[ { "title": "LGI1 mutations in temporal lobe epilepsies.", "journal": "Neurology", "date": "2004", "authors": "Berkovic SF, Izzillo P, McMahon JM, Harkin LA, McIntosh AM, Phillips HA, Briellmann RS, Wallace RH, Mazarib A, Neufeld MY, Korczyn AD, Scheffer IE, Mulley JC", "reference": { "type": "PubMed", "id": "15079010", "url": "https://pubmed.ncbi.nlm.nih.gov/15079010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15079010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased expression of LGI1 gene triggers growth inhibition and apoptosis of neuroblastoma cells.", "journal": "J. Cell. Physiol.", "date": "2006", "authors": "Gabellini Nadia, Masola V, Quartesan S, Oselladore B, Nobile C, Michelucci R, Curtarello M, Parolin C, Pal\u00f9 G", "reference": { "type": "PubMed", "id": "16518856", "url": "https://pubmed.ncbi.nlm.nih.gov/16518856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16518856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The epilepsy gene LGI1 encodes a secreted glycoprotein that binds to the cell surface.", "journal": "Human molecular genetics", "date": "2006", "authors": "Sirerol-Piquer MS, Ayerdi-Izquierdo A, Morante-Redolat JM, Herranz-Perez V, Favell K, Barker PA, Perez-Tur J", "reference": { "type": "PubMed", "id": "17067999", "url": "https://pubmed.ncbi.nlm.nih.gov/17067999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 192, "end_pos": 192, "sequence_org": "N", "sequence_mut": "Q", "comment": "Affects glycosylation; when associated with Q-277 and Q-422. Loss of protein secretion; when associated with Q-277 and Q-422.", "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" }, { "database": "PubMed", "id": "17067999", "url": "https://pubmed.ncbi.nlm.nih.gov/17067999" } ], "uniprot_canonical_ac": "O95970-1" }, { "start_pos": 277, "end_pos": 277, "sequence_org": "N", "sequence_mut": "Q", "comment": "Affects glycosylation; when associated with Q-192 and Q-422. Loss of protein secretion; when associated with Q-192 and Q-422.", "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" }, { "database": "PubMed", "id": "17067999", "url": "https://pubmed.ncbi.nlm.nih.gov/17067999" } ], "uniprot_canonical_ac": "O95970-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "N", "sequence_mut": "Q", "comment": "Affects glycosylation; when associated with Q-192 and Q-277. Loss of protein secretion; when associated with Q-192 and Q-277.", "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" }, { "database": "PubMed", "id": "17067999", "url": "https://pubmed.ncbi.nlm.nih.gov/17067999" } ], "uniprot_canonical_ac": "O95970-1" } ], "record_id": "pubmed.17067999", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two novel epilepsy-linked mutations leading to a loss of function of LGI1.", "journal": "Archives of neurology", "date": "2007", "authors": "Chabrol E, Popescu C, Gourfinkel-An I, Trouillard O, Depienne C, Senechal K, Baulac M, LeGuern E, Baulac S", "reference": { "type": "PubMed", "id": "17296837", "url": "https://pubmed.ncbi.nlm.nih.gov/17296837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17296837", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A de novo LGI1 mutation causing idiopathic partial epilepsy with telephone-induced seizures.", "journal": "Neurology", "date": "2007", "authors": "Michelucci R, Mecarelli O, Bovo G, Bisulli F, Testoni S, Striano P, Striano S, Tinuper P, Nobile C", "reference": { "type": "PubMed", "id": "17562837", "url": "https://pubmed.ncbi.nlm.nih.gov/17562837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17562837", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel loss-of-function LGI1 mutation linked to autosomal dominant lateral temporal epilepsy.", "journal": "Archives of neurology", "date": "2008", "authors": "Striano P, de Falco A, Diani E, Bovo G, Furlan S, Vitiello L, Pinardi F, Striano S, Michelucci R, de Falco FA, Nobile C", "reference": { "type": "PubMed", "id": "18625862", "url": "https://pubmed.ncbi.nlm.nih.gov/18625862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18625862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LGI1 mutations in autosomal dominant and sporadic lateral temporal epilepsy.", "journal": "Human mutation", "date": "2009-04", "authors": "Nobile Carlo, Michelucci Roberto, Andreazza Simonetta, Pasini Elena, Tosatto Silvio C E, Striano Pasquale", "reference": { "type": "PubMed", "id": "19191227", "url": "https://pubmed.ncbi.nlm.nih.gov/19191227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19191227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drug resistant ADLTE and recurrent partial status epilepticus with dysphasic features in a family with a novel LGI1mutation: electroclinical, genetic, and EEG/fMRI findings.", "journal": "Epilepsia", "date": "2009", "authors": "Di Bonaventura C, Carni M, Diani E, Fattouch J, Vaudano EA, Egeo G, Pantano P, Maraviglia B, Bozzao L, Manfredi M, Prencipe M, Giallonardo TA, Nobile C", "reference": { "type": "PubMed", "id": "19552651", "url": "https://pubmed.ncbi.nlm.nih.gov/19552651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19552651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of cardiac bradyarrhythmia associated with LGI1-IgG autoimmune encephalitis.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Zhao-Fleming Hannah H, Zahid Anza, Lu Tong, Sun Xiaojing, Pittock Sean J, Lee Hon-Chi, Dubey Divyanshu", "reference": { "type": "PubMed", "id": "36304459", "url": "https://pubmed.ncbi.nlm.nih.gov/36304459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36304459", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Leucine-Rich Glioma-Inactivated 1 (LGI1) Protein Stimulates Proliferation and IL-10 Production in Peripheral Blood Mononuclear Cells of Patients with LGI1 Antibody-Mediated Autoimmune Encephalitis In Vitro.", "journal": "International journal of molecular sciences", "date": "2024-02-23", "authors": "Goihl Alexander, Reinhold Dirk, Reinhold Annegret, Schraven Burkhart, K\u00f6rtvelyessy Peter", "reference": { "type": "PubMed", "id": "38473828", "url": "https://pubmed.ncbi.nlm.nih.gov/38473828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38473828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The downregulation of Kv1 channels in Lgi1-/-mice is accompanied by a profound modification of its interactome and a parallel decrease in Kv2 channels.", "journal": "Neurobiology of disease", "date": "2024-06-15", "authors": "Ramirez-Franco Jorge, Debreux K\u00e9vin, Sangiardi Marion, Belghazi Maya, Kim Yujin, Lee Suk-Ho, L\u00e9v\u00eaque Christian, Seagar Michael, El Far Oussama", "reference": { "type": "PubMed", "id": "38663634", "url": "https://pubmed.ncbi.nlm.nih.gov/38663634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38663634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activity-driven synaptic translocation of LGI1 controls excitatory neurotransmission.", "journal": "Cell reports", "date": "2024-05-28", "authors": "Cuhadar Ulku, Calzado-Reyes Lorenzo, Pascual-Caro Carlos, Aberra Aman S, Ritzau-Jost Andreas, Aggarwal Abhi, Ibata Keiji, Podgorski Kaspar, Yuzaki Michisuke, Geis Christian, Hallerman Stefan, Hoppa Michael B, de Juan-Sanz Jaime", "reference": { "type": "PubMed", "id": "38700985", "url": "https://pubmed.ncbi.nlm.nih.gov/38700985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K4Y5-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "Lgi1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38700985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Familial mesial temporal lobe epilepsy phenotype is associated with novel LGI1 variants: A report of two families.", "journal": "Seizure", "date": "2024-08", "authors": "Wang Chengzhe, Guo Xintong, Long Dingju, Li Yinchao, Yuan Cai, Ni Guanzhong, Zhang Heyu, Li Xi, Yin Sijing, Peng Xinxin, Huang Wenyao, Chen Siqing, Liu Yue, Chen Ziyi", "reference": { "type": "PubMed", "id": "39029408", "url": "https://pubmed.ncbi.nlm.nih.gov/39029408" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39029408", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic LGI1 and ADAM23 variants cause hippocampal epileptic encephalopathy via the LGI1-ADAM22/23 pathway.", "journal": "Brain : a journal of neurology", "date": "2025-10-03", "authors": "Hirano Yoko, Miyazaki Yuri, Ishikawa Daisuke, Inahashi Hiroki, Al-Hassnan Zuhair Nasser, Zifarelli Giovanni, Bauer Peter, Alvi Javeria Raza, Sultan Tipu, Thompson Michelle L, Sezer Abdullah, Konu\u015fkan Bahad\u0131r, Hajir Razan S, El-Hattab Ayman W, Efthymiou Stephanie, Ishida Ayuki, Yokoi Norihiko, Kornau Hans-Christian, Schmitz Dietmar, Pr\u00fcss Harald, Houlden Henry, Ikegaya Yuji, Fukata Yuko, Fukata Masaki, Maroofian Reza", "reference": { "type": "PubMed", "id": "40455867", "url": "https://pubmed.ncbi.nlm.nih.gov/40455867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.40455867", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Whole Exome Sequencing Identifies Novel Homozygous LGI1 Variant Mimicking ADAM22-Related Pathologies in a Moroccan Family.", "journal": "BMJ neurology open", "date": "2025", "authors": "El Mouhi Hinde, Elmakhzen Badreddine, Bouyahyaoui Amina, Hida Mustapha, Ouldim Karim, Bouguenouch Laila, Chaouki Sana", "reference": { "type": "PubMed", "id": "41000458", "url": "https://pubmed.ncbi.nlm.nih.gov/41000458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.41000458", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel gene, LGI1, from 10q24 is rearranged and downregulated in malignant brain tumors.", "journal": "Oncogene", "date": "1998", "authors": "Chernova O B, Somerville R P, Cowell J K", "reference": { "type": "PubMed", "id": "9879993", "url": "https://pubmed.ncbi.nlm.nih.gov/9879993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95970-1", "protein_name": "Leucine-rich glioma-inactivated protein 1", "gene_name": "LGI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95970", "url": "https://www.uniprot.org/uniprotkb/O95970" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9879993", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Editorial commentary: is LRRTM1 the gene for handedness?", "journal": "Laterality", "date": "2009", "authors": "McManus C, Nicholls M, Vallortigara G", "reference": { "type": "PubMed", "id": "19125365", "url": "https://pubmed.ncbi.nlm.nih.gov/19125365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE6", "url": "https://www.uniprot.org/uniprotkb/Q86UE6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19125365", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Where and what is the right shift factor or cerebral dominance gene? A critique of Francks et al. (2007).", "journal": "Laterality", "date": "2009", "authors": "Crow TJ, Close JP, Dagnall AM, Priddle TH", "reference": { "type": "PubMed", "id": "19125366", "url": "https://pubmed.ncbi.nlm.nih.gov/19125366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE6", "url": "https://www.uniprot.org/uniprotkb/Q86UE6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19125366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bidirectional transcription from human LRRTM2/CTNNA1 and LRRTM1/CTNNA2 gene loci leads to expression of N-terminally truncated CTNNA1 and CTNNA2 isoforms.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Kask M, Pruunsild P, Timmusk T", "reference": { "type": "PubMed", "id": "21708131", "url": "https://pubmed.ncbi.nlm.nih.gov/21708131" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43300-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 2", "gene_name": "LRRTM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35221-1", "protein_name": "Catenin alpha-1", "gene_name": "CTNNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE6", "url": "https://www.uniprot.org/uniprotkb/Q86UE6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21708131", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The imprinted gene LRRTM1 mediates schizotypy and handedness in a nonclinical population.", "journal": "Journal of human genetics", "date": "2014", "authors": "Leach EL, Prefontaine G, Hurd PL, Crespi BJ", "reference": { "type": "PubMed", "id": "24785688", "url": "https://pubmed.ncbi.nlm.nih.gov/24785688" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE6", "url": "https://www.uniprot.org/uniprotkb/Q86UE6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24785688", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypomethylation of the paternally inherited LRRTM1 promoter linked to schizophrenia.", "journal": "American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics", "date": "2014", "authors": "Brucato N, DeLisi LE, Fisher SE, Francks C", "reference": { "type": "PubMed", "id": "25111784", "url": "https://pubmed.ncbi.nlm.nih.gov/25111784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE6", "url": "https://www.uniprot.org/uniprotkb/Q86UE6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25111784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cognitive Control Processes and Functional Cerebral Asymmetries: Association with Variation in the Handedness-Associated Gene LRRTM1.", "journal": "Molecular neurobiology", "date": "2018", "authors": "Beste C, Arning L, Gerding WM, Epplen JT, Mertins A, Roder MC, Bless JJ, Hugdahl K, Westerhausen R, Gunturkun O, Ocklenburg S", "reference": { "type": "PubMed", "id": "28321770", "url": "https://pubmed.ncbi.nlm.nih.gov/28321770" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE6-1", "protein_name": "Leucine-rich repeat transmembrane neuronal protein 1", "gene_name": "LRRTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE6", "url": "https://www.uniprot.org/uniprotkb/Q86UE6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28321770", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Laminin gene LAMB4 is somatically mutated and expressionally altered in gastric and colorectal cancers.", "journal": "APMIS : acta pathologica, microbiologica, et immunologica Scandinavica", "date": "2015", "authors": "Choi MR, An CH, Yoo NJ, Lee SH", "reference": { "type": "PubMed", "id": "25257191", "url": "https://pubmed.ncbi.nlm.nih.gov/25257191" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A4D0S4-1", "protein_name": "Laminin subunit beta-4", "gene_name": "LAMB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A4D0S4", "url": "https://www.uniprot.org/uniprotkb/A4D0S4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25257191", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a rare LAMB4 variant associated with familial diverticulitis through exome sequencing.", "journal": "Human molecular genetics", "date": "2017", "authors": "Coble JL, Sheldon KE, Yue F, Salameh TJ, Harris LR III, Deiling S, Ruggiero FM, Eshelman MA, Yochum GS, Koltun WA, Gerhard GS, Broach JR", "reference": { "type": "PubMed", "id": "28595269", "url": "https://pubmed.ncbi.nlm.nih.gov/28595269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A4D0S4-1", "protein_name": "Laminin subunit beta-4", "gene_name": "LAMB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A4D0S4", "url": "https://www.uniprot.org/uniprotkb/A4D0S4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28595269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Laminin \u03b24 is a constituent of the cutaneous basement membrane zone and additional autoantigen of anti-p200 pemphigoid.", "journal": "Journal of the American Academy of Dermatology", "date": "2023-11-20", "authors": "Goletz Stephanie, Pigors Manuela, Lari Tina Rastegar, Hammers Christoph M, Wang Yao, Emtenani Shirin, Aumailley Monique, Holtsche Maike M, Stang Felix H, Weyers Imke, K\u00f6nig Inke R, Has Cristina, Radzimski Christiane, Komorowski Lars, Zillikens Detlef, Schmidt Enno", "reference": { "type": "PubMed", "id": "37992812", "url": "https://pubmed.ncbi.nlm.nih.gov/37992812" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A4D0S4-1", "protein_name": "Laminin subunit beta-4", "gene_name": "LAMB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A4D0S4", "url": "https://www.uniprot.org/uniprotkb/A4D0S4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37992812", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic association of SLC2A14 polymorphism with Alzheimer's disease in a Han Chinese population.", "journal": "Journal of molecular neuroscience : MN", "date": "2012", "authors": "Wang W, Yu JT, Zhang W, Cui WZ, Wu ZC, Zhang Q, Tan L", "reference": { "type": "PubMed", "id": "22421804", "url": "https://pubmed.ncbi.nlm.nih.gov/22421804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TDB8-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 14", "gene_name": "SLC2A14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TDB8", "url": "https://www.uniprot.org/uniprotkb/Q8TDB8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22421804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Both GLUT-1 and GLUT-14 are Independent Prognostic Factors in Gastric Adenocarcinoma.", "journal": "Annals of surgical oncology", "date": "2015", "authors": "Berlth F, Monig S, Pinther B, Grimminger P, Maus M, Schlosser H, Plum P, Warnecke-Eberz U, Harismendy O, Drebber U, Bollschweiler E, Holscher A, Alakus H", "reference": { "type": "PubMed", "id": "26183839", "url": "https://pubmed.ncbi.nlm.nih.gov/26183839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TDB8-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 14", "gene_name": "SLC2A14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TDB8", "url": "https://www.uniprot.org/uniprotkb/Q8TDB8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26183839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SLC2A14 gene: genomic locus, tissue expression, splice variants, and subcellular localization of the protein.", "journal": "Biochem. Cell Biol.", "date": "2016", "authors": "Amir Shaghaghi M, Murphy B, Eck P", "reference": { "type": "PubMed", "id": "27460888", "url": "https://pubmed.ncbi.nlm.nih.gov/27460888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TDB8-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 14", "gene_name": "SLC2A14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TDB8", "url": "https://www.uniprot.org/uniprotkb/Q8TDB8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27460888", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SLC2A14 gene, encoding the novel glucose/dehydroascorbate transporter GLUT14, is associated with inflammatory bowel disease.", "journal": "The American journal of clinical nutrition", "date": "2017", "authors": "Amir Shaghaghi M, Zhouyao H, Tu H, El-Gabalawy H, Crow GH, Levine M, Bernstein CN, Eck P", "reference": { "type": "PubMed", "id": "28971850", "url": "https://pubmed.ncbi.nlm.nih.gov/28971850" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TDB8-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 14", "gene_name": "SLC2A14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TDB8", "url": "https://www.uniprot.org/uniprotkb/Q8TDB8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28971850", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adaptation to HIF1alpha Deletion in Hypoxic Cancer Cells by Upregulation of GLUT14 and Creatine Metabolism.", "journal": "Molecular cancer research : MCR", "date": "2019", "authors": "Valli A, Morotti M, Zois CE, Albers PK, Soga T, Feldinger K, Fischer R, Frejno M, McIntyre A, Bridges E, Haider S, Buffa FM, Baban D, Rodriguez M, Yanes O, Whittington HJ, Lake HA, Zervou S, Lygate CA, Kessler BM, Harris AL", "reference": { "type": "PubMed", "id": "30885992", "url": "https://pubmed.ncbi.nlm.nih.gov/30885992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TDB8-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 14", "gene_name": "SLC2A14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TDB8", "url": "https://www.uniprot.org/uniprotkb/Q8TDB8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30885992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HSP90 and its R2TP/Prefoldin-like cochaperone are involved in the cytoplasmic assembly of RNA polymerase II.", "journal": "Mol. Cell", "date": "2010", "authors": "Boulon S\u00e9verine, Pradet-Balade B\u00e9reng\u00e8re, Verheggen C\u00e9line, Molle Doroth\u00e9e, Boireau St\u00e9phanie, Georgieva Marya, Azzag Karim, Robert Marie-C\u00e9cile, Ahmad Yasmeen, Neel Henry, Lamond Angus I, Bertrand Edouard", "reference": { "type": "PubMed", "id": "20864038", "url": "https://pubmed.ncbi.nlm.nih.gov/20864038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UHW5-1", "protein_name": "GPN-loop GTPase 3", "gene_name": "GPN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9Y4-1", "protein_name": "GPN-loop GTPase 2", "gene_name": "GPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN4-1", "protein_name": "GPN-loop GTPase 1", "gene_name": "GPN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20864038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human GTPases associate with RNA polymerase II to mediate its nuclear import.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Carre C, Shiekhattar R", "reference": { "type": "PubMed", "id": "21768307", "url": "https://pubmed.ncbi.nlm.nih.gov/21768307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UHW5-1", "protein_name": "GPN-loop GTPase 3", "gene_name": "GPN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN4-1", "protein_name": "GPN-loop GTPase 1", "gene_name": "GPN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 29, "end_pos": 32, "sequence_org": "GSGK", "sequence_mut": "AAAA", "comment": "Abolishes GTPase activity and decreases association with GPN3.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCN4", "url": "https://www.uniprot.org/uniprotkb/Q9HCN4" }, { "database": "PubMed", "id": "21768307", "url": "https://pubmed.ncbi.nlm.nih.gov/21768307" } ], "uniprot_canonical_ac": "Q9HCN4-1" } ], "record_id": "pubmed.21768307", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Parcs/Gpn3 is required for the nuclear accumulation of RNA polymerase II.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Calera MR, Zamora-Ramos C, Araiza-Villanueva MG, Moreno-Aguilar CA, Pena-Gomez SG, Castellanos-Teran F, Robledo-Rivera AY, Sanchez-Olea R", "reference": { "type": "PubMed", "id": "21782856", "url": "https://pubmed.ncbi.nlm.nih.gov/21782856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UHW5-1", "protein_name": "GPN-loop GTPase 3", "gene_name": "GPN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21782856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gpn1 and Gpn3 associate tightly and their protein levels are mutually dependent in mammalian cells.", "journal": "FEBS Lett.", "date": "2014", "authors": "Mendez-Hernandez LE, Perez-Mejia AE, Lara-Chacon B, Barbosa-Camacho AA, Pena-Gomez SG, Martinez-Sanchez M, Robledo-Rivera AY, Sanchez-Olea R, Calera MR", "reference": { "type": "PubMed", "id": "25241168", "url": "https://pubmed.ncbi.nlm.nih.gov/25241168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UHW5-1", "protein_name": "GPN-loop GTPase 3", "gene_name": "GPN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN4-1", "protein_name": "GPN-loop GTPase 1", "gene_name": "GPN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25241168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gpn3 is polyubiquitinated on lysine 216 and degraded by the proteasome in the cell nucleus in a Gpn1-inhibitable manner.", "journal": "FEBS letters", "date": "2017", "authors": "Mendez-Hernandez LE, Robledo-Rivera AY, Macias-Silva M, Calera MR, Sanchez-Olea R", "reference": { "type": "PubMed", "id": "29029378", "url": "https://pubmed.ncbi.nlm.nih.gov/29029378" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UHW5-1", "protein_name": "GPN-loop GTPase 3", "gene_name": "GPN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 210, "end_pos": 210, "sequence_org": "K", "sequence_mut": "R", "comment": "Slightly decreased ubiquitination. Further decreased ubiquitination; when associated with R-216.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" }, { "database": "PubMed", "id": "29029378", "url": "https://pubmed.ncbi.nlm.nih.gov/29029378" } ], "uniprot_canonical_ac": "Q9UHW5-1" }, { "start_pos": 216, "end_pos": 216, "sequence_org": "K", "sequence_mut": "R", "comment": "Markedly decreased ubiquitination. Does not affect the movement between the cytoplasm and the nucleus. Slowly decreased protein abundance. Increased half-life. Further decreased ubiquitination; when associated with R-210.", "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" }, { "database": "PubMed", "id": "29029378", "url": "https://pubmed.ncbi.nlm.nih.gov/29029378" } ], "uniprot_canonical_ac": "Q9UHW5-1" } ], "record_id": "pubmed.29029378", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gpn3 Is Essential for Cell Proliferation of Breast Cancer Cells Independent of Their Malignancy Degree.", "journal": "Technology in cancer research & treatment", "date": "2019", "authors": "Lara-Chacon B, Guerrero-Rodriguez SL, Ramirez-Hernandez KJ, Robledo-Rivera AY, Velazquez MAV, Sanchez-Olea R, Calera MR", "reference": { "type": "PubMed", "id": "31431135", "url": "https://pubmed.ncbi.nlm.nih.gov/31431135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UHW5-1", "protein_name": "GPN-loop GTPase 3", "gene_name": "GPN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UHW5", "url": "https://www.uniprot.org/uniprotkb/Q9UHW5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31431135", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of peptidylarginine deiminase-4 substrates by protein array: antagonistic citrullination and methylation of human ribosomal protein S2.", "journal": "Molecular bioSystems", "date": "2011", "authors": "Guo Q, Bedford MT, Fast W", "reference": { "type": "PubMed", "id": "21584310", "url": "https://pubmed.ncbi.nlm.nih.gov/21584310" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15880-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15880", "url": "https://www.uniprot.org/uniprotkb/P15880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21584310", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human cDNA sequence homologous to the mouse LLRep3 gene family.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Slynn G, Jenner D, Potts W, Elvin P, Morten JE, Markham AF", "reference": { "type": "PubMed", "id": "2308862", "url": "https://pubmed.ncbi.nlm.nih.gov/2308862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15880-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15880", "url": "https://www.uniprot.org/uniprotkb/P15880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2308862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PDCD2 functions as an evolutionarily conserved chaperone dedicated for the 40S ribosomal protein uS5 (RPS2).", "journal": "Nucleic Acids Res.", "date": "2020", "authors": "Landry-Voyer AM, Bergeron D, Yague-Sanz C, Baker B, Bachand F", "reference": { "type": "PubMed", "id": "33245768", "url": "https://pubmed.ncbi.nlm.nih.gov/33245768" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15880-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16342-1", "protein_name": "uS5 assembly chaperone PDCD2", "gene_name": "PDCD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15880", "url": "https://www.uniprot.org/uniprotkb/P15880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33245768", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Silencing of long chain noncoding RNA paternally expressed gene (PEG10) inhibits the progression of neuroblastoma by regulating microRNA-449a (miR-449a)/ribosomal protein S2 (RPS2) axis.", "journal": "Bioengineered", "date": "2022", "authors": "Zhang J, Liu W, Ji P, Zhang Y", "reference": { "type": "PubMed", "id": "35212607", "url": "https://pubmed.ncbi.nlm.nih.gov/35212607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15880-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15880", "url": "https://www.uniprot.org/uniprotkb/P15880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35212607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA methylation-mediated epigenetic regulation of oncogenic RPS2 as a novel therapeutic target and biomarker in hepatocellular carcinoma.", "journal": "Biochemical and biophysical research communications", "date": "2024-02-12", "authors": "Abi Zamer Batoul, Rah Bilal, Jayakumar Manju Nidagodu, Abumustafa Wafaa, Hamad Mawieh, Muhammad Jibran Sualeh", "reference": { "type": "PubMed", "id": "38181486", "url": "https://pubmed.ncbi.nlm.nih.gov/38181486" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15880-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15880", "url": "https://www.uniprot.org/uniprotkb/P15880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38181486", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The inner nuclear membrane protein Lem2 is critical for normal nuclear envelope morphology.", "journal": "FEBS letters", "date": "2006", "authors": "Ulbert S, Antonin W, Platani M, Mattaj IW", "reference": { "type": "PubMed", "id": "17097643", "url": "https://pubmed.ncbi.nlm.nih.gov/17097643" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NC56-1", "protein_name": "LEM domain-containing protein 2", "gene_name": "LEMD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17097643", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hutterite-type cataract maps to chromosome 6p21.32-p21.31, cosegregates with a homozygous mutation in LEMD2, and is associated with sudden cardiac death.", "journal": "Molecular genetics & genomic medicine", "date": "2016", "authors": "Boone PM, Yuan B, Gu S, Ma Z, Gambin T, Gonzaga-Jauregui C, Jain M, Murdock TJ, White JJ, Jhangiani SN, Walker K, Wang Q, Muzny DM, Gibbs RA, Hejtmancik JF, Lupski JR, Posey JE, Lewis RA", "reference": { "type": "PubMed", "id": "26788539", "url": "https://pubmed.ncbi.nlm.nih.gov/26788539" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NC56-1", "protein_name": "LEM domain-containing protein 2", "gene_name": "LEMD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26788539", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Discovery of a LEMD2-Associated Nuclear Envelopathy with Early Progeroid Appearance Suggests Advanced Applications for AI-Driven Facial Phenotyping.", "journal": "American journal of human genetics", "date": "2019", "authors": "Marbach F, Rustad CF, Riess A, Dukic D, Hsieh TC, Jobani I, Prescott T, Bevot A, Erger F, Houge G, Redfors M, Altmueller J, Stokowy T, Gilissen C, Kubisch C, Scarano E, Mazzanti L, Fiskerstrand T, Krawitz PM, Lessel D, Netzer C", "reference": { "type": "PubMed", "id": "30905398", "url": "https://pubmed.ncbi.nlm.nih.gov/30905398" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NC56-1", "protein_name": "LEM domain-containing protein 2", "gene_name": "LEMD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30905398", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LEM2 phase separation promotes ESCRT-mediated nuclear envelope reformation.", "journal": "Nature", "date": "2020", "authors": "von Appen A, LaJoie D, Johnson IE, Trnka MJ, Pick SM, Burlingame AL, Ullman KS, Frost A", "reference": { "type": "PubMed", "id": "32494070", "url": "https://pubmed.ncbi.nlm.nih.gov/32494070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NC56-1", "protein_name": "LEM domain-containing protein 2", "gene_name": "LEMD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 145, "end_pos": 213, "sequence_org": "ARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPDPRPGLRATRAGPAGAARARPEVGRRLERWLSRL", "sequence_mut": "", "comment": "Failure to enrich at microtubule-containing nuclear envelope core during anaphase.", "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" }, { "database": "PubMed", "id": "32494070", "url": "https://pubmed.ncbi.nlm.nih.gov/32494070" } ], "uniprot_canonical_ac": "Q8NC56-1" }, { "start_pos": 21, "end_pos": 24, "sequence_org": "GPIT", "sequence_mut": "AAAA", "comment": "Disrupts LEMD2 accumulation within the nuclear envelope (NE) and subsequent NE core enrichment in anaphase cells.", "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" }, { "database": "PubMed", "id": "32494070", "url": "https://pubmed.ncbi.nlm.nih.gov/32494070" } ], "uniprot_canonical_ac": "Q8NC56-1" }, { "start_pos": 415, "end_pos": 485, "sequence_org": "VKKIIDVVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGE", "sequence_mut": "", "comment": "Does not affect nuclear envelope enrichment.", "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" }, { "database": "PubMed", "id": "32494070", "url": "https://pubmed.ncbi.nlm.nih.gov/32494070" } ], "uniprot_canonical_ac": "Q8NC56-1" }, { "start_pos": 43, "end_pos": 202, "sequence_org": "RLRDEERLREEARPRGEERLREEARLREDAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRGLAYPARPAQLRRRASVRGSSEEDEDARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPDPRPGLRATRAGPAGAARARPEV", "sequence_mut": "", "comment": "Compromises nuclear envelope enrichment.", "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" }, { "database": "PubMed", "id": "32494070", "url": "https://pubmed.ncbi.nlm.nih.gov/32494070" } ], "uniprot_canonical_ac": "Q8NC56-1" } ], "record_id": "pubmed.32494070", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SATB2-LEMD2 interaction links nuclear shape plasticity to regulation of cognition-related genes.", "journal": "The EMBO journal", "date": "2021", "authors": "Feurle P, Abentung A, Cera I, Wahl N, Ablinger C, Bucher M, Stefan E, Sprenger S, Teis D, Fischer A, Laighneach A, Whitton L, Morris DW, Apostolova G, Dechant G", "reference": { "type": "PubMed", "id": "33319920", "url": "https://pubmed.ncbi.nlm.nih.gov/33319920" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NC56-1", "protein_name": "LEM domain-containing protein 2", "gene_name": "LEMD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33319920", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Role of the LEMD2 p.L13R Mutation in Dilated Cardiomyopathy.", "journal": "Circulation research", "date": "2023-01-20", "authors": "Vargas Jose D", "reference": { "type": "PubMed", "id": "36656966", "url": "https://pubmed.ncbi.nlm.nih.gov/36656966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NC56-1", "protein_name": "LEM domain-containing protein 2", "gene_name": "LEMD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NC56", "url": "https://www.uniprot.org/uniprotkb/Q8NC56" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36656966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Androgen receptor specifically interacts with a novel p21-activated kinase, PAK6.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Yang F, Li X, Sharma M, Zarnegar M, Lim B, Sun Z", "reference": { "type": "PubMed", "id": "11278661", "url": "https://pubmed.ncbi.nlm.nih.gov/11278661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11278661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of p21-activated kinase 6-mediated inhibition of androgen receptor signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Schrantz N, da Silva Correia J, Fowler B, Ge Q, Sun Z, Bokoch GM", "reference": { "type": "PubMed", "id": "14573606", "url": "https://pubmed.ncbi.nlm.nih.gov/14573606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10275-1", "protein_name": "Androgen receptor", "gene_name": "AR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "Q9NQU5-1", "kinase_gene_name": "PAK6", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NQU5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQU5" }, { "database": "PubMed", "id": "14573606", "url": "https://pubmed.ncbi.nlm.nih.gov/14573606" } ], "site_lbl": "Ser560", "uniprot_canonical_ac": "Q9NQU5-1" }, { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" }, { "database": "iPTMnet", "id": "Q9NQU5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQU5" }, { "database": "PubMed", "id": "14573606", "url": "https://pubmed.ncbi.nlm.nih.gov/14573606" }, { "database": "PubMed", "id": "15550393", "url": "https://pubmed.ncbi.nlm.nih.gov/15550393" }, { "database": "PubMed", "id": "22339630", "url": "https://pubmed.ncbi.nlm.nih.gov/22339630" }, { "database": "PubMed", "id": "24352566", "url": "https://pubmed.ncbi.nlm.nih.gov/24352566" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" } ], "site_lbl": "Ser560", "uniprot_canonical_ac": "Q9NQU5-1" } ], "record_id": "pubmed.14573606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of p21-activated kinase 6 (PAK6) increases radiosensitivity of prostate cancer cells.", "journal": "The Prostate", "date": "2010", "authors": "Zhang M, Siedow M, Saia G, Chakravarti A", "reference": { "type": "PubMed", "id": "20054820", "url": "https://pubmed.ncbi.nlm.nih.gov/20054820" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92934-1", "protein_name": "Bcl2-associated agonist of cell death", "gene_name": "BAD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "Q9NQU5-1", "kinase_gene_name": "PAK6", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q92934", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92934" }, { "database": "PubMed", "id": "20054820", "url": "https://pubmed.ncbi.nlm.nih.gov/20054820" } ], "site_lbl": "Ser75", "uniprot_canonical_ac": "Q92934-1" } ], "record_id": "pubmed.20054820", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A PAK6-IQGAP1 complex promotes disassembly of cell-cell adhesions.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2014", "authors": "Fram S, King H, Sacks DB, Wells CM", "reference": { "type": "PubMed", "id": "24352566", "url": "https://pubmed.ncbi.nlm.nih.gov/24352566" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" }, { "database": "iPTMnet", "id": "Q9NQU5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQU5" }, { "database": "PubMed", "id": "14573606", "url": "https://pubmed.ncbi.nlm.nih.gov/14573606" }, { "database": "PubMed", "id": "15550393", "url": "https://pubmed.ncbi.nlm.nih.gov/15550393" }, { "database": "PubMed", "id": "22339630", "url": "https://pubmed.ncbi.nlm.nih.gov/22339630" }, { "database": "PubMed", "id": "24352566", "url": "https://pubmed.ncbi.nlm.nih.gov/24352566" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" } ], "site_lbl": "Ser560", "uniprot_canonical_ac": "Q9NQU5-1" }, { "start_pos": 675, "end_pos": 675, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P35222", "url": "https://www.uniprot.org/uniprotkb/P35222" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "iPTMnet", "id": "P35222", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35222" }, { "database": "PubMed", "id": "16199882", "url": "https://pubmed.ncbi.nlm.nih.gov/16199882" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PRO", "id": "P35222", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P35222" }, { "database": "PubMed", "id": "16476742", "url": "https://pubmed.ncbi.nlm.nih.gov/16476742" }, { "database": "PubMed", "id": "22369945", "url": "https://pubmed.ncbi.nlm.nih.gov/22369945" }, { "database": "PubMed", "id": "18353896", "url": "https://pubmed.ncbi.nlm.nih.gov/18353896" }, { "database": "PubMed", "id": "19581924", "url": "https://pubmed.ncbi.nlm.nih.gov/19581924" }, { "database": "PubMed", "id": "21108734", "url": "https://pubmed.ncbi.nlm.nih.gov/21108734" }, { "database": "PubMed", "id": "21196815", "url": "https://pubmed.ncbi.nlm.nih.gov/21196815" }, { "database": "PubMed", "id": "21822311", "url": "https://pubmed.ncbi.nlm.nih.gov/21822311" }, { "database": "PubMed", "id": "23552738", "url": "https://pubmed.ncbi.nlm.nih.gov/23552738" }, { "database": "PubMed", "id": "24352566", "url": "https://pubmed.ncbi.nlm.nih.gov/24352566" }, { "database": "PubMed", "id": "24930713", "url": "https://pubmed.ncbi.nlm.nih.gov/24930713" }, { "database": "PubMed", "id": "25143352", "url": "https://pubmed.ncbi.nlm.nih.gov/25143352" }, { "database": "PubMed", "id": "25683913", "url": "https://pubmed.ncbi.nlm.nih.gov/25683913" }, { "database": "PubMed", "id": "26068882", "url": "https://pubmed.ncbi.nlm.nih.gov/26068882" }, { "database": "PubMed", "id": "26425687", "url": "https://pubmed.ncbi.nlm.nih.gov/26425687" }, { "database": "PubMed", "id": "26509276", "url": "https://pubmed.ncbi.nlm.nih.gov/26509276" }, { "database": "PubMed", "id": "26700621", "url": "https://pubmed.ncbi.nlm.nih.gov/26700621" }, { "database": "PubMed", "id": "26780430", "url": "https://pubmed.ncbi.nlm.nih.gov/26780430" }, { "database": "PubMed", "id": "26908451", "url": "https://pubmed.ncbi.nlm.nih.gov/26908451" }, { "database": "PubMed", "id": "27313491", "url": "https://pubmed.ncbi.nlm.nih.gov/27313491" }, { "database": "PubMed", "id": "27363012", "url": "https://pubmed.ncbi.nlm.nih.gov/27363012" }, { "database": "PubMed", "id": "27624192", "url": "https://pubmed.ncbi.nlm.nih.gov/27624192" }, { "database": "PubMed", "id": "27698922", "url": "https://pubmed.ncbi.nlm.nih.gov/27698922" }, { "database": "PubMed", "id": "28159572", "url": "https://pubmed.ncbi.nlm.nih.gov/28159572" }, { "database": "PubMed", "id": "28340578", "url": "https://pubmed.ncbi.nlm.nih.gov/28340578" }, { "database": "PubMed", "id": "28470144", "url": "https://pubmed.ncbi.nlm.nih.gov/28470144" }, { "database": "PubMed", "id": "28495797", "url": "https://pubmed.ncbi.nlm.nih.gov/28495797" }, { "database": "PubMed", "id": "28529629", "url": "https://pubmed.ncbi.nlm.nih.gov/28529629" }, { "database": "PubMed", "id": "28700668", "url": "https://pubmed.ncbi.nlm.nih.gov/28700668" }, { "database": "PubMed", "id": "28943877", "url": "https://pubmed.ncbi.nlm.nih.gov/28943877" }, { "database": "PubMed", "id": "29050202", "url": "https://pubmed.ncbi.nlm.nih.gov/29050202" }, { "database": "PubMed", "id": "29394407", "url": "https://pubmed.ncbi.nlm.nih.gov/29394407" }, { "database": "PubMed", "id": "29415992", "url": "https://pubmed.ncbi.nlm.nih.gov/29415992" }, { "database": "PubMed", "id": "29426364", "url": "https://pubmed.ncbi.nlm.nih.gov/29426364" }, { "database": "PubMed", "id": "29784906", "url": "https://pubmed.ncbi.nlm.nih.gov/29784906" }, { "database": "PubMed", "id": "30165890", "url": "https://pubmed.ncbi.nlm.nih.gov/30165890" }, { "database": "PubMed", "id": "32863225", "url": "https://pubmed.ncbi.nlm.nih.gov/32863225" }, { "database": "PubMed", "id": "33284104", "url": "https://pubmed.ncbi.nlm.nih.gov/33284104" }, { "database": "PubMed", "id": "33321112", "url": "https://pubmed.ncbi.nlm.nih.gov/33321112" }, { "database": "PubMed", "id": "33371405", "url": "https://pubmed.ncbi.nlm.nih.gov/33371405" }, { "database": "PubMed", "id": "33832512", "url": "https://pubmed.ncbi.nlm.nih.gov/33832512" } ], "site_lbl": "Ser675", "uniprot_canonical_ac": "P35222-1" } ], "record_id": "pubmed.24352566", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAK6 Phosphorylates 14-3-3gamma to Regulate Steady State Phosphorylation of LRRK2.", "journal": "Frontiers in molecular neuroscience", "date": "2017", "authors": "Civiero L, Cogo S, Kiekens A, Morganti C, Tessari I, Lobbestael E, Baekelandt V, Taymans JM, Chartier-Harlin MC, Franchin C, Arrigoni G, Lewis PA, Piccoli G, Bubacco L, Cookson MR, Pinton P, Greggio E", "reference": { "type": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NQU5-1", "protein_name": "Serine/threonine-protein kinase PAK 6", "gene_name": "PAK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5S007-1", "protein_name": "Leucine-rich repeat serine/threonine-protein kinase 2", "gene_name": "LRRK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61981-1", "protein_name": "14-3-3 protein gamma", "gene_name": "YWHAG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 531, "end_pos": 531, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NQU5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQU5" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" } ], "site_lbl": "Ser531", "uniprot_canonical_ac": "Q9NQU5-1" }, { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q9NQU5", "url": "https://www.uniprot.org/uniprotkb/Q9NQU5" }, { "database": "iPTMnet", "id": "Q9NQU5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQU5" }, { "database": "PubMed", "id": "14573606", "url": "https://pubmed.ncbi.nlm.nih.gov/14573606" }, { "database": "PubMed", "id": "15550393", "url": "https://pubmed.ncbi.nlm.nih.gov/15550393" }, { "database": "PubMed", "id": "22339630", "url": "https://pubmed.ncbi.nlm.nih.gov/22339630" }, { "database": "PubMed", "id": "24352566", "url": "https://pubmed.ncbi.nlm.nih.gov/24352566" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" } ], "site_lbl": "Ser560", "uniprot_canonical_ac": "Q9NQU5-1" }, { "start_pos": 935, "end_pos": 935, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5S007", "url": "https://www.uniprot.org/uniprotkb/Q5S007" }, { "database": "PubMed", "id": "28720718", "url": "https://pubmed.ncbi.nlm.nih.gov/28720718" }, { "database": "PubMed", "id": "29127255", "url": "https://pubmed.ncbi.nlm.nih.gov/29127255" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "28202711", "url": "https://pubmed.ncbi.nlm.nih.gov/28202711" }, { "database": "PubMed", "id": "30635421", "url": "https://pubmed.ncbi.nlm.nih.gov/30635421" }, { "database": "iPTMnet", "id": "Q5S007", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5S007" }, { "database": "PubMed", "id": "17200152", "url": "https://pubmed.ncbi.nlm.nih.gov/17200152" }, { "database": "PubMed", "id": "20642453", "url": "https://pubmed.ncbi.nlm.nih.gov/20642453" }, { "database": "PubMed", "id": "20659021", "url": "https://pubmed.ncbi.nlm.nih.gov/20659021" }, { "database": "PubMed", "id": "22004453", "url": "https://pubmed.ncbi.nlm.nih.gov/22004453" }, { "database": "PubMed", "id": "22952710", "url": "https://pubmed.ncbi.nlm.nih.gov/22952710" }, { "database": "PubMed", "id": "22988882", "url": "https://pubmed.ncbi.nlm.nih.gov/22988882" }, { "database": "PubMed", "id": "23916833", "url": "https://pubmed.ncbi.nlm.nih.gov/23916833" }, { "database": "PubMed", "id": "23938344", "url": "https://pubmed.ncbi.nlm.nih.gov/23938344" }, { "database": "PubMed", "id": "24836358", "url": "https://pubmed.ncbi.nlm.nih.gov/24836358" }, { "database": "PubMed", "id": "24917786", "url": "https://pubmed.ncbi.nlm.nih.gov/24917786" }, { "database": "PubMed", "id": "24942733", "url": "https://pubmed.ncbi.nlm.nih.gov/24942733" }, { "database": "PubMed", "id": "25009464", "url": "https://pubmed.ncbi.nlm.nih.gov/25009464" }, { "database": "PubMed", "id": "25118928", "url": "https://pubmed.ncbi.nlm.nih.gov/25118928" }, { "database": "PubMed", "id": "25830304", "url": "https://pubmed.ncbi.nlm.nih.gov/25830304" }, { "database": "PubMed", "id": "27911006", "url": "https://pubmed.ncbi.nlm.nih.gov/27911006" }, { "database": "PubMed", "id": "28353278", "url": "https://pubmed.ncbi.nlm.nih.gov/28353278" }, { "database": "PubMed", "id": "28353283", "url": "https://pubmed.ncbi.nlm.nih.gov/28353283" }, { "database": "PubMed", "id": "28453723", "url": "https://pubmed.ncbi.nlm.nih.gov/28453723" }, { "database": "PubMed", "id": "28553204", "url": "https://pubmed.ncbi.nlm.nih.gov/28553204" }, { "database": "PubMed", "id": "28860483", "url": "https://pubmed.ncbi.nlm.nih.gov/28860483" }, { "database": "PubMed", "id": "28973420", "url": "https://pubmed.ncbi.nlm.nih.gov/28973420" }, { "database": "PubMed", "id": "29127256", "url": "https://pubmed.ncbi.nlm.nih.gov/29127256" }, { "database": "PubMed", "id": "29129681", "url": "https://pubmed.ncbi.nlm.nih.gov/29129681" }, { "database": "PubMed", "id": "29166931", "url": "https://pubmed.ncbi.nlm.nih.gov/29166931" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" }, { "database": "PubMed", "id": "29513666", "url": "https://pubmed.ncbi.nlm.nih.gov/29513666" }, { "database": "PubMed", "id": "29541021", "url": "https://pubmed.ncbi.nlm.nih.gov/29541021" }, { "database": "PubMed", "id": "29743203", "url": "https://pubmed.ncbi.nlm.nih.gov/29743203" }, { "database": "PubMed", "id": "30592011", "url": "https://pubmed.ncbi.nlm.nih.gov/30592011" }, { "database": "PubMed", "id": "31428781", "url": "https://pubmed.ncbi.nlm.nih.gov/31428781" }, { "database": "PubMed", "id": "31527116", "url": "https://pubmed.ncbi.nlm.nih.gov/31527116" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "32499675", "url": "https://pubmed.ncbi.nlm.nih.gov/32499675" }, { "database": "PubMed", "id": "32736291", "url": "https://pubmed.ncbi.nlm.nih.gov/32736291" }, { "database": "PubMed", "id": "33057100", "url": "https://pubmed.ncbi.nlm.nih.gov/33057100" }, { "database": "PubMed", "id": "33297425", "url": "https://pubmed.ncbi.nlm.nih.gov/33297425" }, { "database": "PubMed", "id": "34125248", "url": "https://pubmed.ncbi.nlm.nih.gov/34125248" }, { "database": "PubMed", "id": "35675433", "url": "https://pubmed.ncbi.nlm.nih.gov/35675433" }, { "database": "PubMed", "id": "35950872", "url": "https://pubmed.ncbi.nlm.nih.gov/35950872" } ], "site_lbl": "Ser935", "uniprot_canonical_ac": "Q5S007-1" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P61981", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61981" }, { "database": "PubMed", "id": "21118956", "url": "https://pubmed.ncbi.nlm.nih.gov/21118956" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" } ], "site_lbl": "Ser59", "uniprot_canonical_ac": "P61981-1" } ], "record_id": "pubmed.29311810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A de novo mutation in the beta-tubulin gene TUBB4A results in the leukoencephalopathy hypomyelination with atrophy of the basal ganglia and cerebellum.", "journal": "American journal of human genetics", "date": "2013", "authors": "Simons C, Wolf NI, McNeil N, Caldovic L, Devaney JM, Takanohashi A, Crawford J, Ru K, Grimmond SM, Miller D, Tonduti D, Schmidt JL, Chudnow RS, van Coster R, Lagae L, Kisler J, Sperner J, van der Knaap MS, Schiffmann R, Taft RJ, Vanderver A", "reference": { "type": "PubMed", "id": "23582646", "url": "https://pubmed.ncbi.nlm.nih.gov/23582646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04350", "url": "https://www.uniprot.org/uniprotkb/P04350" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23582646", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation in the \u03b2-tubulin gene TUBB4A results in epileptic encephalopathy associated with hypomyelinated leucodystrophy: Unexpected findings reveal genetic mosaicism.", "journal": "International journal of developmental neuroscience : the official journal of the International Society for Developmental Neuroscience", "date": "2023-08-02", "authors": "Ben Jdila Marwa, Kammoun Fatma, Abdelmaksoud-Dammak Rania, Triki Chahnez, Fakhfakh Faiza", "reference": { "type": "PubMed", "id": "37529938", "url": "https://pubmed.ncbi.nlm.nih.gov/37529938" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04350", "url": "https://www.uniprot.org/uniprotkb/P04350" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37529938", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expanding the phenotypic and genotypic spectrum of DYT-TUBB4A with seven patients from India.", "journal": "Parkinsonism & related disorders", "date": "2024-07", "authors": "Garg Divyani, Holla Vikram V, Ganguly Jacky, Rajan Roopa, Saini Arti, Agarwal Ayush, Radhakrishnan Divya M, Basu Purba, Mondal Banashree, Dhar Debjyoti, Kamble Nitish, Yadav Ravi, Muthusamy Babylakshmi, Kumar Hrishikesh, Srivastava Achal Kumar, Pal Pramod Kumar", "reference": { "type": "PubMed", "id": "38762926", "url": "https://pubmed.ncbi.nlm.nih.gov/38762926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04350", "url": "https://www.uniprot.org/uniprotkb/P04350" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38762926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence of an expressed human beta-tubulin gene containing ten Alu family members.", "journal": "Nucleic Acids Res.", "date": "1984", "authors": "Lee MG, Loomis C, Cowan NJ", "reference": { "type": "PubMed", "id": "6462917", "url": "https://pubmed.ncbi.nlm.nih.gov/6462917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04350", "url": "https://www.uniprot.org/uniprotkb/P04350" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6462917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Viral inhibition of interferon signal transduction.", "journal": "Intervirology", "date": "1999", "authors": "Cebulla C M, Miller D M, Sedmak D D", "reference": { "type": "PubMed", "id": "10702714", "url": "https://pubmed.ncbi.nlm.nih.gov/10702714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10702714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arginine/lysine-rich structural element is involved in interferon-induced nuclear import of STATs.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Melen K, Kinnunen L, Julkunen I", "reference": { "type": "PubMed", "id": "11150296", "url": "https://pubmed.ncbi.nlm.nih.gov/11150296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 374, "end_pos": 374, "sequence_org": "R", "sequence_mut": "A", "comment": "Prevents the nuclear import; when associated with A-375.", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "11150296", "url": "https://pubmed.ncbi.nlm.nih.gov/11150296" } ], "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 375, "end_pos": 375, "sequence_org": "K", "sequence_mut": "A", "comment": "Prevents the nuclear import; when associated with A-374.", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "11150296", "url": "https://pubmed.ncbi.nlm.nih.gov/11150296" } ], "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 409, "end_pos": 409, "sequence_org": "R", "sequence_mut": "A", "comment": "Prevents the nuclear import; when associated with A-415.", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "11150296", "url": "https://pubmed.ncbi.nlm.nih.gov/11150296" } ], "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 415, "end_pos": 415, "sequence_org": "K", "sequence_mut": "A", "comment": "Prevents the nuclear import; when associated with A-409.", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "11150296", "url": "https://pubmed.ncbi.nlm.nih.gov/11150296" } ], "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.11150296", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The proteins of ISGF-3, the interferon alpha-induced transcriptional activator, define a gene family involved in signal transduction.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Fu X Y, Schindler C, Improta T, Aebersold R, Darnell J E", "reference": { "type": "PubMed", "id": "1502204", "url": "https://pubmed.ncbi.nlm.nih.gov/1502204" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1502204", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effect of ethanol on innate antiviral pathways and HCV replication in human liver cells.", "journal": "Virology journal", "date": "2005", "authors": "Plumlee CR, Lazaro CA, Fausto N, Polyak SJ", "reference": { "type": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 727, "end_pos": 727, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CaMK2, CDK8 and MAPK14", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "14963018", "url": "https://pubmed.ncbi.nlm.nih.gov/14963018" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "PubMed", "id": "9355737", "url": "https://pubmed.ncbi.nlm.nih.gov/9355737" }, { "database": "PubMed", "id": "16799645", "url": "https://pubmed.ncbi.nlm.nih.gov/16799645" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10329948", "url": "https://pubmed.ncbi.nlm.nih.gov/10329948" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10523304", "url": "https://pubmed.ncbi.nlm.nih.gov/10523304" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10570180", "url": "https://pubmed.ncbi.nlm.nih.gov/10570180" }, { "database": "PubMed", "id": "10645003", "url": "https://pubmed.ncbi.nlm.nih.gov/10645003" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10753717", "url": "https://pubmed.ncbi.nlm.nih.gov/10753717" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "10878008", "url": "https://pubmed.ncbi.nlm.nih.gov/10878008" }, { "database": "PubMed", "id": "10918594", "url": "https://pubmed.ncbi.nlm.nih.gov/10918594" }, { "database": "PubMed", "id": "10940874", "url": "https://pubmed.ncbi.nlm.nih.gov/10940874" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11884587", "url": "https://pubmed.ncbi.nlm.nih.gov/11884587" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12232043", "url": "https://pubmed.ncbi.nlm.nih.gov/12232043" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12748293", "url": "https://pubmed.ncbi.nlm.nih.gov/12748293" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12807916", "url": "https://pubmed.ncbi.nlm.nih.gov/12807916" }, { "database": "PubMed", "id": "12811837", "url": "https://pubmed.ncbi.nlm.nih.gov/12811837" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "12856330", "url": "https://pubmed.ncbi.nlm.nih.gov/12856330" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14648593", "url": "https://pubmed.ncbi.nlm.nih.gov/14648593" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15585657", "url": "https://pubmed.ncbi.nlm.nih.gov/15585657" }, { "database": "PubMed", "id": "15695932", "url": "https://pubmed.ncbi.nlm.nih.gov/15695932" }, { "database": "PubMed", "id": "15728510", "url": "https://pubmed.ncbi.nlm.nih.gov/15728510" }, { "database": "PubMed", "id": "15850832", "url": "https://pubmed.ncbi.nlm.nih.gov/15850832" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "15994429", "url": "https://pubmed.ncbi.nlm.nih.gov/15994429" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16204068", "url": "https://pubmed.ncbi.nlm.nih.gov/16204068" }, { "database": "PubMed", "id": "16257975", "url": "https://pubmed.ncbi.nlm.nih.gov/16257975" }, { "database": "PubMed", "id": "16260419", "url": "https://pubmed.ncbi.nlm.nih.gov/16260419" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16343349", "url": "https://pubmed.ncbi.nlm.nih.gov/16343349" }, { "database": "PubMed", "id": "16516295", "url": "https://pubmed.ncbi.nlm.nih.gov/16516295" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17258468", "url": "https://pubmed.ncbi.nlm.nih.gov/17258468" }, { "database": "PubMed", "id": "17293456", "url": "https://pubmed.ncbi.nlm.nih.gov/17293456" }, { "database": "PubMed", "id": "17371985", "url": "https://pubmed.ncbi.nlm.nih.gov/17371985" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17565448", "url": "https://pubmed.ncbi.nlm.nih.gov/17565448" }, { "database": "PubMed", "id": "17785783", "url": "https://pubmed.ncbi.nlm.nih.gov/17785783" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17933493", "url": "https://pubmed.ncbi.nlm.nih.gov/17933493" }, { "database": "PubMed", "id": "18190974", "url": "https://pubmed.ncbi.nlm.nih.gov/18190974" }, { "database": "PubMed", "id": "18378670", "url": "https://pubmed.ncbi.nlm.nih.gov/18378670" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19214187", "url": "https://pubmed.ncbi.nlm.nih.gov/19214187" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19801665", "url": "https://pubmed.ncbi.nlm.nih.gov/19801665" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20675591", "url": "https://pubmed.ncbi.nlm.nih.gov/20675591" }, { "database": "PubMed", "id": "21084836", "url": "https://pubmed.ncbi.nlm.nih.gov/21084836" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21783819", "url": "https://pubmed.ncbi.nlm.nih.gov/21783819" }, { "database": "PubMed", "id": "21878628", "url": "https://pubmed.ncbi.nlm.nih.gov/21878628" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22823229", "url": "https://pubmed.ncbi.nlm.nih.gov/22823229" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23352233", "url": "https://pubmed.ncbi.nlm.nih.gov/23352233" }, { "database": "PubMed", "id": "23449448", "url": "https://pubmed.ncbi.nlm.nih.gov/23449448" }, { "database": "PubMed", "id": "23597922", "url": "https://pubmed.ncbi.nlm.nih.gov/23597922" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23760261", "url": "https://pubmed.ncbi.nlm.nih.gov/23760261" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25753288", "url": "https://pubmed.ncbi.nlm.nih.gov/25753288" }, { "database": "PubMed", "id": "25941617", "url": "https://pubmed.ncbi.nlm.nih.gov/25941617" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "25995822", "url": "https://pubmed.ncbi.nlm.nih.gov/25995822" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28086195", "url": "https://pubmed.ncbi.nlm.nih.gov/28086195" }, { "database": "PubMed", "id": "28262979", "url": "https://pubmed.ncbi.nlm.nih.gov/28262979" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28431406", "url": "https://pubmed.ncbi.nlm.nih.gov/28431406" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28560754", "url": "https://pubmed.ncbi.nlm.nih.gov/28560754" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30724425", "url": "https://pubmed.ncbi.nlm.nih.gov/30724425" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31653890", "url": "https://pubmed.ncbi.nlm.nih.gov/31653890" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32319563", "url": "https://pubmed.ncbi.nlm.nih.gov/32319563" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32731335", "url": "https://pubmed.ncbi.nlm.nih.gov/32731335" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33692335", "url": "https://pubmed.ncbi.nlm.nih.gov/33692335" }, { "database": "PubMed", "id": "33747209", "url": "https://pubmed.ncbi.nlm.nih.gov/33747209" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "36154299", "url": "https://pubmed.ncbi.nlm.nih.gov/36154299" }, { "database": "PubMed", "id": "36342456", "url": "https://pubmed.ncbi.nlm.nih.gov/36342456" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9399961", "url": "https://pubmed.ncbi.nlm.nih.gov/9399961" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" } ], "site_lbl": "Ser727", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.16324217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A transcription factor with SH2 and SH3 domains is directly activated by an interferon alpha-induced cytoplasmic protein tyrosine kinase(s).", "journal": "Cell", "date": "1992", "authors": "Fu XY", "reference": { "type": "PubMed", "id": "1638633", "url": "https://pubmed.ncbi.nlm.nih.gov/1638633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1638633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition.", "journal": "J. Virol.", "date": "2008", "authors": "Ramachandran Aparna, Parisien Jean-Patrick, Horvath Curt M", "reference": { "type": "PubMed", "id": "18579593", "url": "https://pubmed.ncbi.nlm.nih.gov/18579593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18579593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding STAT2 by the acidic domain of human cytomegalovirus IE1 promotes viral growth and is negatively regulated by SUMO.", "journal": "J. Virol.", "date": "2008", "authors": "Huh Yong Ho, Kim Young Eui, Kim Eui Tae, Park Jung Jin, Song Moon Jung, Zhu Hua, Hayward Gary S, Ahn Jin-Hyun", "reference": { "type": "PubMed", "id": "18701593", "url": "https://pubmed.ncbi.nlm.nih.gov/18701593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18701593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of IFN-alpha/beta signaling by two discrete peptides within measles virus V protein that specifically bind STAT1 and STAT2.", "journal": "Virology", "date": "2009", "authors": "Caignard Gr\u00e9gory, Boura\u00ef Mehdi, Jacob Yves, , Tangy Fr\u00e9d\u00e9ric, Vidalain Pierre-Olivier", "reference": { "type": "PubMed", "id": "19007958", "url": "https://pubmed.ncbi.nlm.nih.gov/19007958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19007958", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NS5 of dengue virus mediates STAT2 binding and degradation.", "journal": "J. Virol.", "date": "2009", "authors": "Ashour Joseph, Laurent-Rolle Maudry, Shi Pei-Yong, Garc\u00eda-Sastre Adolfo", "reference": { "type": "PubMed", "id": "19279106", "url": "https://pubmed.ncbi.nlm.nih.gov/19279106" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19279106", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Physical requirements and functional consequences of complex formation between the cytomegalovirus IE1 protein and human STAT2.", "journal": "J. Virol.", "date": "2009", "authors": "Krauss Steffen, Kaps Julia, Czech Nathalie, Paulus Christina, Nevels Michael", "reference": { "type": "PubMed", "id": "19812155", "url": "https://pubmed.ncbi.nlm.nih.gov/19812155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19812155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhanced anti-melanoma efficacy of interferon alfa-2b via inhibition of Shp2.", "journal": "Cancer letters", "date": "2012", "authors": "Win-Piazza H, Schneeberger VE, Chen L, Pernazza D, Lawrence HR, Sebti SM, Lawrence NJ, Wu J", "reference": { "type": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.22306001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of type I interferons by a novel porcine reproductive and respiratory syndrome virus isolate.", "journal": "Virology", "date": "2012-10-25", "authors": "Nan Yuchen, Wang Rong, Shen Meiyan, Faaberg Kay S, Samal Siba K, Zhang Yan-Jin", "reference": { "type": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.22704065", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of STAT2 serine 287 as a novel regulatory phosphorylation site in type I interferon-induced cellular responses.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Steen HC, Nogusa S, Thapa RJ, Basagoudanavar SH, Gill AL, Merali S, Barrero CA, Balachandran S, Gamero AM", "reference": { "type": "PubMed", "id": "23139419", "url": "https://pubmed.ncbi.nlm.nih.gov/23139419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "23139419", "url": "https://pubmed.ncbi.nlm.nih.gov/23139419" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" } ], "site_lbl": "Ser283", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "23139419", "url": "https://pubmed.ncbi.nlm.nih.gov/23139419" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "27802159", "url": "https://pubmed.ncbi.nlm.nih.gov/27802159" } ], "site_lbl": "Ser287", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "23139419", "url": "https://pubmed.ncbi.nlm.nih.gov/23139419" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" } ], "site_lbl": "Thr294", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.23139419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STAT2 deficiency and susceptibility to viral illness in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013-02-19", "authors": "Hambleton Sophie, Goodbourn Stephen, Young Dan F, Dickinson Paul, Mohamad Siti M B, Valappil Manoj, McGovern Naomi, Cant Andrew J, Hackett Scott J, Ghazal Peter, Morgan Neil V, Randall Richard E", "reference": { "type": "PubMed", "id": "23391734", "url": "https://pubmed.ncbi.nlm.nih.gov/23391734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23391734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STAT2/IRF9 directs a prolonged ISGF3-like transcriptional response and antiviral activity in the absence of STAT1.", "journal": "The Biochemical journal", "date": "2015-03-15", "authors": "Blaszczyk Katarzyna, Olejnik Adam, Nowicka Hanna, Ozgyin Lilla, Chen Yi-Ling, Chmielewski Stefan, Kostyrko Kaja, Wesoly Joanna, Balint Balint Laszlo, Lee Chien-Kuo, Bluyssen Hans A R", "reference": { "type": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.25564224", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of type I interferon signaling by the nonstructural protein of severe fever with thrombocytopenia syndrome virus via the hijacking of STAT2 and STAT1 into inclusion bodies.", "journal": "J. Virol.", "date": "2015", "authors": "Ning Yun-Jia, Feng Kuan, Min Yuan-Qin, Cao Wu-Chun, Wang Manli, Deng Fei, Hu Zhihong, Wang Hualin", "reference": { "type": "PubMed", "id": "25631085", "url": "https://pubmed.ncbi.nlm.nih.gov/25631085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25631085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Porcine bocavirus NP1 negatively regulates interferon signaling pathway by targeting the DNA-binding domain of IRF9.", "journal": "Virology", "date": "2015-11", "authors": "Zhang Ruoxi, Fang Liurong, Wang Dang, Cai Kaimei, Zhang Huan, Xie Lilan, Li Yi, Chen Huanchun, Xiao Shaobo", "reference": { "type": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.26342467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zika Virus Targets Human STAT2 to Inhibit Type I Interferon Signaling.", "journal": "Cell Host Microbe", "date": "2016", "authors": "Grant Alesha, Ponia Sanket S, Tripathi Shashank, Balasubramaniam Vinod, Miorin Lisa, Sourisseau Marion, Schwarz Megan C, S\u00e1nchez-Seco Mari Paz, Evans Matthew J, Best Sonja M, Garc\u00eda-Sastre Adolfo", "reference": { "type": "PubMed", "id": "27212660", "url": "https://pubmed.ncbi.nlm.nih.gov/27212660" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27212660", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Global functional profiling of human ubiquitome identifies E3 ubiquitin ligase DCST1 as a novel negative regulator of Type-I interferon signaling.", "journal": "Scientific reports", "date": "2016", "authors": "Nair S, Bist P, Dikshit N, Krishnan MN", "reference": { "type": "PubMed", "id": "27782195", "url": "https://pubmed.ncbi.nlm.nih.gov/27782195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T197-1", "protein_name": "E3 ubiquitin-protein ligase DCST1", "gene_name": "DCST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27782195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zika virus inhibits type-I interferon production and downstream signaling.", "journal": "EMBO Rep.", "date": "2016", "authors": "Kumar Anil, Hou Shangmei, Airo Adriana M, Limonta Daniel, Mancinelli Valeria, Branton William, Power Christopher, Hobman Tom C", "reference": { "type": "PubMed", "id": "27797853", "url": "https://pubmed.ncbi.nlm.nih.gov/27797853" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27797853", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of STAT2 on serine-734 negatively regulates the IFN-alpha-induced antiviral response.", "journal": "Journal of cell science", "date": "2016", "authors": "Steen HC, Kotredes KP, Nogusa S, Harris MY, Balachandran S, Gamero AM", "reference": { "type": "PubMed", "id": "27802159", "url": "https://pubmed.ncbi.nlm.nih.gov/27802159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "23139419", "url": "https://pubmed.ncbi.nlm.nih.gov/23139419" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "27802159", "url": "https://pubmed.ncbi.nlm.nih.gov/27802159" } ], "site_lbl": "Ser287", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 734, "end_pos": 734, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "27802159", "url": "https://pubmed.ncbi.nlm.nih.gov/27802159" } ], "site_lbl": "Ser734", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.27802159", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of STAT2 recognition by IRF9 reveals molecular insights into ISGF3 function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Rengachari S, Groiss S, Devos JM, Caron E, Grandvaux N, Panne D", "reference": { "type": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.29317535", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IRF9 and unphosphorylated STAT2 cooperate with NF-kappaB to drive IL6 expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Nan J, Wang Y, Yang J, Stark GR", "reference": { "type": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.29581268", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonstructural protein of severe fever with thrombocytopenia syndrome phlebovirus targets STAT2 and not STAT1 to inhibit type I interferon-stimulated JAK-STAT signaling.", "journal": "Microbes Infect.", "date": "2018", "authors": "Kitagawa Y, Sakai M, Shimojima M, Saijo M, Itoh M, Gotoh B", "reference": { "type": "PubMed", "id": "29886262", "url": "https://pubmed.ncbi.nlm.nih.gov/29886262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29886262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heartland virus antagonizes type I and III interferon antiviral signaling by inhibiting phosphorylation and nuclear translocation of STAT2 and STAT1.", "journal": "J. Biol. Chem.", "date": "2019", "authors": "Feng Kuan, Deng Fei, Hu Zhihong, Wang Hualin, Ning Yun-Jia", "reference": { "type": "PubMed", "id": "31040183", "url": "https://pubmed.ncbi.nlm.nih.gov/31040183" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31040183", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Severe type I interferonopathy and unrestrained interferon signaling due to a homozygous germline mutation in STAT2.", "journal": "Science immunology", "date": "2019", "authors": "Duncan CJA, Thompson BJ, Chen R, Rice GI, Gothe F, Young DF, Lovell SC, Shuttleworth VG, Brocklebank V, Corner B, Skelton AJ, Bondet V, Coxhead J, Duffy D, Fourrage C, Livingston JH, Pavaine J, Cheesman E, Bitetti S, Grainger A, Acres M, Innes BA, Mikulasova A, Sun R, Hussain R, Wright R, Wynn R, Zarhrate M, Zeef LAH, Wood K, Hughes SM, Harris CL, Engelhardt KR, Crow YJ, Randall RE, Kavanagh D, Hambleton S, Briggs TA", "reference": { "type": "PubMed", "id": "31836668", "url": "https://pubmed.ncbi.nlm.nih.gov/31836668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31836668", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homozygous STAT2 gain-of-function mutation by loss of USP18 activity in a patient with type I interferonopathy.", "journal": "The Journal of experimental medicine", "date": "2020", "authors": "Gruber C, Martin-Fernandez M, Ailal F, Qiu X, Taft J, Altman J, Rosain J, Buta S, Bousfiha A, Casanova JL, Bustamante J, Bogunovic D", "reference": { "type": "PubMed", "id": "32092142", "url": "https://pubmed.ncbi.nlm.nih.gov/32092142" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32092142", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tick-borne encephalitis virus NS4A ubiquitination antagonizes type I interferon-stimulated STAT1/2 signalling pathway.", "journal": "Emerging microbes & infections", "date": "2020-12", "authors": "Yang Qi, You Jia, Zhou Yuan, Wang Yun, Pei Rongjuan, Chen Xinwen, Yang Min, Chen Jizheng", "reference": { "type": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.32196427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disentangling molecular mechanisms regulating sensitization of interferon alpha signal transduction.", "journal": "Molecular systems biology", "date": "2020-07", "authors": "Kok Fr\u00e9d\u00e9rique, Rosenblatt Marcus, Teusel Melissa, Nizharadze Tamar, Gon\u00e7alves Magalh\u00e3es Vladimir, D\u00e4chert Christopher, Maiwald Tim, Vlasov Artyom, W\u00e4sch Marvin, Tyufekchieva Silvana, Hoffmann Katrin, Damm Georg, Seehofer Daniel, Boettler Tobias, Binder Marco, Timmer Jens, Schilling Marcel, Klingm\u00fcller Ursula", "reference": { "type": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.32696599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Herpes Simplex Virus Type 2 Inhibits Type I IFN Signaling Mediated by the Novel E3 Ubiquitin Protein Ligase Activity of Viral Protein ICP22.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2020", "authors": "Zhang M, Fu M, Li M, Hu H, Gong S, Hu Q", "reference": { "type": "PubMed", "id": "32699158", "url": "https://pubmed.ncbi.nlm.nih.gov/32699158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32699158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Initial activation of STAT2 induced by IAV infection is critical for innate antiviral immunity.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Li X, Liu S, Rai KR, Zhou W, Wang S, Chi X, Guo G, Chen JL, Liu S", "reference": { "type": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.36148221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of the impact of AXL, TLR3, and STAT2 in congenital Zika syndrome through genetic polymorphisms and protein-protein interaction network analyses.", "journal": "Birth defects research", "date": "2023-10-01", "authors": "Gomes Julia A, Sgarioni Eduarda, Boquett Juliano A, Kowalski Thayne W, Fraga Lucas R, Ter\u00e7as-Trettel Ana Cl\u00e1udia P, da Silva Juliana H, Ribeiro Beth\u00e2nia F R, Galera Marcial F, de Oliveira Thalita M, Carvalho de Andrade Maria Denise F, Carvalho Isabella F, Sch\u00fcler-Faccini Lav\u00ednia, Vianna Fernanda S L", "reference": { "type": "PubMed", "id": "37526179", "url": "https://pubmed.ncbi.nlm.nih.gov/37526179" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37526179", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ISGF3 and STAT2/IRF9 Control Basal and IFN-Induced Transcription through Genome-Wide Binding of Phosphorylated and Unphosphorylated Complexes to Common ISRE-Containing ISGs.", "journal": "International journal of molecular sciences", "date": "2023-12-18", "authors": "Nowicka Hanna, Sekrecka Agata, Blaszczyk Katarzyna, Kluzek Katarzyna, Chang Chan-Yu, Wesoly Joanna, Lee Chien-Kuo, Bluyssen Hans A R", "reference": { "type": "PubMed", "id": "38139463", "url": "https://pubmed.ncbi.nlm.nih.gov/38139463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38139463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The lack of either IRF9, or STAT2, has surprisingly little effect on human natural killer cell development and function.", "journal": "Immunology", "date": "2024-03-21", "authors": "Calvo-Apalategi Ane, Nevado Marta L\u00f3pez, Bravo-Gallego Luz Yadira, Gonz\u00e1lez-Granado Luis Ignacio, Allende Luis M, Pena Rebeca Rodr\u00edguez, L\u00f3pez-Granados Eduardo, Reyburn Hugh T", "reference": { "type": "PubMed", "id": "38514903", "url": "https://pubmed.ncbi.nlm.nih.gov/38514903" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38514903", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "African swine fever virus pB475L evades host antiviral innate immunity via targeting STAT2 to inhibit IFN-I signaling.", "journal": "The Journal of biological chemistry", "date": "2024-07", "authors": "Huang Zhao, Mai Zhanzhuo, Kong Cuiying, You Jianyi, Lin Sizhan, Gao Chenyang, Zhang WenBo, Chen Xiongnan, Xie Qingmei, Wang Heng, Tang Shengqiu, Zhou Pei, Gong Lang, Zhang Guihong", "reference": { "type": "PubMed", "id": "38879005", "url": "https://pubmed.ncbi.nlm.nih.gov/38879005" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38879005", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "OGT-regulated O-GlcNAcylation promotes the malignancy of colorectal cancer by activating STAT2 to induce macrophage M2: OGT protein macromolecule action.", "journal": "International journal of biological macromolecules", "date": "2025-06", "authors": "Wang Meng, Qiao Li, Jin Li, Chen Yuanyuan, Wen Xing, Wang Haijuan", "reference": { "type": "PubMed", "id": "40348242", "url": "https://pubmed.ncbi.nlm.nih.gov/40348242" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 338, "start_aa": "Ser", "end_pos": 338, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser338", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "P52630", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P52630" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "40348242", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40348242" }, { "id": "P52630", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P52630" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P52630-3" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 341, "start_aa": "Thr", "end_pos": 341, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr341", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29351928" }, { "id": "P52630", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P52630" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "40348242", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40348242" }, { "id": "P52630", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P52630" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.40348242", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "exact_o_linked_glycan_sites", "count": 2 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "exact_o_linked_glycan_sites", "count": 2 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of STAT2 in the alpha interferon signaling pathway.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Leung S, Qureshi SA, Kerr IM, Darnell JE Jr, Stark GR", "reference": { "type": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 690, "end_pos": 690, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduces phosphorylation of STAT1 in response to IFN-ALPHA.", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "uniprot_canonical_ac": "P52630-3" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.7532278", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The genomic structure of the STAT genes: multiple exons in coincident sites in Stat1 and Stat2.", "journal": "Nucleic Acids Res.", "date": "1995", "authors": "Yan R, Qureshi S, Zhong Z, Wen Z, Darnell JE Jr", "reference": { "type": "PubMed", "id": "7885841", "url": "https://pubmed.ncbi.nlm.nih.gov/7885841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7885841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of alternative splicing form of Stat2.", "journal": "FEBS Lett.", "date": "1996", "authors": "Sugiyama T, Nishio Y, Kishimoto T, Akira S", "reference": { "type": "PubMed", "id": "8601453", "url": "https://pubmed.ncbi.nlm.nih.gov/8601453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WVL2-1", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "Stat2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8601453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SH2 domains of Stat1 and Stat2 mediate multiple interactions in the transduction of IFN-alpha signals.", "journal": "The EMBO journal", "date": "1996-03-01", "authors": "Gupta S, Yan H, Wong L H, Ralph S, Krolewski J, Schindler C", "reference": { "type": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.8605877", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stat2 is a transcriptional activator that requires sequence-specific contacts provided by stat1 and p48 for stable interaction with DNA.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Bluyssen HA, Levy DE", "reference": { "type": "PubMed", "id": "9020188", "url": "https://pubmed.ncbi.nlm.nih.gov/9020188" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "P23458-1", "kinase_gene_name": "JAK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "9020188", "url": "https://pubmed.ncbi.nlm.nih.gov/9020188" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.9020188", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In vivo restoration of laminin 5 beta 3 expression and function in junctional epidermolysis bullosa.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "Robbins P B, Lin Q, Goodnough J B, Tian H, Chen X, Khavari P A", "reference": { "type": "PubMed", "id": "11296269", "url": "https://pubmed.ncbi.nlm.nih.gov/11296269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13751-1", "protein_name": "Laminin subunit beta-3", "gene_name": "LAMB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13751", "url": "https://www.uniprot.org/uniprotkb/Q13751" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11296269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Revertant mosaicism in junctional epidermolysis bullosa due to multiple correcting second-site mutations in LAMB3.", "journal": "The Journal of clinical investigation", "date": "2007", "authors": "Pasmooij AM, Pas HH, Bolling MC, Jonkman MF", "reference": { "type": "PubMed", "id": "17476356", "url": "https://pubmed.ncbi.nlm.nih.gov/17476356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13751-1", "protein_name": "Laminin subunit beta-3", "gene_name": "LAMB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13751", "url": "https://www.uniprot.org/uniprotkb/Q13751" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17476356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-GlcNAc-specific antibody CTD110.6 cross-reacts with N-GlcNAc2-modified proteins induced under glucose deprivation.", "journal": "PloS one", "date": "2011", "authors": "Isono T", "reference": { "type": "PubMed", "id": "21526146", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13751-1", "protein_name": "Laminin subunit beta-3", "gene_name": "LAMB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08380-1", "protein_name": "Galectin-3-binding protein", "gene_name": "LGALS3BP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08195-2", "protein_name": "Amino acid transporter heavy chain SLC3A2", "gene_name": "SLC3A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4L1-1", "protein_name": "Hypoxia up-regulated protein 1", "gene_name": "HYOU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13751", "url": "https://www.uniprot.org/uniprotkb/Q13751" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 606, "start_aa": "Thr", "end_pos": 606, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr606", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q13751", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13751" }, { "id": "35289036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35289036" }, { "id": "Q13751", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q13751" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q13751-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 550, "start_aa": "Thr", "end_pos": 550, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr550", "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "Q08380", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q08380" }, { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "28411811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28411811" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "32574038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32574038" }, { "id": "28510447", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28510447" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "Q08380", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q08380" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q08380-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P08195", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08195" }, { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35083852" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "41018975", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41018975" }, { "id": "26853435", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26853435" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P08195-2" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 513, "start_aa": "Ser", "end_pos": 513, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser513", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 517, "start_aa": "Thr", "end_pos": 517, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr517", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 583, "start_aa": "Ser", "end_pos": 583, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser583", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 589, "start_aa": "Thr", "end_pos": 589, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr589", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 590, "start_aa": "Thr", "end_pos": 590, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr590", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 598, "start_aa": "Thr", "end_pos": 598, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr598", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 727, "start_aa": "Thr", "end_pos": 727, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr727", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 832, "start_aa": "Ser", "end_pos": 832, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser832", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 864, "start_aa": "Thr", "end_pos": 864, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr864", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 871, "start_aa": "Thr", "end_pos": 871, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr871", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 933, "start_aa": "Ser", "end_pos": 933, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser933", "evidence": [ { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9Y4L1" }, { "id": "34229054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34229054" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "39534244", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39534244" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" }, { "id": "32119511", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32119511" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "37217939", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37217939" }, { "id": "22661428", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22661428" }, { "id": "35008409", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35008409" }, { "id": "30444036", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30444036" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "30059200", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30059200" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "29249144", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29249144" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39531497" }, { "id": "40307207", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40307207" }, { "id": "33465208", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33465208" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35138101" }, { "id": "37541260", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" }, { "id": "Q9Y4L1", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9Y4L1" }, { "id": "35705054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35705054" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9Y4L1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "Q99567", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q99567" }, { "id": "21526146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21526146" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "21300897", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21300897" }, { "id": "33214551", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33214551" }, { "id": "20305658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20305658" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "22121020", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22121020" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "41018975", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41018975" }, { "id": "21740066", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21740066" }, { "id": "34725712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725712" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q99567-1" } ], "record_id": "pubmed.21526146", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 15 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 13 }, { "field": "exact_o_linked_sites", "count": 13 }, { "field": "exact_o_linked_glycan_sites", "count": 13 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 2 }, { "field": "fuzzy_o_linked_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 15 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 13 }, { "field": "exact_o_linked_sites", "count": 13 }, { "field": "exact_o_linked_glycan_sites", "count": 13 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 2 }, { "field": "fuzzy_o_linked_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 2 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]