M, Zhang F, Ma X, Long J, Zhou H", "reference": { "type": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.28919412", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "beta1 integrin-dependent Rac/group I PAK signaling mediates YAP activation of Yes-associated protein 1 (YAP1) via NF2/merlin.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Sabra H, Brunner M, Mandati V, Wehrle-Haller B, Lallemand D, Ribba AS, Chevalier G, Guardiola P, Block MR, Bouvard D", "reference": { "type": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.28972170", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tumor suppressor LATS2 reduces v-Src-induced membrane blebs in a kinase activity-independent manner.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2021-01", "authors": "Ikeuchi Masayoshi, Yuki Ryuzaburo, Saito Youhei, Nakayama Yuji", "reference": { "type": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 518, "end_pos": 518, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK", "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" }, { "database": "iPTMnet", "id": "P35240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35240" }, { "database": "PubMed", "id": "11719502", "url": "https://pubmed.ncbi.nlm.nih.gov/11719502" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://pubmed.ncbi.nlm.nih.gov/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18071304", "url": "https://pubmed.ncbi.nlm.nih.gov/18071304" }, { "database": "PubMed", "id": "11782491", "url": "https://pubmed.ncbi.nlm.nih.gov/11782491" }, { "database": "PubMed", "id": "14724586", "url": "https://pubmed.ncbi.nlm.nih.gov/14724586" }, { "database": "PubMed", "id": "14981079", "url": "https://pubmed.ncbi.nlm.nih.gov/14981079" }, { "database": "PubMed", "id": "15378014", "url": "https://pubmed.ncbi.nlm.nih.gov/15378014" }, { "database": "PubMed", "id": "16247032", "url": "https://pubmed.ncbi.nlm.nih.gov/16247032" }, { "database": "PubMed", "id": "16267393", "url": "https://pubmed.ncbi.nlm.nih.gov/16267393" }, { "database": "PubMed", "id": "16324214", "url": "https://pubmed.ncbi.nlm.nih.gov/16324214" }, { "database": "PubMed", "id": "17175165", "url": "https://pubmed.ncbi.nlm.nih.gov/17175165" }, { "database": "PubMed", "id": "17566081", "url": "https://pubmed.ncbi.nlm.nih.gov/17566081" }, { "database": "PubMed", "id": "17891137", "url": "https://pubmed.ncbi.nlm.nih.gov/17891137" }, { "database": "PubMed", "id": "17989580", "url": "https://pubmed.ncbi.nlm.nih.gov/17989580" }, { "database": "PubMed", "id": "17998937", "url": "https://pubmed.ncbi.nlm.nih.gov/17998937" }, { "database": "PubMed", "id": "18361411", "url": "https://pubmed.ncbi.nlm.nih.gov/18361411" }, { "database": "PubMed", "id": "18835652", "url": "https://pubmed.ncbi.nlm.nih.gov/18835652" }, { "database": "PubMed", "id": "19141242", "url": "https://pubmed.ncbi.nlm.nih.gov/19141242" }, { "database": "PubMed", "id": "19262146", "url": "https://pubmed.ncbi.nlm.nih.gov/19262146" }, { "database": "PubMed", "id": "19295124", "url": "https://pubmed.ncbi.nlm.nih.gov/19295124" }, { "database": "PubMed", "id": "20074368", "url": "https://pubmed.ncbi.nlm.nih.gov/20074368" }, { "database": "PubMed", "id": "20890305", "url": "https://pubmed.ncbi.nlm.nih.gov/20890305" }, { "database": "PubMed", "id": "22105362", "url": "https://pubmed.ncbi.nlm.nih.gov/22105362" }, { "database": "PubMed", "id": "22325036", "url": "https://pubmed.ncbi.nlm.nih.gov/22325036" }, { "database": "PubMed", "id": "24356468", "url": "https://pubmed.ncbi.nlm.nih.gov/24356468" }, { "database": "PubMed", "id": "24882693", "url": "https://pubmed.ncbi.nlm.nih.gov/24882693" }, { "database": "PubMed", "id": "25043298", "url": "https://pubmed.ncbi.nlm.nih.gov/25043298" }, { "database": "PubMed", "id": "26045165", "url": "https://pubmed.ncbi.nlm.nih.gov/26045165" }, { "database": "PubMed", "id": "26481443", "url": "https://pubmed.ncbi.nlm.nih.gov/26481443" }, { "database": "PubMed", "id": "28919412", "url": "https://pubmed.ncbi.nlm.nih.gov/28919412" }, { "database": "PubMed", "id": "28972170", "url": "https://pubmed.ncbi.nlm.nih.gov/28972170" }, { "database": "PubMed", "id": "33368671", "url": "https://pubmed.ncbi.nlm.nih.gov/33368671" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" } ], "site_lbl": "Ser518", "uniprot_canonical_ac": "P35240-1" } ], "record_id": "pubmed.33368671", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acquired NF2 mutation confers resistance to TRK inhibition in an ex vivo LMNA::NTRK1-rearranged soft-tissue sarcoma cell model.", "journal": "The Journal of pathology", "date": "2024-06", "authors": "Chen Yanjiang, Steiner Sabrina, Hagedorn Catherine, Kollar Sarah, Pliego-Mendieta Alicia, Haberecker Martina, Plock Jan, Britschgi Christian, Planas-Paz Lara, Pauli Chantal", "reference": { "type": "PubMed", "id": "38613194", "url": "https://pubmed.ncbi.nlm.nih.gov/38613194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04629-1", "protein_name": "High affinity nerve growth factor receptor", "gene_name": "NTRK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38613194", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The histone lysine acetyltransferase KAT2B inhibits cholangiocarcinoma growth: evidence for interaction with SP1 to regulate NF2-YAP signaling.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2024-04-19", "authors": "Ma Wenbo, Zhang Jinqiang, Chen Weina, Liu Nianli, Wu Tong", "reference": { "type": "PubMed", "id": "38641672", "url": "https://pubmed.ncbi.nlm.nih.gov/38641672" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35240-1", "protein_name": "Merlin", "gene_name": "NF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92831-1", "protein_name": "Histone acetyltransferase KAT2B", "gene_name": "KAT2B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35240", "url": "https://www.uniprot.org/uniprotkb/P35240" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38641672", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]